XP_006534693.1 has 5192 amino acids
Query: ZnF_RZ-type [M=54]
Accession: PF20173.2
Description: RZ type zinc finger domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.2e-23 66.8 2.3 2.3e-22 64.7 2.3 2.2 1 XP_006534693.1
Domain annotation for each sequence (and alignments):
>> XP_006534693.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 64.7 2.3 2.3e-22 2.3e-22 8 53 .. 4489 4534 .. 4480 4535 .. 0.91
Alignments for each domain:
== domain 1 score: 64.7 bits; conditional E-value: 2.3e-22
ZnF_RZ-type 8 tghwYkCpnGHpYvigeCGrameesrCpeCgatIGGeshnlaagnt 53
+ +wY+Cp+GHp+ +geCGr+m+es+C +Cg ++GG +h++++g++
XP_006534693.1 4489 NVTWYTCPRGHPCSVGECGRPMQESTCLDCGLPVGGLNHTPHEGFS 4534
689***************************************9986 PP
Or compare XP_006534693.1 to CDD or PaperBLAST