E1BHN4 has 5015 amino acids
Query: ZnF_RZ-type [M=54] Accession: PF20173.2 Description: RZ type zinc finger domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-22 64.9 2.6 6.6e-22 63.3 2.6 2.0 1 E1BHN4 Domain annotation for each sequence (and alignments): >> E1BHN4 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 63.3 2.6 6.6e-22 6.6e-22 8 53 .. 4312 4357 .. 4303 4358 .. 0.90 Alignments for each domain: == domain 1 score: 63.3 bits; conditional E-value: 6.6e-22 ZnF_RZ-type 8 tghwYkCpnGHpYvigeCGrameesrCpeCgatIGGeshnlaagnt 53 +wY+CpnGH++ +geCG++m++s C +C+a+IGG +h +++g++ E1BHN4 4312 GVTWYTCPNGHVCSVGECGKPMQQSFCIDCRAPIGGINHLPKEGFR 4357 589*************************************999986 PP
Or compare E1BHN4 to CDD or PaperBLAST