SwissProt::Q6P1Y1 has 553 amino acids
Query: DUF4939 [M=112]
Accession: PF16297.9
Description: Domain of unknown function (DUF4939)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.6e-11 30.3 0.0 2.8e-11 29.6 0.0 1.3 1 SwissProt::Q6P1Y1
Domain annotation for each sequence (and alignments):
>> SwissProt::Q6P1Y1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 29.6 0.0 2.8e-11 2.8e-11 14 103 .. 303 390 .. 289 397 .. 0.89
Alignments for each domain:
== domain 1 score: 29.6 bits; conditional E-value: 2.8e-11
DUF4939 14 arlrkrrwrnpipfpelfdGeserlpefivqtlsymlvdektfssdalkvaflitrlkGralewvmpyiqkdspllnnyraflnemkeef 103
a+ + + p+ +p f+ + ++l ef+vq +sy+ + + ++a v f+ + ++G+a + p ++++ pl+++++ +l ++++f
SwissProt::Q6P1Y1 303 AQCELEATTLPLEYPLAFSEDFQKLSEFLVQLTSYL--RSRGYPTEAALVSFVGSFFSGEAGRMFQPLLDSQPPLVEQFERLLRALQDTF 390
444556677899***********************7..6799**************************************9999998888 PP
Or compare SwissProt::Q6P1Y1 to CDD or PaperBLAST