reanno::SB2B:6936760 has 378 amino acids
Query: DUF5009 [M=260]
Accession: PF16401.9
Description: Domain of unknown function (DUF5009)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.9e-12 32.7 1.5 2.9e-12 32.7 1.5 1.7 2 reanno::SB2B:6936760
Domain annotation for each sequence (and alignments):
>> reanno::SB2B:6936760
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 32.7 1.5 2.9e-12 2.9e-12 2 160 .. 13 174 .. 12 185 .. 0.77
2 ? -2.2 0.3 0.13 0.13 162 162 .. 324 324 .. 268 372 .. 0.55
Alignments for each domain:
== domain 1 score: 32.7 bits; conditional E-value: 2.9e-12
DUF5009 2 aksldalrGiaillmvlsas..iafsilpgwmyhaqvpppghkfkpelpGitwvdlvfpfflfamGaaiplalkkkvekgssk.lkvll 87
sldalrG+ ++ ++ ia l gw + + + +++ e G t+ dl+fp+f+f G a+ l+ k+ + + ++ ++
reanno::SB2B:6936760 13 LMSLDALRGFDMFWILGGEKlfIALFALTGWSFWQLAD--AEMHHSEWHGFTFYDLIFPLFIFLSGVALGLSPKRLDKLAPAErNPIYR 99
579*******9886654443225667899**8876554..4556789*************************98877655554155777 PP
DUF5009 88 diikrfvlltffalftmharsyvlssepelk..eqllsivcfvllfllylsikkklkkkaalvikvvafllaial 160
+++kr ll + ++ h + ++ + +l ++f +f+ l ++ l+ + a+++ ++ ai l
reanno::SB2B:6936760 100 HAVKRLFLLLALGVLYNHGWGTGIPAHSDEVryASVLGRIAFAWFFAALLVWHTSLRTQIATALAILFGYAAIQL 174
9******99999999999988877766665411468888999999999999999999999999887755555554 PP
== domain 2 score: -2.2 bits; conditional E-value: 0.13
DUF5009 162 l 162
+
reanno::SB2B:6936760 324 A 324
0 PP
Or compare reanno::SB2B:6936760 to CDD or PaperBLAST