Family Search for PF02594 (DUF167)

PF02594 hits 25 sequences in PaperBLAST's database above the trusted cutoff. Showing all hits. Or show only hits to curated sequences or try another family.

Bd0463 hypothetical protein from Bdellovibrio bacteriovorus HD100
Aligns to 8:80 / 94 (77.7%), covers 98.7% of PF02594, 91.3 bits

• DivIVA Controls Progeny Morphology and Diverse ParA Proteins Regulate Cell Division or Gliding Motility in Bdellovibrio bacteriovorus
  Milner, Frontiers in microbiology 2020
  • “...pyrroline-5-carboxylate reductase (Bd0465 accession: NP_967453.1 ) and upstream of a gene encoding an YggU homolog (Bd0463 accession: NP_967451.1 ). (B) Alignment of DivIVA Bb with DivIVA homologs in Streptococcus pneumoniae (DivIVA Spn ; accession: AAC95445.1 ) and Bacillus subtilis (DivIVA Bsub ; accession: P71021.1 ). Sequences...”
  • “...( Figure 6 and Supplementary Figure S5 ). No interaction was detected between DivIVA Bd -Bd0463, and for DivIVA Bd with ParA1, ParA2 or ParA3. We later turned to analyze Par protein function (see below) as there is a potential three-way interaction between Bd0465-DivIVA Bd ,...”

VP2619 conserved hypothetical protein from Vibrio parahaemolyticus RIMD 2210633
Aligns to 11:83 / 96 (76.0%), covers 98.7% of PF02594, 89.9 bits

• Rapid identification of Vibrio parahaemolyticus by whole-cell matrix-assisted laser desorption ionization-time of flight mass spectrometry
  Hazen, Applied and environmental microbiology 2009
  • “...VP2817 VP2331 VP0160 VP1210 VP0261 VPA0321 VPA0286 VP2627 VP2619 VP2029 VPA0577 VP2530 VP0646 VP0448 VP0283 50S ribosomal protein L30 Zinc-binding protein 50S...”

B598_0277 DUF167 family protein from Chlamydia psittaci GR9
Aligns to 5:77 / 92 (79.3%), covers 96.1% of PF02594, 89.1 bits

• Data of de novo genome assembly of the Chlamydia psittaci strain isolated from the livestock in Volga Region, Russian Federation
  Feodorova, Data in brief 2020
  • “...261,710..262,906 B598_0275 FI836_03980 86.80 8 putative lipoprotein 263,013..263,957 B598_0276 FI836_03985 92.28 9 hypothetical protein 263,962..264,240 B598_0277 FI836_03990 92.45 10 ABC transporter substrate binding family protein 263,962..264,240 B598_0278 FI836_03995 93.77 11 ll -diaminopimelate aminotransferase 265,277..266,473 B598_0279 FI836_04000 91.31 12 hypothetical protein 266,738..267,508 B598_0280 FI836_04005 84.77 13 hypothetical...”

YggU / b2953 DUF167 domain-containing protein YggU from Escherichia coli K-12 substr. MG1655 (see 2 papers)
P52060 UPF0235 protein YggU from Escherichia coli (strain K12)
Aligns to 10:82 / 96 (76.0%), covers 98.7% of PF02594, 88.4 bits

• Knowns and Unknowns of Vitamin B₆ Metabolism in Escherichia coli
  Tramonti, EcoSal Plus 2021 (secret)

asl3196 hypothetical protein from Nostoc sp. PCC 7120
Aligns to 2:72 / 75 (94.7%), covers 94.7% of PF02594, 88.2 bits

• Nitrogen-regulated antisense transcription in the adaptation to nitrogen deficiency in Nostoc sp. PCC 7120
  Brenes-Álvarez, PNAS nexus 2023
  • “...alr3554 TU02337 all3556-ilvB TU02841 3.86 2.58 PCC7120DELTA_RS22895 TU02840 argJ2 TU02078 3.81 2.08 alr3195 E-DIF TU02079 asl3196 TU02080 all3197 TU01767 3.78 3.22 all2747 TU01765 alr2745alr2746 TU02125 3.75 2.59 asr3279 NtcA TU02124 all3278 TU01093 3.71 2.86 asr1734 TU01094 all1736 TU00968 3.64 2.72 patD TU00967 all1549 TU02430 3.59 1.80...”

APL_1380 hypothetical protein from Actinobacillus pleuropneumoniae L20
Aligns to 12:84 / 97 (75.3%), covers 98.7% of PF02594, 86.0 bits

• Effects of growth conditions on biofilm formation by Actinobacillus pleuropneumoniae
  Labrie, Veterinary research 2010
  • “...APL_0090 APL_0090 Hypothetical protein 1.360 APL_1709 APL_1709 Hypothetical protein 1.307 APL_0357 APL_0357 Hypothetical protein 1.328 APL_1380 APL_1380 Hypothetical protein 1.394 APL_1729 APL_1729 Hypothetical protein 1.401 APL_1062 APL_1062 Hypothetical protein 1.468 APL_0179 APL_0179 Hypothetical protein 1.481 APL_0940 APL_0940 Hypothetical protein 1.482 APL_1273 APL_1273 Putative fimbrial biogenesis and...”
• Host-pathogen interactions of Actinobacillus pleuropneumoniae with porcine lung and tracheal epithelial cells
  Auger, Infection and immunity 2009
  • “...Berkeley Hypothetical/unclassified/unknown APL_0568 APL_1459 APL_1690 APL_1471 APL_1380 APL_2002 APL_0750 APL_1575 APL_1103 APL_1854 APL_0217 Gene 1436 AUGER ET...”

CEF07_01320, CHAB577_0262 DUF167 domain-containing protein from Chlamydia abortus
Aligns to 5:77 / 96 (76.0%), covers 96.1% of PF02594, 85.7 bits

• Data of de novo genome assembly of the Chlamydia psittaci strain isolated from the livestock in Volga Region, Russian Federation
  Feodorova, Data in brief 2020
  • “...48 C. abortus GN6 CP021996.1 hypothetical protein 262,872..263,816 CEF07_01315 FI836_03985 99.68 49 hypothetical protein 263,821..264,111 CEF07_01320 FI836_03990 98.92 50 ABC transporter substrate-binding protein 264,096..265,139 CEF07_01325 FI836_03995 2 Experimental design, materials, and methods 2.1 DNA extraction, Illumina and nanopore sequencing, and assembly Total DNA was extracted from...”
  • “...HrcA 258,322..259,482 CHAB577_0258 FI836_03970 36 uncharacterized protein 261,590..262,786 CHAB577_0260 FI836_03980 97.16 37 uncharacterized protein 263,842..264,132 CHAB577_0262 FI836_03990 99.43 38 putative ABC transporter substrate-binding protein 264,117..265,160 CHAB577_0263 FI836_03995 39 l , l -diaminopimelate aminotransferase 265,157..266,353 CHAB577_0264 FI836_04000 40 putative ABC transporter substrate-binding protein 264,117..265,160 CHAB577_0263 FI836_03995 99.33...”

CG14966 uncharacterized protein from Drosophila melanogaster
Aligns to 49:121 / 140 (52.1%), covers 97.4% of PF02594, 85.1 bits

• New levels of transcriptome complexity at upper thermal limits in wild Drosophila revealed by exon expression analysis
  Telonis-Scott, Genetics 2013
  • “...exon analysis Genea Intron/s (bp) Acp54A1 CG32198 CG15357 CG14966 Robl37BC obst-I CG30487 CG18125 CG6974 Acp29AB GstE7 GstE1 CG4461b Hsp23b fan CG32271 Hsp26b...”
  • “...or regulated by HSF including CG18125, GstE7, GstE1, and CG14966, with the latter being adjacent to Hsp83 (Birch-Machin et al. 2005; Jensen et al. 2008;...”
• The molecular chaperone Hsp90 is required for cell cycle exit in Drosophila melanogaster
  Bandura, PLoS genetics 2013
  • “...the Hsp83 genomic rescue construct also contains the entire coding sequence for the neighboring genes CG14966 and CG32276 [44] . Although we have not sequenced these genes in the mutant strain to confirm that they are unaltered, both reside in a region that remains intact in...”
• Hsp90 is important for fecundity, longevity, and buffering of cryptic deleterious variation in wild fly populations
  Chen, BMC evolutionary biology 2012
  • “...of the gene CG14965 immediately upstream of Hsp83 , as well as the entire gene CG14966 immediately downstream of Hsp83 (see additional file 8 and sequences in additional file 9 of the 3 primer pairs (i) CG14965-S1F and S1R, (ii) S2F and S2R, (iii) S3F and...”
  • “...). This region covers the whole Hsp83 coding region and most of the downstream gene CG14966 . This analysis found no polymorphisms. To determine if the Hsp83 mutation was in linkage disequilibrium with the inversion Inv(3L)P , we genotyped the Hsp83 mutant and wild-type lines for...”
• Genomic analysis of heat-shock factor targets in Drosophila
  Birch-Machin, Genome biology 2005
  • “...the ChIP also reveals a second peak at the 3' of Hsp83 extending to cover CG14966 (a gene of unknown function) and 3' to CG32276 , a predicted chaperone. This additional signal contains matches with an Hsf consensus binding sequence, suggesting that it represents a bona...”

Atu2660 hypothetical protein from Agrobacterium tumefaciens str. C58 (Cereon)
Aligns to 91:168 / 183 (42.6%), covers 98.7% of PF02594, 82.4 bits

• Transcription Factor PecS Mediates Agrobacterium fabrum Fitness and Survival
  Nwokocha, Journal of bacteriology 2023 (secret)

APJL_1398 hypothetical protein from Actinobacillus pleuropneumoniae serovar 3 str. JL03
Aligns to 12:85 / 98 (75.5%), covers 92.1% of PF02594, 82.3 bits

• Global effects of catecholamines on Actinobacillus pleuropneumoniae gene expression
  Li, PloS one 2012
  • “...protein 2.28 2.07 APJL_1024 - inner membrane protein 2.54 1.86 APJL_1143 pfkA phosphofructokinase 2.84 2.62 APJL_1398 - hypothetical protein 1.75 1.60 APJL_1942 - Zn-dependent protease with chaperone function 1.58 1.56 APJL_1992 - integral membrane protein 2.12 1.54 APL_0443 - autotransporter adhesin 1.54 1.61 APL_0540 - thiamine...”

RL4503 hypothetical protein from Rhizobium leguminosarum bv. viciae 3841
Aligns to 11:88 / 103 (75.7%), covers 98.7% of PF02594, 81.7 bits

• The Use of Transposon Insertion Sequencing to Interrogate the Core Functional Genome of the Legume Symbiont Rhizobium leguminosarum
  Perry, Frontiers in microbiology 2016
  • “...protein RL4016 TGI 5 0.8 27.5 NE 5 0 0 GD 0.0.2 Conserved hypothetical protein RL4503 TGI 4 0.75 3 NE 4 1 4.75 GD 0.0.2 Conserved hypothetical protein PLASMID GROWTH IMPAIRED HYPOTHETICAL PROTEINS pRL100111 PGI 38 0.45 3.18 GD 38 0.45 3.71 ES 0.0.0 Hypothetical...”

LOC8055455 UPF0235 protein C15orf40 homolog from Sorghum bicolor
Aligns to 41:113 / 131 (55.7%), covers 98.7% of PF02594, 81.2 bits

• Deciphering the Genetic Mechanisms of Salt Tolerance in Sorghum bicolor L.: Key Genes and SNP Associations from Comparative Transcriptomic Analyses
  Jeon, Plants (Basel, Switzerland) 2023
  • “...mitogen-activated protein kinase kinase kinase 2 3 3 LOC8059087 vacuolar cation/proton exchanger 1c 2 1 LOC8055455 UPF0235 protein C15orf40 homolog 2 1 LOC8077931 peptide chain release factor PrfB3, chloroplastic 2 1 LOC8055150 mitochondrial carnitine/acylcarnitine carrier-like protein 2 1 LOC8065993 inosine-5-monophosphate dehydrogenase 2 1 LOC8064978 F-box/kelch-repeat protein...”

AT1G49170 hypothetical protein from Arabidopsis thaliana
Aligns to 36:108 / 126 (57.9%), covers 98.7% of PF02594, 80.8 bits

• Natural variation identifies new effectors of water-use efficiency in Arabidopsis
  Bhaskara, Proceedings of the National Academy of Sciences of the United States of America 2022
  • “...general control nonrepressible 20 ( gcn20-2 ), and a hypothetical protein with unknown function ( at1g49170 ) had a strong decrease in biomass as well as strongly reduced water consumption ( Fig. 4 ). However, biomass was more strongly reduced, leading to a substantial decrease in...”
  • “...temperatures and no change in SD, consistent with a previous report ( 37 ). The AT1G49170 mutant also had decreased leaf temperature ( Fig. 4 and SI Appendix , Fig. S8 ). Fig. 4. Mutants of 13 genes had reduced biomass and reduced water consumption as...”

CT388 hypothetical protein from Chlamydia trachomatis D/UW-3/CX
Aligns to 5:77 / 100 (73.0%), covers 96.1% of PF02594, 80.0 bits

• Genome sequencing of recent clinical Chlamydia trachomatis strains identifies loci associated with tissue tropism and regions of apparent recombination
  Jeffrey, Infection and immunity 2010
  • “...are in ORFs CT171 to CT183 and ORFs CT360 to CT388 (Fig. 5A). The differences between genomes in these regions included SNPs, indels as large as 308 nucleotides...”

CT_388 hypothetical protein from Chlamydia trachomatis D/UW-3/CX
Aligns to 20:92 / 115 (63.5%), covers 96.1% of PF02594, 79.1 bits

• Chlamydia trachomatis Whole-Proteome Microarray Analysis of The Netherlands Chlamydia Cohort Study
  Hufnagel, Microorganisms 2019
  • “...CT_799 50S ribosomal protein 9 6.2% 23 CT_116 inclusion membrane protein E 17 11.7% 48 CT_388 hypothetical protein 9 6.2% 24 CT_242 OmpH-like outer membrane protein 17 11.7% 49 CT_578 hypothetical protein 9 6.2% 25 CT_759 muramidase 17 11.7% 50 CT_226 hypothetical protein 9 6.2% Antigen...”

lpg2716 Hypothetical protein from Legionella pneumophila subsp. pneumophila str. Philadelphia 1
Aligns to 9:81 / 95 (76.8%), covers 97.4% of PF02594, 79.1 bits

• Induction of caspase 3 activation by multiple Legionella pneumophila Dot/Icm substrates
  Zhu, Cellular microbiology 2013
  • “...replication. Deletion of single caspase-3 activator or all five of these genes (Lpg0898, Lpg1625, Lpg0716, Lpg2716, and Lpg2831) did not cause detectable defect in caspase-3 activation ( Fig. S6 ). Consistent with this observation, the 5 mutant did not display any defect in intracellular bacterial growth...”
  • “...al. , 2003 ). Non-polar deletions of each or the combination of lpg0716, lpg0898, lpg1625, lpg2716 , and lpg2831 were constructed as described elsewhere ( Luo et al. , 2004 ). In each case, primers were designed such that the open reading frame was replaced by...”

Dde_2170 Uncharacterized conserved protein from Desulfovibrio desulfuricans G20
Aligns to 14:86 / 118 (61.9%), covers 98.7% of PF02594, 78.2 bits

• Transcriptomics and Functional Analysis of Copper Stress Response in the Sulfate-Reducing Bacterium Desulfovibrio alaskensis G20
  Tripathi, International journal of molecular sciences 2022
  • “...2.77 0.54 Dde_0111 # Zinc resistance-associated protein 8.56 0.30 Dde_4025 # Uncharacterized protein 7.07 0.64 Dde_2170 # UPF0235 protein Dde_2170 6.48 0.39 Dde_2819 # Uncharacterized protein 6.11 0.27 Dde_3737 # Putative GAF sensor protein 5.98 0.77 Dde_2991 # Transcription termination/antitermination protein, NusG 5.97 0.36 Dde_3226 #...”
  • “...aminopeptidase 1.68 0.69 Dde_0925 ** Uncharacterized protein 1.67 0.62 Dde_0715 ## Uncharacterized protein 5.93 0.32 Dde_2170 ## UPF0235 protein Dde_2170 5.72 0.37 Dde_4025 ## Uncharacterized protein 5.58 0.63 Dde_0356 ## Flagellar basal body rod protein FlgB 5.34 0.35 Dde_0221 ## Response regulator receiver protein 5.17 0.42...”

O26734 UPF0235 protein MTH_637 from Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Aligns to 13:84 / 104 (69.2%), covers 98.7% of PF02594, 77.4 bits

• Insight into the protein solubility driving forces with neural attention.
  Raimondi, PLoS computational biology 2020
  • “...mutational screening of proteins, as shown in Fig 3 for UPF0235 protein MTH_637 (Uniprot ID: O26734), which is present in the test dataset [ 22 ]. The protein is annotated as soluble in the dataset, and SKADE predicts it correctly (score of 0.733). We implemented each...”
  • “...S values (in blue) decrease it. Fig 3 shows that, since the predicted solubility of O26734 is already very high, most of the mutations have the effect of decreasing the predicted solubility. In particular, there are few regions with very high effect, such as the residues...”

SPO0937 DUF167 domain-containing protein from Ruegeria pomeroyi DSS-3
Aligns to 19:89 / 92 (77.2%), covers 93.4% of PF02594, 77.2 bits

• Experimental Identification of Small Non-Coding RNAs in the Model Marine Bacterium Ruegeria pomeroyi DSS-3
  Rivers, Frontiers in microbiology 2016
  • “...ABC transporter, ATP-binding Transport 0.008 SPO0831 Xanthine dehydrogenase family, medium subunit Nucleic acid metabolism 0.009 SPO0937 Hypothetical protein 0.009 trans21 264 SPO1144 Universal stress protein family protein 0.003 SPO2761 Pantothenate kinase Coenzyme metabolism 0.004 SPO0685 Fumarylacetoacetase Amino acid metabolism 0.005 SPO2385 Benzaldehyde lyase, putative 0.007 trans28...”

A1G_07140 hypothetical protein from Rickettsia rickettsii str. 'Sheila Smith'
Aligns to 13:89 / 105 (73.3%), covers 97.4% of PF02594, 71.7 bits

• Limited transcriptional responses of Rickettsia rickettsii exposed to environmental stimuli
  Ellison, PloS one 2009
  • “...A1G_07355 (RrIowa1570) 4.26 A1G_06080 (RrIowa1305) 4.02 RrIowa0127 c 3.86 A1G_06415 (RrIowa1374) 3.80 A1G_02825 (RrIowa0593) 3.76 A1G_07140 (RrIowa1526) 3.76 A1G_02575 (RrIowa0544) 3.75 A1G_01810 (RrIowa0384) 3.71 A1G_07135 (RrIowa1524) 3.69 A1G_06075 (RrIowa1304) 3.67 A1G_06375 (RrIowa1366) 3.61 A1G_00925 (RrIowa0201) 3.59 A1G_00120 (RrIowa0027) 3.52 A1G_03785 (RrIowa0796) 3.51 RrIowa1046 c 3.49 A1G_07280...”
  • “...1.85 Hypothetical d RrIowa0127 e 1.95 3.86 Hypothetical d A1G_04310 (RrIowa0905) 1.91 11.73 Hypothetical d A1G_07140 (RrIowa1526) 1.85 3.76 Hypothetical A1G_06375 (RrIowa1366) 1.79 3.61 1.40.1 3.50.3 Hypothetical A1G_00070 (RrIowa0016) 1.68 3.25 Hypothetical d A1G_07280 (RrIowa1556) 1.66 3.36 cytidylyltransferase A1G_04305 (RrIowa0904) 1.58 18.55 1.70.4 14.32.6 Hypothetical d...”

MT2038 hypothetical protein from Mycobacterium tuberculosis CDC1551
Aligns to 3:75 / 76 (96.1%), covers 94.7% of PF02594, 70.9 bits

• Microarray analysis of the Mycobacterium tuberculosis transcriptional response to the acidic conditions found in phagosomes
  Fisher, Journal of bacteriology 2002
  • “...Rv3361c Rv3655c Rv1645c Rv3481c Rv3679 Rv2305 MT2405 Rv3541c MT2038 Rv2893 MT0740.1 Rv2599 Rv2791c Rv3409c a nuoA efpA pitB mhpE fadE12 aspB nuoG pcnA choD...”

Y6344_ARATH / Q8GWQ6 UPF0235 protein At5g63440 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
NP_568972 hypothetical protein (DUF167) from Arabidopsis thaliana
AT5G63440 hypothetical protein from Arabidopsis thaliana
Aligns to 143:215 / 232 (31.5%), covers 98.7% of PF02594, 65.0 bits

• function: May play a role during early embryonic development. Probably involved in pre-mRNA splicing (By similarity).
  subunit: Interacts with CTN.
  disruption phenotype: No visible phenotype.
• COP1 SUPPRESSOR 4 promotes seedling photomorphogenesis by repressing CCA1 and PIF4 expression in Arabidopsis.
  Zhao, Proceedings of the National Academy of Sciences of the United States of America 2018
  • GeneRIF: The study suggests that CSU4 acts as a negative regulator of CCA1 via physically associating with CCA1, which in turn, likely serves to repress expression of CCA1 and PIF4 to promote photomorphogenesis. [CSU4]
• COP1 SUPPRESSOR 4 promotes seedling photomorphogenesis by repressing CCA1 and PIF4 expression in Arabidopsis
  Zhao, Proceedings of the National Academy of Sciences of the United States of America 2018
  • “...csu4-1 (SI Appendix, Fig. S1). Next, we amplified the At5g63440 in csu4-2 cop1-6 using PCR. Next, the PCR products were subjected to sequencing, and a C-to-T...”
  • “...acid 667 from the start code (ATG) in At5g63440, causing a premature stop code at the 41st codon in 11632 | www.pnas.org/cgi/doi/10.1073/pnas.1813171115 Fig. 2....”

Mmah_0207 protein of unknown function DUF167 from Methanohalophilus mahii DSM 5219
D5E990 UPF0235 protein Mmah_0207 from Methanohalophilus mahii (strain ATCC 35705 / DSM 5219 / SLP)
Aligns to 13:88 / 103 (73.8%), covers 98.7% of PF02594, 63.1 bits

• Rapid identification of haloarchaea and methanoarchaea using the matrix assisted laser desorption/ionization time-of-flight mass spectrometry
  Shih, Scientific reports 2015
  • “...protein L31e MENERIYTIPLRDVTNKVPTTKRAPRAIKKIREYLQKHMKSDNVKLDNSIN EKVWERSLNKIPARVRVKAVKQDDVVIATLVE Methanohalophilus mahii DSM 5219 T D5E990 11436.11 11433.53/20 0.02 UPF0235 protein Mmah_0207 MPIRDAIHTKGNGCIIDFEINPGSSKLVVPSGYNIWRKRVEGKLTESAQKGK ANDQLIQRLSHIFQINSSSITIVAGAKTTKKSVHLENVYPKTAEDVLEQYL a Protein accession number from NCBI protein database. b The protein was described from Methanosarcina mazei G1 T . c The protein was described from Methanococcus voltaei A3...”
• Rapid identification of haloarchaea and methanoarchaea using the matrix assisted laser desorption/ionization time-of-flight mass spectrometry
  Shih, Scientific reports 2015
  • “...c 9740.40 9751.67/43 0.12 50S ribosomal protein L31e MENERIYTIPLRDVTNKVPTTKRAPRAIKKIREYLQKHMKSDNVKLDNSIN EKVWERSLNKIPARVRVKAVKQDDVVIATLVE Methanohalophilus mahii DSM 5219 T D5E990 11436.11 11433.53/20 0.02 UPF0235 protein Mmah_0207 MPIRDAIHTKGNGCIIDFEINPGSSKLVVPSGYNIWRKRVEGKLTESAQKGK ANDQLIQRLSHIFQINSSSITIVAGAKTTKKSVHLENVYPKTAEDVLEQYL a Protein accession number from NCBI protein database. b The protein was described from Methanosarcina mazei G1 T . c The protein...”

LBF_5037 hypothetical protein from Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'
Aligns to 1:72 / 75 (96.0%), covers 96.1% of PF02594, 57.7 bits

• Genome sequence of the saprophyte Leptospira biflexa provides insights into the evolution of Leptospira and the pathogenesis of leptospirosis
  Picardeau, PloS one 2008
  • “...LBF_5020 SPN2291 Exodeoxyribonuclease V, gamma subunit 41270 42064 LBF_5030 SPN0228 Bacteriophage-related protein * 53226 52999 LBF_5037 SPN1718 Conserved hypothetical protein 60761 60456 LBF_5044 SPN3221 Antitoxin of toxin-antitoxin stability system 61204 60767 LBF_5045 SPN3222 Hypothetical protein 62047 63093 LBF_5047 SPN1129 Homoserine kinase 63112 64008 LBF_5048 SPN1151 GGDEF...”

CLIBASIA_00580 hypothetical protein from Candidatus Liberibacter asiaticus str. psy62
Aligns to 1:80 / 98 (81.6%), covers 94.7% of PF02594, 55.7 bits

• "Candidatus Liberibacter asiaticus" Secretes Nonclassically Secreted Proteins That Suppress Host Hypersensitive Cell Death and Induce Expression of Plant Pathogenesis-Related Proteins
  Du, Applied and environmental microbiology 2021 (secret)

Or search for genetic data about PF02594 in the Fitness Browser