NP_908998.1 has 1744 amino acids
Query: DUF4939 [M=112]
Accession: PF16297.9
Description: Domain of unknown function (DUF4939)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.2e-16 44.8 0.1 1.5e-15 43.3 0.1 1.7 1 NP_908998.1
Domain annotation for each sequence (and alignments):
>> NP_908998.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 43.3 0.1 1.5e-15 1.5e-15 25 105 .. 454 534 .. 434 538 .. 0.90
Alignments for each domain:
== domain 1 score: 43.3 bits; conditional E-value: 1.5e-15
DUF4939 25 ipfpelfdGeserlpefivqtlsymlvdektfssdalkvaflitrlkGralewvmpyiqkdspllnnyraflnemkeefGw 105
+p f+G+ ef+v m + +d+l+v f+i +l+ alew+ ++++sp++nn++afl+ m e+f +
NP_908998.1 454 LPSLRPFSGDRRDYHEFVVLCQMTMQNYPSMLYNDELRVKFVIRHLTDLALEWANDLVEQNSPVINNFSAFLEAMSEKFEY 534
566677*******************9999*************************************************987 PP
Or compare NP_908998.1 to CDD or PaperBLAST