PaperBLAST – Find papers about a protein or its homologs

 

Align Q7L3V2 to PF16297 (DUF4939)

Q7L3V2 has 364 amino acids

Query:       DUF4939  [M=112]
Accession:   PF16297.9
Description: Domain of unknown function (DUF4939)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    1.1e-14   40.5   0.0    1.9e-14   39.8   0.0    1.2  1  Q7L3V2    


Domain annotation for each sequence (and alignments):
>> Q7L3V2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   39.8   0.0   1.9e-14   1.9e-14      23     102 ..      99     178 ..      85     183 .. 0.90

  Alignments for each domain:
  == domain 1  score: 39.8 bits;  conditional E-value: 1.9e-14
  DUF4939  23 npipfpelfdGeserlpefivqtlsymlvdektfssdalkvaflitrlkGralewvmpyiqkdspllnnyraflnemkee 102
               p   p +fdG    l  f+ q   ym  + ++++ +  +v  ++ rl+Gra+ w+ py++ d pl ++y+ f +++ke+
   Q7L3V2  99 VPGSDPGTFDGSPWLLDRFLAQLGDYMSFHFEHYQDNISRVCEILRRLTGRAQAWAAPYLDGDLPLPDDYELFCQDLKEV 178
              4555699**********************************************************************997 PP



Or compare Q7L3V2 to CDD or PaperBLAST