Family Search for PF04379 (DUF525)
PF04379 hits 17 sequences in PaperBLAST's database above the trusted cutoff. Showing all hits. Or show only hits to curated sequences or try another family.
PA0591 hypothetical protein (NCBI) from Pseudomonas aeruginosa PAO1
Aligns to 18:104 / 126 (69.0%), covers 97.7% of PF04379, 123.9 bits
- The Small RNAs PA2952.1 and PrrH as Regulators of Virulence, Motility, and Iron Metabolism in Pseudomonas aeruginosa.
Coleman, Applied and environmental microbiology 2021 (secret) - Pseudomonas aeruginosa cells attached to a surface display a typical proteome early as 20 minutes of incubation
Crouzet, PloS one 2017 - “...difference in attachment ability compared to PAO1 control ( S8 Table ). 3 of them (PA0591, PA0950 and PA3675) presented an increase in the attachment capacity (ratio 1.5 to 1.6). For the others (PA0180, PA2235, PA2864, PA3160 and PA3435) there is a large decrease in attachment...”
- “...a flavodoxin and PA2864 encoding a protein of unknown function. Interestingly, for 3 mutant strains (PA0591, PA0950 and PA3675) a net increase in the attachment capacity was observed (ratio 1.5 to 1.6). No clear function is attributed to these genes but we can hypothesize that these...”
ApaG / b0050 DUF525 domain-containing protein ApaG from Escherichia coli K-12 substr. MG1655 (see 5 papers)
P62672 Protein ApaG from Escherichia coli (strain K12)
NP_414592 DUF525 domain-containing protein ApaG from Escherichia coli str. K-12 substr. MG1655
b0050 hypothetical protein (NCBI) from Escherichia coli str. K-12 substr. MG1655
S0049 hypothetical protein (NCBI ptt file) from Shigella flexneri 2a str. 2457T
ECs0055 hypothetical protein (NCBI ptt file) from Escherichia coli O157:H7 str. Sakai
DR76_RS13325 Co2+/Mg2+ efflux protein ApaG from Escherichia coli ATCC 25922
Aligns to 17:103 / 125 (69.6%), covers 97.7% of PF04379, 115.6 bits
- Knowns and Unknowns of Vitamin B6 Metabolism in Escherichia coli.
Tramonti, EcoSal Plus 2021 - “...The penultimate gene of the operon is apaG , encoding a DUF525 domain-containing protein (UniProt P62672), whereas the last gene is apaH coding for a diadenosine tetraphosphatase (Uniprot P05637). Both apaG and apaH belong to a group of genes involved in stress-activated mutagenesis ( 53 )....”
- Identification of bacterial factors involved in type 1 fimbria expression using an Escherichia coli K12 proteome chip
Chen, Molecular & cellular proteomics : MCP 2014 - “...NP_416335 NP_416680 NP_415195 NC_000913 NP_414786 NP_414592 NP_415912 NP_417164 NP_415785 NP_416249 NP_417399 NP_417573 NP_415468 NP_418508 NP_415858 NP_417776...”
- Functional genomics analysis of free fatty acid production under continuous phosphate limiting conditions
Youngquist, Journal of industrial microbiology & biotechnology 2017 - “...2 potassium translocating ATPase, subunit C b4111 proP 8.2 2.7 10 4 proline/glycine betaine transporter b0050 apaG 2.0 1.8 10 2 protein associated with Co2+ and Mg 2+ efflux Pentose phosphate b b1852 zwf 2.4 8.0 10 4 glucose-6-phosphate dehydrogenase b0767 pgl 2.0 4.8 10 2...”
- Directional RNA-seq reveals highly complex condition-dependent transcriptomes in E. coli K12 through accurate full-length transcripts assembling
Li, BMC genomics 2013 - “...in at least one of our seven samples (Additional file 14 ), and 21 ( b0050, b0137, b1356, b1382, b1419, b1446, b1457, b1607, b1952, b1998, b3471, b3638, b3937, b4325, b4335, b4336, b4593, b4596, b4610, b4615 and b4620 ) of them were expressed in all the seven...”
- Transcriptomic analysis of Escherichia coli O157:H7 and K-12 cultures exposed to inorganic and organic acids in stationary phase reveals acidulant- and strain-specific acid tolerance responses
King, Applied and environmental microbiology 2010 - “...b0884 ECs5321 ECs0206 ECs3395 ECs0055 ECs2569 b4361 b0210 b2529 b0050 b1859 bcsE (yhjS) yecJ yhcN yheO yaiZ ybeD ydcX yebG yohJ yieP rrmJ yiaU zntR xseA nudE...”
- Microarray analysis of orthologous genes: conservation of the translational machinery across species at the sequence and expression level
Jiménez, Genome biology 2003 - “...isomerase rRNA modification and chaperone b0049 Yes* COG0639 T Diadenosine tetraphosphatase rRNA modification and chaperone b0050 No COG2967 P Uncharacterized protein affecting Mg 2+ /Co 2+ transport rRNA modification and chaperone b0051 Yes** COG0030 J 6-m-2-A methyltransferase; put. 16S rRNA methyltransferase rRNA modification and chaperone b0052...”
- A functional update of the Escherichia coli K-12 genome
Serres, Genome biology 2001 - “...solvent tolerance b0201 rrsH n 16S rRNA b0001 ec_G0001 thrL l thr operon leader peptide b0050 ec_0078 apaG o Conserved protein b0081 ec_0123 mraZ o Conserved hypothetical protein b0005 ec_G0005 yaaX o Unknown CDS * Gene product type: c, carrier; e, enzyme; f, factor; h, extrachromosomal...”
- Combined, functional genomic-biochemical approach to intermediary metabolism: interaction of acivicin, a glutamine amidotransferase inhibitor, with Escherichia coli K-12
Smulski, Journal of bacteriology 2001 - “...fimA fis fixX flgD b3256 b4015 b4016 b1623 b0111 b0050 b0564 b0469 b0908 b2601 b1704 b3433 b0930 b1597 b3734 b3731 b3732 b3736 b3572 b0778 b1270 b1661 b2155...”
- A multiplex oligonucleotide ligation-PCR as a complementary tool for subtyping of Salmonella Typhimurium
Wuyts, Applied microbiology and biotechnology 2015 - “...showed variation among 8 DT1 S . Typhimurium isolates (S0031, S0032, S0036, S0041, S0042, S0043, S0049 and S0050 in Data set S1), which were screened earlier to determine a positive control for the PCR with these markers. For each SNP marker, PCR amplicons were sequenced of...”
- Transcriptomic analysis of Escherichia coli O157:H7 and K-12 cultures exposed to inorganic and organic acids in stationary phase reveals acidulant- and strain-specific acid tolerance responses
King, Applied and environmental microbiology 2010 - “...and metabolism ECs0969 ECs1601 b1129 b0884 ECs5321 ECs0206 ECs3395 ECs0055 ECs2569 b4361 b0210 b2529 b0050 b1859 bcsE (yhjS) yecJ yhcN yheO yaiZ ybeD ydcX yebG...”
- Virulence and transcriptome profile of multidrug-resistant Escherichia coli from chicken
Hussain, Scientific reports 2017 - “...Iron-enterobactin transporter membrane protein 1.87 0.01 DR76_RS23065 Ferrienterobactin ABC transporter periplasmic binding protein 1.80 0.01 DR76_RS13325 Cobalt transporter 1.54 0.01 DR76_RS12185 Fe3+ dicitrate ABC transporter permease 1.40 0.01 DR76_RS23085 Iron-enterobactin transporter ATP-binding protein 1.42 0.01 DR76_RS12180 Iron ABC transporter 1.24 0.01 DR76_RS12205 fecR Fec operon regulator...”
PFLU5579 hypothetical protein (RefSeq) from Pseudomonas fluorescens SBW25
Aligns to 18:104 / 126 (69.0%), covers 97.7% of PF04379, 112.6 bits
C5975_08880 Co2+/Mg2+ efflux protein ApaG from Cronobacter sakazakii
Aligns to 17:103 / 125 (69.6%), covers 97.7% of PF04379, 112.3 bits
- Draft genomes of Cronobacter sakazakii strains isolated from dried spices bring unique insights into the diversity of plant-associated strains
Jang, Standards in genomic sciences 2018 - “...RND efflux (C5975_02520, Transporter), proteins associated with heavy metal efflux of nickel/cobalt (C5975_13445, RcnB), cobalt/magnesium (C5975_08880, ApaG), and manganese ions (C5975_18840, MntP), sugar efflux (C5975_13720, SetB), and multidrug resistance (MdtA, MdtH, MdtD). There were on average 513, 110, 1520 proteins that were annotated as integrases, transposases,...”
FBX3_HUMAN / Q9UK99 F-box only protein 3 from Homo sapiens (Human) (see 3 papers)
Aligns to 294:384 / 471 (19.3%), covers 96.6% of PF04379, 101.7 bits
- function: Substrate recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex, SCF(FBXO3), which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (PubMed:18809579, PubMed:26037928). Mediates the ubiquitination of HIPK2 and probably that of EP300, leading to rapid degradation by the proteasome (PubMed:18809579). In the presence of PML, HIPK2 ubiquitination still occurs, but degradation is prevented (PubMed:18809579). PML, HIPK2 and FBXO3 may act synergically to activate p53/TP53-dependent transactivation (PubMed:18809579). The SCF(FBXO3) also acts as a regulator of inflammation by mediating ubiquitination and degradation of FBXL2 in response to lipopolysaccharide (LPS) (PubMed:26037928). The SCF(FBXO3) complex specifically recognizes FBXL2 phosphorylated at 'Thr-404' and promotes its ubiquitination (By similarity).
subunit: Part of a SCF (SKP1-cullin-F-box) protein ligase complex SCF(FBXO3) consisting of FBXO3, SKP1, CUL1 and RBX1 (PubMed:18809579). Interacts with PML, interaction is direct and takes place either alone or within the SCF complex (PubMed:18809579).
subunit: (Microbial infection) Isoform 1 and 2 interact with Rift valley fever virus NSs; this interaction is important for GT2H1 degradation. - Multi-chaperone function modulation and association with cytoskeletal proteins are key features of the function of AIP in the pituitary gland.
Hernández-Ramírez, Oncotarget 2018 - “...) Co-F [ 105 ] P03372 Oestrogen receptor ( ESR1 ) Co-IP [ 106 ] Q9UK99 F-box only protein 3 ( FBXO3 ) Co-IP, AC-MS [ 7 ] P50395 Rab GDP dissociation inhibitor beta ( GDIB ) Co-F [ 107 ] Q14344 Guanine nucleotide-binding protein subunit...”
- “...ILGLLDTHLKTR KFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELR 10 D4ABP9 FBX3_RAT F-box only protein 3 ( Fbxo3 ) 55.4 EEDLDAVEAQIGCKLPDDYR 91 Q9UK99 FBX3_HUMAN F-box only protein 3 ( FBXO3 ) 54.6 ITNAKGDVEEVQGPGVVGEFPIISPGR 11 Q99PF5 FUBP2_RAT Far upstream element-binding protein 2 ( Khsrp ) 74.2 KDAFADAVQR 98 Q92945 FUBP2_HUMAN Far upstream element-binding protein...”
- Acetylation-regulated interaction between p53 and SET reveals a widespread regulatory mode.
Wang, Nature 2016 - “...Q96KQ7 Q8IX15 Q8WYB5 P19338 Q5H9L4 Q13029 P27797 Q9UER7 Q4LE39 Q9UPS6-2 P39687 P09429 Q9BT43 P17480 Q15911 Q9UK99 Q9Y4B6 Proline-, glutamic acid- and leucine-rich protein 1 Acidic leucine-rich nuclear phosphoprotein 32 family member B Myelin transcription factor 1-like protein Myelin transcription factor 1 Zinc finger and BTB domain-containing...”
- Virulence factor NSs of rift valley fever virus recruits the F-box protein FBXO3 to degrade subunit p62 of general transcription factor TFIIH.
Kainulainen, Journal of virology 2014 - Quantitative proteomics with siRNA screening identifies novel mechanisms of trastuzumab resistance in HER2 amplified breast cancers
Boyer, Molecular & cellular proteomics : MCP 2013 - “...factor Transmembrane protein 165 BT474 SILAC experiment Q6VVX0 Q9UK99 Q9Y6S9 Q8N3P4 Q59H77 CYP2R1 FBXO3 RPS6KL1 VPS8 CCT3 P81605 Q13268 Q15303 P02452 Q13332...”
- SUMOylation of the Forkhead transcription factor FOXL2 promotes its stabilization/activation through transient recruitment to PML bodies.
Georges, PloS one 2011 - “...P38398 + RNF6 Q9Y252 + RBCK1 Q9BYM8 + MDM2 Q00987 + E6AP Q05086 + FBX3/SCF Q9UK99 + CULLIN1 Q13616 + SKP1 P63208 + PLZF Q05516 + UBP7 Q93009 Enzymes involved in post-translational modifications of proteins and described as associated with PML Nuclear Bodies, according to Van...”
XP_006234719 F-box only protein 3 isoform X3 from Rattus norvegicus
Aligns to 294:384 / 417 (21.8%), covers 96.6% of PF04379, 100.2 bits
FBX3_MOUSE / Q9DC63 F-box only protein 3 from Mus musculus (Mouse) (see paper)
NP_997598 F-box only protein 3 isoform 1 from Mus musculus
Aligns to 294:384 / 480 (19.0%), covers 96.6% of PF04379, 99.9 bits
- function: Substrate recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex, SCF(FBXO3), which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity). Mediates the ubiquitination of HIPK2 and probably that of EP300, leading to rapid degradation by the proteasome (By similarity). In the presence of PML, HIPK2 ubiquitination still occurs, but degradation is prevented (By similarity). PML, HIPK2 and FBXO3 may act synergically to activate p53/TP53-dependent transactivation (By similarity). The SCF(FBXO3) also acts as a regulator of inflammation by mediating ubiquitination and degradation of FBXL2: specifically recognizes FBXL2 phosphorylated at 'Thr-404' and promotes its ubiquitination (PubMed:23542741).
subunit: Part of a SCF (SKP1-cullin-F-box) protein ligase complex SCF(FBXO3) consisting of FBXO3, SKP1, CUL1 and RBX1. Interacts with PML, interaction is direct and takes place either alone or within the SCF complex. - E3 Ubiquitin Ligase FBXO3 Drives Neuroinflammation to Aggravate Cerebral Ischemia/Reperfusion Injury.
Gao, International journal of molecular sciences 2022 - GeneRIF: E3 Ubiquitin Ligase FBXO3 Drives Neuroinflammation to Aggravate Cerebral Ischemia/Reperfusion Injury.
- FBXO3 Protein Promotes Ubiquitylation and Transcriptional Activity of AIRE (Autoimmune Regulator).
Shao, The Journal of biological chemistry 2016 - GeneRIF: AIRE, which is phosphorylated on two specific residues near its N terminus, then binds to the F-box protein 3 (FBXO3) E3 ubiquitin ligase. In turn, this SCF(FBXO3) (SKP1-CUL1-F box) complex ubiquitylates AIRE, increases its binding to the positive transcription elongation factor b (P-TEFb), and potentiates its transcriptional activity.
- Proteomic analysis reveals semaglutide impacts lipogenic protein expression in epididymal adipose tissue of obese mice.
Zhu, Frontiers in endocrinology 2023 - “...kDa heat shock protein ATPase homolog 2 Ahsa2 0.801091655 P41242 Megakaryocyte-associated tyrosine-protein kinase Matk 0.568717607 Q9DC63 F-box only protein 3 Fbxo3 0.722183075 P56375 Acylphosphatase-2 Acyp2 0.589639337 Q6TCG2 Membrane progesterone receptor epsilon Paqr9 0.620337924 Q6IME9 Keratin, type II cytoskeletal 72 Krt72 0.562148059 B1AZA5 Transmembrane protein 245 Tmem245...”
- Characterization and Proteomic-Transcriptomic Investigation of Monocarboxylate Transporter 6 Knockout Mice: Evidence of a Potential Role in Glucose and Lipid Metabolism
Jones, Molecular pharmacology 2019 (secret) - Amyloid Precursor Protein (APP) May Act as a Substrate and a Recognition Unit for CRL4CRBN and Stub1 E3 Ligases Facilitating Ubiquitination of Proteins Involved in Presynaptic Functions and Neurodegeneration
Del, The Journal of biological chemistry 2016 - “...Q8CH72 O08759 Q5U430 A2AN08 Q80TP3 Q9WUD1 Q3TCH7 A2A432 Q3U1J4 Q80T85 Q8N7N5 Q9DC63 Q8VDH1 A2RT62 Q8C7D2 64 179 483 42 103 20 55 72 101 213 572 308 35 88 111...”
- “...Usp9x Q3U1J4 Q8C7D2 Q9WUD1 Q3TCH7 P46935 Q7TQI3 P56399 Q02053 O88544 A2RT62 Q9DC63 Q9Z1K5 Q8N7N5 Q9QZM0 A2AN08 P70398 127 51 35 88 103 31 96 118 46 52 55 64 66...”
D4ABP9 F-box only protein 3 from Rattus norvegicus
Aligns to 294:384 / 480 (19.0%), covers 96.6% of PF04379, 99.8 bits
NP_001277074 polymerase delta-interacting protein 2 isoform 2 from Homo sapiens
Aligns to 233:320 / 350 (25.1%), covers 95.4% of PF04379, 90.0 bits
- Metabolic regulation of the proteasome under hypoxia by Poldip2 controls fibrotic signaling in vascular smooth muscle cells.
Paredes, Free radical biology & medicine 2023 - GeneRIF: Metabolic regulation of the proteasome under hypoxia by Poldip2 controls fibrotic signaling in vascular smooth muscle cells.
- Endothelial Poldip2 regulates sepsis-induced lung injury via Rho pathway activation.
Dolmatova, Cardiovascular research 2022 - GeneRIF: Endothelial Poldip2 regulates sepsis-induced lung injury via Rho pathway activation.
- Poldip2/Nox4 Mediates Lipopolysaccharide-Induced Oxidative Stress and Inflammation in Human Lung Epithelial Cells.
Wang, Mediators of inflammation 2022 - GeneRIF: Poldip2/Nox4 Mediates Lipopolysaccharide-Induced Oxidative Stress and Inflammation in Human Lung Epithelial Cells.
- [PolDIP2 regulates mitochondrial functioning and cellular metabolism].
Andjongo, Medecine sciences : M/S 2021 (PubMed)- GeneRIF: [PolDIP2 regulates mitochondrial functioning and cellular metabolism].", trans "PolDIP2, une proteine cle de la regulation du fonctionnement mitochondrial et du metabolisme cellulaire.
- Crystal structure and molecular dynamics of human POLDIP2, a multifaceted adaptor protein in metabolism and genome stability.
Kulik, Protein science : a publication of the Protein Society 2021 - GeneRIF: Crystal structure and molecular dynamics of human POLDIP2, a multifaceted adaptor protein in metabolism and genome stability.
- Human Polymerase δ-Interacting Protein 2 (PolDIP2) Inhibits the Formation of Human Tau Oligomers and Fibrils.
Kasho, International journal of molecular sciences 2021 - GeneRIF: Human Polymerase delta-Interacting Protein 2 (PolDIP2) Inhibits the Formation of Human Tau Oligomers and Fibrils.
- Mitochondrial Protein Poldip2 (Polymerase Delta Interacting Protein 2) Controls Vascular Smooth Muscle Differentiated Phenotype by O-Linked GlcNAc (N-Acetylglucosamine) Transferase-Dependent Inhibition of a Ubiquitin Proteasome System.
Paredes, Circulation research 2020 - GeneRIF: Poldip2 deficiency in human aortic vascular smooth muscle in vitro induces the expression of the SRF , myocardin, and MRTFA and dramatically represses KLF4. Poldip2 deficiency upregulates the hexosamine biosynthetic pathway and OGT (O-linked N-acetylglucosamine transferase)-mediated protein O-GlcNAcylation. Poldip2 deficiency induces a highly differentiated phenotype in VSMCs by regulating metabolism and proteostasis.
- A Multifunctional Protein PolDIP2 in DNA Translesion Synthesis.
Gagarinskaya, Advances in experimental medicine and biology 2020 (PubMed)- GeneRIF: functional interaction of PolDIP2 with human DNA polymerases and the possible functions in DNA damage response
- More
NP_080665 polymerase delta-interacting protein 2 precursor from Mus musculus
Q91VA6 Polymerase delta-interacting protein 2 from Mus musculus
Aligns to 251:338 / 368 (23.9%), covers 95.4% of PF04379, 89.9 bits
- Endothelial Poldip2 regulates sepsis-induced lung injury via Rho pathway activation.
Dolmatova, Cardiovascular research 2022 - GeneRIF: Endothelial Poldip2 regulates sepsis-induced lung injury via Rho pathway activation.
- Myeloid Poldip2 Contributes to the Development of Pulmonary Inflammation by Regulating Neutrophil Adhesion in a Murine Model of Acute Respiratory Distress Syndrome.
Ou, Journal of the American Heart Association 2022 - GeneRIF: Myeloid Poldip2 Contributes to the Development of Pulmonary Inflammation by Regulating Neutrophil Adhesion in a Murine Model of Acute Respiratory Distress Syndrome.
- Poldip2 controls leukocyte infiltration into the ischemic brain by regulating focal adhesion kinase-mediated VCAM-1 induction.
Eidson, Scientific reports 2021 - GeneRIF: Poldip2 controls leukocyte infiltration into the ischemic brain by regulating focal adhesion kinase-mediated VCAM-1 induction.
- Characterization of Poldip2 knockout mice: Avoiding incorrect gene targeting.
Lassègue, PloS one 2021 - GeneRIF: Characterization of Poldip2 knockout mice: Avoiding incorrect gene targeting.
- Mitochondrial Protein Poldip2 (Polymerase Delta Interacting Protein 2) Controls Vascular Smooth Muscle Differentiated Phenotype by O-Linked GlcNAc (N-Acetylglucosamine) Transferase-Dependent Inhibition of a Ubiquitin Proteasome System.
Paredes, Circulation research 2020 - GeneRIF: Preservation of the differentiated phenotype in Poldip2+/- mice inhibits neointima formation after injury. Poldip2 deficiency induces a highly differentiated phenotype in VSMCs through a mechanism that involves regulation of metabolism and proteostasis.
- Poldip2 mediates blood-brain barrier disruption and cerebral edema by inducing AQP4 polarity loss in mouse bacterial meningitis model.
Gao, CNS neuroscience & therapeutics 2020 - GeneRIF: Poldip2 mediates blood-brain barrier disruption and cerebral edema by inducing AQP4 polarity loss in mouse bacterial meningitis model.
- Poldip2 deficiency protects against lung edema and vascular inflammation in a model of acute respiratory distress syndrome.
Forrester, Clinical science (London, England : 1979) 2019 - GeneRIF: Heterozygous deletion of Poldip2 protects against lung edema and vascular inflammation in a model of acute respiratory distress syndrome.
- Hepatic deficiency of Poldip2 in type 2 diabetes dampens lipid and glucose homeostasis.
Jiang, Metabolism: clinical and experimental 2019 (PubMed)- GeneRIF: hepatic dysregulation of Poldip2 may contribute to diabetic dyslipidemia and hyperglycemia
- More
- Evolutionary constraints of phosphorylation in eukaryotes, prokaryotes, and mitochondria
Gnad, Molecular & cellular proteomics : MCP 2010 - “...Q01279 Q60932 Q60932 Q02013 A2APH4 Q9WTQ5 P97315 Q924Z4 Q91VA6 Q8C064 P14602 Q03265 Q9Z1T1 O88587 Q9CQF4 P67778 Q9CRD0 Q63918 P53986 Tsfm Glud1 Pc Hars2 Sntb1...”
E9PT51 DNA polymerase delta interacting protein 2 from Rattus norvegicus
Aligns to 251:338 / 368 (23.9%), covers 95.4% of PF04379, 89.9 bits
PDIP2_HUMAN / Q9Y2S7 Polymerase delta-interacting protein 2; 38 kDa DNA polymerase delta interaction protein; p38 from Homo sapiens (Human) (see 5 papers)
NP_056399 polymerase delta-interacting protein 2 isoform 1 from Homo sapiens
Aligns to 251:338 / 368 (23.9%), covers 95.4% of PF04379, 89.9 bits
G3GTP7 Vitronectin from Cricetulus griseus
Aligns to 759:846 / 876 (10.0%), covers 95.4% of PF04379, 88.5 bits
LOC100809876 F-box protein SKIP16-like from Glycine max
Aligns to 321:416 / 443 (21.7%), covers 94.3% of PF04379, 88.2 bits
SKI16_ARATH / Q9LND7 F-box protein SKIP16; SKP1-interacting partner 16 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
AT1G06110 SKIP16 (SKP1/ASK-interacting protein 16); protein binding (RefSeq) from Arabidopsis thaliana
Aligns to 313:409 / 436 (22.2%), covers 95.4% of PF04379, 87.9 bits
- function: Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.
subunit: Part of a SCF (ASK-cullin-F-box) protein ligase complex (By similarity). Interacts with SKP1A/ASK1, SKP1B/ASK2, ASK4, ASK11 and ASK13. - Identification and Validation of Reference Genes for RT-qPCR Analysis in Non-Heading Chinese Cabbage Flowers
Wang, Frontiers in plant science 2016 (no snippet) - Evaluation of putative reference genes for gene expression normalization in soybean by quantitative real-time RT-PCR
Hu, BMC molecular biology 2009 - “...Glyma08g05480.1 CK768960 Gma.34482 AT1G58050 Nuclear helicase Unwinding of the DNA double-helix SKIP16 Glyma12g05510.1 CD397253 Gma.6079 AT1G06110 SKP1/Ask-Interacting Protein 16 Protein binding MTP Glyma03g29350.2 CF808703 Gma.7635 AT2G41790 Metalloprotease, Insulin degrading enzyme Protein degradation PEPKR1 Glyma10g38460.1 AW396185 Gma.23799 AT1G12580 Phosphoenolpyruvate Carboxylase-Related Kinase 1 Protein phosphorylation TIP41 Glyma20g26690.1 EV263725...”
- “...( At4G34270 ), HDC ( At1G58050 ) and UKN2 ( At4G33380 ); and SKIP16 ( At1G06110 ), MTP ( At2G41790 ), PEPKR1 ( At1G12580 ) and UKN1 ( At3G13410 ), which were identified as potential reference genes via a soybean microarray gene expression analysis [ 37...”
LOC105134419 F-box protein SKIP16-like from Populus euphratica
Aligns to 324:416 / 443 (21.0%), covers 89.7% of PF04379, 77.9 bits
- Heterophylly Quantitative Trait Loci Respond to Salt Stress in the Desert Tree Populus euphratica
Fu, Frontiers in plant science 2021 - “...LOC105138604, LOC105129804, LOC105139638, LOC105121124) Kinase activity GO:0016301 0.0009 E3 ubiquitin-protein ligase SHPRH-like (LOC105107433), (LOC105142410, LOC105110458, LOC105134419) Ubiquitin ligase complex GO:0000151 0.0081 WD repeat-containing protein 48 (LOC105110458), (LOC105126665, LOC105126240, LOC105123276, LOC105124653, LOC105115456, LOC105131169, LOC105127854, LOC105110458, LOC105111425, LOC105109520, LOC105130122, LOC105117107, LOC105126350, LOC105112394, LOC105111615, LOC105142410, LOC105130009, LOC105129804, LOC105111272) Regulation...”
F6SQH7 Polymerase (DNA-directed), delta interacting protein 2 (Fragment) from Mus musculus
Aligns to 217:278 / 284 (21.8%), covers 65.5% of PF04379, 50.8 bits
Or search for genetic data about PF04379 in the Fitness Browser
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory