biolip::8tu9A has 533 amino acids
Query: DUF5009 [M=260]
Accession: PF16401.9
Description: Domain of unknown function (DUF5009)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.7e-11 30.2 2.1 5.3e-10 25.3 0.6 2.7 2 biolip::8tu9A
Domain annotation for each sequence (and alignments):
>> biolip::8tu9A
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 3.4 0.0 0.0025 0.0025 2 18 .. 138 154 .. 137 158 .. 0.88
2 ! 25.3 0.6 5.3e-10 5.3e-10 48 104 .. 171 227 .. 163 264 .. 0.91
Alignments for each domain:
== domain 1 score: 3.4 bits; conditional E-value: 0.0025
DUF5009 2 aksldalrGiaillmvl 18
+s+d++rGia++lmv+
biolip::8tu9A 138 LRSVDTFRGIALILMVF 154
579************97 PP
== domain 2 score: 25.3 bits; conditional E-value: 5.3e-10
DUF5009 48 pGitwvdlvfpfflfamGaaiplalkkkvekgssklkvlldiikrfvlltffalftm 104
G+t dlvfp+f+f mG++i l+++ ++g sk+++l +i+ r ll+ + +
biolip::8tu9A 171 NGLTVADLVFPWFVFIMGSSIFLSMTSILQRGCSKFRLLGKIAWRSFLLICIGIIIV 227
699******************************************999998887765 PP
Or compare biolip::8tu9A to CDD or PaperBLAST