WP_016575220.1 has 121 amino acids
Query: Rv2175c_C [M=56]
Accession: PF18367.5
Description: Rv2175c C-terminal domain of unknown function
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.9e-33 100.1 0.2 4.7e-33 99.4 0.2 1.3 1 WP_016575220.1
Domain annotation for each sequence (and alignments):
>> WP_016575220.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 99.4 0.2 4.7e-33 4.7e-33 1 56 [] 65 120 .. 65 120 .. 0.99
Alignments for each domain:
== domain 1 score: 99.4 bits; conditional E-value: 4.7e-33
Rv2175c_C 1 VkgLpGtltvLrDgGfddeeilrWLFteDesLpgrPidALregrkrEVkRrAqalA 56
VkgL Gtlt+LrD+Gf dee+l+WLFt+D++Lpg+P +ALre+r++EVkRrAqalA
WP_016575220.1 65 VKGLVGTLTLLRDDGFADEEMLEWLFTADDTLPGTPAQALRENRGTEVKRRAQALA 120
9******************************************************8 PP
Or compare WP_016575220.1 to CDD or PaperBLAST