PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS942592 to PF19802 (DUF6285)

VIMSS942592 has 116 amino acids

Query:       DUF6285  [M=91]
Accession:   PF19802.3
Description: Domain of unknown function (DUF6285)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.3e-25   76.3   0.8    1.7e-25   75.9   0.8    1.2  1  VIMSS942592  


Domain annotation for each sequence (and alignments):
>> VIMSS942592  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   75.9   0.8   1.7e-25   1.7e-25       3      91 .]      26     111 ..      23     111 .. 0.96

  Alignments for each domain:
  == domain 1  score: 75.9 bits;  conditional E-value: 1.7e-25
      DUF6285   3 legraaFharVaaNalaiveRelalgpaaaaaerarlaallgedgdlealnaeLaaaIrageldldtpallahLratvlakLavdnPky 91 
                  +++r++F+++Va  al+i++Relalg+a a+++r++l  llg+++ l +l ++Laa+Ir+g+     p+++a L+a v++kL+v+ Pky
  VIMSS942592  26 ADPRLRFQTLVALSALGIARRELALGEALAEEDRRELGTLLGREAPLGELLRTLAAKIREGQAP---PGTFAFLKAHVARKLKVASPKY 111
                  589**********************************************************776...89*******************9 PP



Or compare VIMSS942592 to CDD or PaperBLAST