SwissProt::A0A0R4I9Y1 has 5061 amino acids
Query: ZnF_RZ-type [M=54]
Accession: PF20173.2
Description: RZ type zinc finger domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.3e-20 58.3 1.8 2.3e-20 58.3 1.8 2.4 3 SwissProt::A0A0R4I9Y1
Domain annotation for each sequence (and alignments):
>> SwissProt::A0A0R4I9Y1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? -2.5 0.1 0.23 0.23 36 47 .. 255 266 .. 254 271 .. 0.80
2 ? -2.6 0.1 0.24 0.24 30 41 .. 3989 4000 .. 3984 4009 .. 0.80
3 ! 58.3 1.8 2.3e-20 2.3e-20 8 53 .. 4445 4490 .. 4437 4491 .. 0.91
Alignments for each domain:
== domain 1 score: -2.5 bits; conditional E-value: 0.23
ZnF_RZ-type 36 eCgatIGGeshn 47
eC++++G+++ n
SwissProt::A0A0R4I9Y1 255 ECEEKVGDNQKN 266
9******98766 PP
== domain 2 score: -2.6 bits; conditional E-value: 0.24
ZnF_RZ-type 30 eesrCpeCgatI 41
e + Cp C+++
SwissProt::A0A0R4I9Y1 3989 EAQHCPVCREPL 4000
6789****9986 PP
== domain 3 score: 58.3 bits; conditional E-value: 2.3e-20
ZnF_RZ-type 8 tghwYkCpnGHpYvigeCGrameesrCpeCgatIGGeshnlaagnt 53
+ ++Y C n H +++geCGr+m +s+C +Cg +IGGe+h+++ g+t
SwissProt::A0A0R4I9Y1 4445 KLKMYFCSNSHACFVGECGRPMAKSKCATCGVEIGGEGHIPVPGFT 4490
7799*************************************99986 PP
Or compare SwissProt::A0A0R4I9Y1 to CDD or PaperBLAST