SwissProt::P43600 has 232 amino acids
Query: DUF6736 [M=129]
Accession: PF20521.2
Description: Family of unknown function (DUF6736)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.3e-13 35.1 0.0 9.4e-13 34.6 0.0 1.3 1 SwissProt::P43600
Domain annotation for each sequence (and alignments):
>> SwissProt::P43600
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 34.6 0.0 9.4e-13 9.4e-13 42 120 .. 131 208 .. 104 213 .. 0.91
Alignments for each domain:
== domain 1 score: 34.6 bits; conditional E-value: 9.4e-13
DUF6736 42 liksksdansCtttsGtaegvkyaykatgknCdTtAekkTiqgAiekllkevekkkvceteClelsHgGtweGylrlga 120
i + + +C+ + G + + y+y+ + nC+ t ++kTi A++++ ++++ + ++++ gG w+G + +g
SwissProt::P43600 131 DIFGMTNMGNCAVMAGDKGAFYYKYYPVEPNCNSTIHQKTIDDALQQATEQLN-GDFNNMYFFHVNRGGLWQGDMMVGT 208
67889999*******************************************98.5666699**************9997 PP
Or compare SwissProt::P43600 to CDD or PaperBLAST