B0XXQ4 has 834 amino acids
Query: DUF4965 [M=174] Accession: PF16335.9 Description: Domain of unknown function (DUF4965) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-67 212.9 1.4 6.1e-55 171.6 0.1 2.5 2 B0XXQ4 Domain annotation for each sequence (and alignments): >> B0XXQ4 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 171.6 0.1 6.1e-55 6.1e-55 4 127 .. 354 475 .. 351 492 .. 0.91 2 ! 39.8 0.2 1.9e-14 1.9e-14 131 174 .] 534 577 .. 528 577 .. 0.95 Alignments for each domain: == domain 1 score: 171.6 bits; conditional E-value: 6.1e-55 DUF4965 4 ekYadllalsvRqafaaleltgedntsdvllflKeissngnvntvdviypaaPlflylnpellkllLeplleyqesgrypkkyaahDlGtsYPnatghndge 105 +Y+d++als+Rq+++a+++ g+ +d++lflKeissngn++t+dvi+p++P+f+y+np++l +lLepl+e++ sg+yp++ya+hDlG+++Pnatgh dg+ B0XXQ4 354 YDYMDIVALSARQVMGATTFSGTP--DDPILFLKEISSNGNFQTIDVIFPSFPFFMYTNPRWLAYLLEPLIEHMLSGQYPNTYAMHDLGAHFPNATGHPDGR 453 69*******************766..9*************************************************************************** PP DUF4965 106 deqmpveesGnmlimalayaqa 127 de mpvee+Gnmlim la+++ B0XXQ4 454 DEYMPVEECGNMLIMGLAMVNS 475 *****************99875 PP == domain 2 score: 39.8 bits; conditional E-value: 1.9e-14 DUF4965 131 tsllkqyyelLkqwadYLvengldpanqlstddfagalanqtnL 174 ++++++ y+l +qw+ YLve +l panqlstddfag la qtnL B0XXQ4 534 EKWVQRSYRLWTQWTGYLVEYSLEPANQLSTDDFAGWLALQTNL 577 5899***************************************8 PP
Or compare B0XXQ4 to CDD or PaperBLAST