B6SX84 has 121 amino acids
Query: DUF5323 [M=62]
Accession: PF17257.6
Description: Family of unknown function (DUF5323)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
8.5e-40 120.8 4.9 1.3e-39 120.3 4.9 1.3 1 B6SX84
Domain annotation for each sequence (and alignments):
>> B6SX84
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 120.3 4.9 1.3e-39 1.3e-39 2 58 .. 39 95 .. 38 99 .. 0.94
Alignments for each domain:
== domain 1 score: 120.3 bits; conditional E-value: 1.3e-39
DUF5323 2 gkgglviecSSRPqKKataHHmKtRPrKtqawDirRkPtvYapLPpLPpdwtlvssa 58
g ++l +ecSSRPqKK+t+HHmKtRP+Ktq+wDi+R+Pt Y+pLPpLPpdwtlv+s
B6SX84 39 GRAALAVECSSRPQKKGTKHHMKTRPKKTQPWDIKRRPTQYPPLPPLPPDWTLVASG 95
56789*************************************************986 PP
Or compare B6SX84 to CDD or PaperBLAST