Q8R151 has 1909 amino acids
Query: ZnF_RZ-type [M=54]
Accession: PF20173.2
Description: RZ type zinc finger domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.1e-27 79.2 2.3 7.1e-27 79.2 2.3 4.1 5 Q8R151
Domain annotation for each sequence (and alignments):
>> Q8R151
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? -6.2 3.3 1 1 24 37 .. 1432 1444 .. 1431 1447 .. 0.72
2 ? -10.9 8.7 1 1 31 40 .. 1472 1481 .. 1468 1496 .. 0.74
3 ? -5.1 7.1 1 1 16 38 .. 1538 1558 .. 1536 1560 .. 0.82
4 ? -3.3 0.2 0.41 0.41 32 41 .. 1609 1618 .. 1605 1618 .. 0.81
5 ! 79.2 2.3 7.1e-27 7.1e-27 8 53 .. 1834 1879 .. 1826 1880 .. 0.91
Alignments for each domain:
== domain 1 score: -6.2 bits; conditional E-value: 1
ZnF_RZ-type 24 eCGrameesrCpeC 37
+CG++ ++C C
Q8R151 1432 DCGHPCP-GSCHSC 1444
7999874.567777 PP
== domain 2 score: -10.9 bits; conditional E-value: 1
ZnF_RZ-type 31 esrCpeCgat 40
+++Cp C++t
Q8R151 1472 TGECPPCQRT 1481
5678888765 PP
== domain 3 score: -5.1 bits; conditional E-value: 1
ZnF_RZ-type 16 nGHpYvigeCGrameesrCpeCg 38
+GHp+ ig CG++ ++C C+
Q8R151 1538 CGHPC-IGLCGEPCP-KKCRVCQ 1558
89998.8******86.4788885 PP
== domain 4 score: -3.3 bits; conditional E-value: 0.41
ZnF_RZ-type 32 srCpeCgatI 41
+ Cp C+ +I
Q8R151 1609 KVCPICQVPI 1618
68****9987 PP
== domain 5 score: 79.2 bits; conditional E-value: 7.1e-27
ZnF_RZ-type 8 tghwYkCpnGHpYvigeCGrameesrCpeCgatIGGeshnlaagnt 53
+ghw+kCpnGH+Yvi+eCG+am++s+CpeC++ IGGe+h+l+++n
Q8R151 1834 RGHWFKCPNGHIYVITECGGAMQRSTCPECQEVIGGENHTLERSNH 1879
8****************************************99985 PP
Or compare Q8R151 to CDD or PaperBLAST