VIMSS1727308 has 71 amino acids
Query: DUF5431 [M=70]
Accession: PF17496.6
Description: Family of unknown function (DUF5431)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
8.1e-42 127.6 0.1 8.9e-42 127.5 0.1 1.0 1 VIMSS1727308
Domain annotation for each sequence (and alignments):
>> VIMSS1727308
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 127.5 0.1 8.9e-42 8.9e-42 1 70 [] 1 70 [. 1 70 [. 0.99
Alignments for each domain:
== domain 1 score: 127.5 bits; conditional E-value: 8.9e-42
DUF5431 1 mseqhqdsLLprvaqGeegHEtaaKrpyLvcinrvlhvvniHvsDpkiavRdpaerRrqGGygktGLRir 70
ms+qhq++LLp+ qG+++HEt++KrpyLv+inrvlhvv+iH++Dp++ vR+pae+R+qG yg+ GLRir
VIMSS1727308 1 MSDQHQYGLLPCKLQGGVNHETTGKRPYLVRINRVLHVVDIHTPDPESPVRSPAEGRIQGSYGNNGLRIR 70
9********************************************************************8 PP
Or compare VIMSS1727308 to CDD or PaperBLAST