WP_021570798.1 has 823 amino acids
Query: Rv2179c-like [M=177] Accession: PF16473.9 Description: 3'-5' exoribonuclease Rv2179c-like domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-70 222.9 0.0 2.6e-70 221.8 0.0 1.6 1 WP_021570798.1 Domain annotation for each sequence (and alignments): >> WP_021570798.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 221.8 0.0 2.6e-70 2.6e-70 2 177 .] 642 813 .. 641 813 .. 0.98 Alignments for each domain: == domain 1 score: 221.8 bits; conditional E-value: 2.6e-70 Rv2179c-like 2 hlmiDiEtlgneetaaivsIGavffdpetGelGeeFyarvdlesseeagaevdaeTikWWlkqssearaellkddaksledalkeleefieened 96 hlmiD+Et+g++++a+i+sIGa+ffdp+tG++G eF +++dle + g+ +d +TikWWlkqs ea++++++d+ ++l+dal +l+efi en+ WP_021570798.1 642 HLMIDLETMGKNPDAPIISIGAIFFDPQTGDMGPEFSKTIDLETA---GGVIDRDTIKWWLKQSREAQSAIMTDE-IPLDDALLQLREFIDENSG 732 9*****************************************655...99**********************998.99***************** PP Rv2179c-like 97 akslkvwgngasfDnviLraafelagleipwkfwndrdvrTlvelakelglekkrdipfegvkhnAlddAkhqakivsaiw 177 + ++vwgnga+fDn+iLr+++e+ g+++pw+++ndrdvrT+vel+k+++++++ +ipfeg++hnAlddA++ ak+vs+iw WP_021570798.1 733 EFFVQVWGNGANFDNTILRRSYERQGIPCPWRYYNDRDVRTIVELGKAIDFDARTAIPFEGERHNALDDARYLAKYVSVIW 813 ********************************************************************************9 PP
Or compare WP_021570798.1 to CDD or PaperBLAST