Q7L3V2 has 364 amino acids
Query: DUF4939 [M=112] Accession: PF16297.9 Description: Domain of unknown function (DUF4939) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-14 40.5 0.0 1.9e-14 39.8 0.0 1.2 1 Q7L3V2 Domain annotation for each sequence (and alignments): >> Q7L3V2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 39.8 0.0 1.9e-14 1.9e-14 23 102 .. 99 178 .. 85 183 .. 0.90 Alignments for each domain: == domain 1 score: 39.8 bits; conditional E-value: 1.9e-14 DUF4939 23 npipfpelfdGeserlpefivqtlsymlvdektfssdalkvaflitrlkGralewvmpyiqkdspllnnyraflnemkee 102 p p +fdG l f+ q ym + ++++ + +v ++ rl+Gra+ w+ py++ d pl ++y+ f +++ke+ Q7L3V2 99 VPGSDPGTFDGSPWLLDRFLAQLGDYMSFHFEHYQDNISRVCEILRRLTGRAQAWAAPYLDGDLPLPDDYELFCQDLKEV 178 4555699**********************************************************************997 PP
Or compare Q7L3V2 to CDD or PaperBLAST