SwissProt::Q8GED8 has 105 amino acids
Query: DUF6092 [M=86]
Accession: PF19585.3
Description: Family of unknown function (DUF6092)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.3e-33 101.4 0.5 1.5e-33 101.2 0.5 1.0 1 SwissProt::Q8GED8
Domain annotation for each sequence (and alignments):
>> SwissProt::Q8GED8
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 101.2 0.5 1.5e-33 1.5e-33 1 86 [] 14 99 .. 14 99 .. 0.98
Alignments for each domain:
== domain 1 score: 101.2 bits; conditional E-value: 1.5e-33
DUF6092 1 eellellaYlltSArglldEPasYGplRlldaarrllelleeagksdeeleelreeieevkekamtdeeefaelLdeliaklaeel 86
ee+++l++Yll+S+rgll+EPa+YG +R+ d+arr+l+ll+e+g s ++l+++re+++ev+ +m++++++ ++Ld+l++++a++l
SwissProt::Q8GED8 14 EEIALLAVYLLSSGRGLLEEPADYGIYRCTDGARRALQLLDEHGGSTARLTAVRERLDEVMFAPMGEDRDMGAILDDLCRQMADAL 99
7999*******************************************************************************975 PP
Or compare SwissProt::Q8GED8 to CDD or PaperBLAST