biolip::6eriAf has 47 amino acids
Query: DUF5323 [M=62]
Accession: PF17257.6
Description: Family of unknown function (DUF5323)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.8e-33 98.5 6.6 8.3e-33 98.4 6.6 1.0 1 biolip::6eriAf
Domain annotation for each sequence (and alignments):
>> biolip::6eriAf
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 98.4 6.6 8.3e-33 8.3e-33 11 57 .. 1 47 [] 1 47 [] 0.98
Alignments for each domain:
== domain 1 score: 98.4 bits; conditional E-value: 8.3e-33
DUF5323 11 SSRPqKKataHHmKtRPrKtqawDirRkPtvYapLPpLPpdwtlvss 57
SSRPqKK+taHHmKtRP+Kt wDi+R+P+vY+pLPpLP++wt+vss
biolip::6eriAf 1 SSRPQKKGTAHHMKTRPKKTARWDIKRGPAVYPPLPPLPAEWTIVSS 47
9********************************************85 PP
Or compare biolip::6eriAf to CDD or PaperBLAST