WP_001061334.1 has 189 amino acids
Query: Rv2179c-like [M=177] Accession: PF16473.9 Description: 3'-5' exoribonuclease Rv2179c-like domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-76 240.5 0.0 5.6e-76 240.3 0.0 1.0 1 WP_001061334.1 Domain annotation for each sequence (and alignments): >> WP_001061334.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 240.3 0.0 5.6e-76 5.6e-76 1 177 [] 2 178 .. 2 178 .. 0.98 Alignments for each domain: == domain 1 score: 240.3 bits; conditional E-value: 5.6e-76 Rv2179c-like 1 nhlmiDiEtlgneetaaivsIGavffdpetGelGeeFyarvdlesseeagaevdaeTikWWlkqssearaellkddaksledalkeleefieen. 94 n+lmiD+Et+g++++a++vsIGavffdp++Ge+G eFy++v+les++e+ga +d++Ti WWl+qs eara+++ d s+ +al e+++fi+ + WP_001061334.1 2 NNLMIDLETMGKKPNAPVVSIGAVFFDPQSGEIGPEFYTAVSLESAMEQGAVPDGDTILWWLRQSPEARAAICADA-VSVTTALIEFNDFITCHa 95 79***********************************************************************776.99************9888 PP Rv2179c-like 95 edakslkvwgngasfDnviLraafelagleipwkfwndrdvrTlvelakelglekkrdipfegvkhnAlddAkhqakivsaiw 177 +d k+lkvwgnga+fDnviLr afe+a l++ w++ nd+dvrT+v+l++++g+++krd+pfeg hnAl+dA+hqak+vsaiw WP_001061334.1 96 DDLKYLKVWGNGANFDNVILRGAFERASLPCLWNYRNDHDVRTMVTLGRAIGFDPKRDMPFEGDMHNALADARHQAKYVSAIW 178 999*******************************************************************************9 PP
Or compare WP_001061334.1 to CDD or PaperBLAST