WP_013152195.1 has 105 amino acids
Query: DUF6092 [M=86]
Accession: PF19585.3
Description: Family of unknown function (DUF6092)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.1e-35 106.3 0.1 4.7e-35 106.1 0.1 1.0 1 WP_013152195.1
Domain annotation for each sequence (and alignments):
>> WP_013152195.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 106.1 0.1 4.7e-35 4.7e-35 1 86 [] 13 97 .. 13 97 .. 0.98
Alignments for each domain:
== domain 1 score: 106.1 bits; conditional E-value: 4.7e-35
DUF6092 1 eellellaYlltSArglldEPasYGplRlldaarrllelleeagksdeeleelreeieevkekamtdeeefaelLdeliaklaeel 86
eell+l+aYll+S+rglldEP++YG++R+ldaarr+l+l + +g++++el++lr ++++v++++m+d +e+++lLd+++++la++l
WP_013152195.1 13 EELLLLAAYLLSSGRGLLDEPRQYGTFRCLDAARRVLALAAGTGPHHPELDALRGRMDDVMCGPMGD-HELDTLLDQMCERLATVL 97
799****************************************************************.**************9875 PP
Or compare WP_013152195.1 to CDD or PaperBLAST