WP_004147979.1 has 712 amino acids
Query: Rv2179c-like [M=177] Accession: PF16473.9 Description: 3'-5' exoribonuclease Rv2179c-like domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.6e-74 233.8 0.1 9.4e-74 233.1 0.1 1.4 1 WP_004147979.1 Domain annotation for each sequence (and alignments): >> WP_004147979.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 233.1 0.1 9.4e-74 9.4e-74 2 177 .] 519 696 .. 518 696 .. 0.99 Alignments for each domain: == domain 1 score: 233.1 bits; conditional E-value: 9.4e-74 Rv2179c-like 2 hlmiDiEtlgneetaaivsIGavffdpetGelGeeFyarvdlesseeagaevdaeTikWWlkqssearaellkddaksledalkeleefieen.. 94 h+m+D+Et+g++ +a+iv+IGav+fdp+tG++Ge+Fy++v less + ga +d +T+ WWlkqssear+++++dda++l+dal +++ef+++n WP_004147979.1 519 HVMVDLETMGKKYNAPIVAIGAVVFDPATGSIGESFYKVVCLESSVNWGAVIDPSTVIWWLKQSSEARSAIVNDDAIPLQDALLQFREFVSDNva 613 9********************************************************************************************99 PP Rv2179c-like 95 edakslkvwgngasfDnviLraafelagleipwkfwndrdvrTlvelakelglekkrdipfegvkhnAlddAkhqakivsaiw 177 + k+ +vwgngasfDn+iLr++++ + ++pw++wndrdvrT+vel++++++++k +ipfeg +hnAl+dA+hqa++vsaiw WP_004147979.1 614 GGSKKAQVWGNGASFDNSILRSSYDCIAEDYPWEYWNDRDVRTMVELGQAISFDPKTTIPFEGSRHNALADAIHQARYVSAIW 696 999************************999****************************************************9 PP
Or compare WP_004147979.1 to CDD or PaperBLAST