NP_001376200.1 has 1907 amino acids
Query: ZnF_RZ-type [M=54]
Accession: PF20173.2
Description: RZ type zinc finger domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.3e-27 79.1 1.9 7.3e-27 79.1 1.9 4.0 5 NP_001376200.1
Domain annotation for each sequence (and alignments):
>> NP_001376200.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? -7.9 4.2 1 1 24 37 .. 1432 1444 .. 1432 1447 .. 0.69
2 ? -11.3 8.9 1 1 32 40 .. 1473 1481 .. 1470 1497 .. 0.62
3 ? -4.7 6.8 1 1 16 38 .. 1538 1558 .. 1536 1560 .. 0.83
4 ? -3.3 0.2 0.41 0.41 32 41 .. 1609 1618 .. 1605 1618 .. 0.81
5 ! 79.1 1.9 7.3e-27 7.3e-27 8 53 .. 1833 1878 .. 1824 1879 .. 0.93
Alignments for each domain:
== domain 1 score: -7.9 bits; conditional E-value: 1
ZnF_RZ-type 24 eCGrameesrCpeC 37
+CG+a ++C C
NP_001376200.1 1432 DCGHACP-GSCHSC 1444
7888874.567777 PP
== domain 2 score: -11.3 bits; conditional E-value: 1
ZnF_RZ-type 32 srCpeCgat 40
++Cp C++t
NP_001376200.1 1473 GECPPCQRT 1481
566666654 PP
== domain 3 score: -4.7 bits; conditional E-value: 1
ZnF_RZ-type 16 nGHpYvigeCGrameesrCpeCg 38
+GHp+ ig CG++ +C C+
NP_001376200.1 1538 CGHPC-IGLCGEPCP-RKCRVCH 1558
89998.8******86.5788886 PP
== domain 4 score: -3.3 bits; conditional E-value: 0.41
ZnF_RZ-type 32 srCpeCgatI 41
+ Cp C+ +I
NP_001376200.1 1609 KVCPICQVPI 1618
68****9987 PP
== domain 5 score: 79.1 bits; conditional E-value: 7.3e-27
ZnF_RZ-type 8 tghwYkCpnGHpYvigeCGrameesrCpeCgatIGGeshnlaagnt 53
+ghw+kCpnGH+Yvi+eCG+am++s+CpeC++ IGGe+h+l+++n
NP_001376200.1 1833 RGHWFKCPNGHIYVITECGGAMQRSTCPECQEVIGGENHTLERSNH 1878
89***************************************99985 PP
Or compare NP_001376200.1 to CDD or PaperBLAST