NP_690046.3 has 139 amino acids
Query: DUF5533 [M=139] Accession: PF17685.5 Description: Family of unknown function (DUF5533) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-84 267.7 8.6 1.5e-84 267.5 8.6 1.0 1 NP_690046.3 Domain annotation for each sequence (and alignments): >> NP_690046.3 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 267.5 8.6 1.5e-84 1.5e-84 1 139 [] 1 139 [] 1 139 [] 1.00 Alignments for each domain: == domain 1 score: 267.5 bits; conditional E-value: 1.5e-84 DUF5533 1 mpvipiprrvrsfhgphttclhsacgsvrasklvrtkynnfdlylksrlmysflrfllyfscslltsllwvalsilfflqylsvrvllrlqyklsvil 98 mpv+piprrvrsfhgphttclh+acg+vras+l rtkynnfd+y+k+r++y+f+rfllyfscsl+t+ lw al++lf+lqyl+vrvllr+q klsv+l NP_690046.3 1 MPVMPIPRRVRSFHGPHTTCLHAACGPVRASHLARTKYNNFDVYIKTRWLYGFIRFLLYFSCSLFTAALWGALAALFCLQYLGVRVLLRFQRKLSVLL 98 9************************************************************************************************* PP DUF5533 99 lllgrrrldfsllnelliyslqvtmllvgglgwcfmvfvdm 139 lllgrrr+df l+nell+y+++vtmllvgglgwcfmvfvdm NP_690046.3 99 LLLGRRRVDFRLVNELLVYGIHVTMLLVGGLGWCFMVFVDM 139 ****************************************9 PP
Or compare NP_690046.3 to CDD or PaperBLAST