VIMSS914454 has 59 amino acids
Query: VraX [M=55]
Accession: PF17412.6
Description: Family of unknown function
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.4e-43 131.9 1.8 2.7e-43 131.8 1.8 1.0 1 VIMSS914454
Domain annotation for each sequence (and alignments):
>> VIMSS914454
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 131.8 1.8 2.7e-43 2.7e-43 1 55 [] 1 55 [. 1 55 [. 0.99
Alignments for each domain:
== domain 1 score: 131.8 bits; conditional E-value: 2.7e-43
VraX 1 miiYRryieeGaPvYeiitktFktvsikCDesFsdteiykLLsLLedDvDnmkvs 55
miiYRr+ie+G+PvYeiitktFkt++ikCDe+F+++eiy+LLsLLe+DvDnm++s
VIMSS914454 1 MIIYRRNIENGTPVYEIITKTFKTITIKCDETFNKYEIYQLLSLLENDVDNMPTS 55
9****************************************************98 PP
Or compare VIMSS914454 to CDD or PaperBLAST