Family Search for PF05305 (DUF732)
April 2024: See Interactive Tools for Functional Annotation of Bacterial Genomes for advice on using these tools.
PF05305 hits 34 sequences in PaperBLAST's database above the trusted cutoff. Showing all hits. Or show only hits to curated sequences or try another family.
MAV_1419 hypothetical protein from Mycobacterium avium 104
Aligns to 31:104 / 110 (67.3%), covers 98.6% of PF05305, 81.5 bits
- Identification of Mycobacterium avium subsp. hominissuis secreted proteins using an in vitro system mimicking the phagosomal environment
Chinison, BMC microbiology 2016 - “...F ATGGCGGCGATGAAGCC R CTTGAGTTCGTCACGGAGGG MAV_4394 BlaC F GGATCCGTGAAAACTCACCGGATCG R GAATTCGACGAGAGGTGCTTGCGAAG RT-PCR F CCTACGGGGTCAACTATGCC R CACGATGTCCATCACCGAGG MAV_1419 BlaC F GGATCCAATGTTCTCGCGCCGCATCATCACC R GAATTCGGCGGGCTGGCCGGAGAATTGCGGG RT-PCR F CGATGAGATGTTCCTCGCCC R MAV_0398 BlaC F GGATCCAATGACCATGCGGATCACGCGGGTTTGCCGGGCGGT R GAATTCTTGACCCAGCGCGTTTTGCATGGCCCCGG RT-PCR F GACGAGAACTGGACCAAGCA R TATTGACCCAGCGCGTTTTG MAV_1177 BlaC F GGATCCATGAGCATCAACTACCAGTTC R GAATTCGGCCCAGCTGGACC RT-PCR F ACTACCAGTTCGGCGATGTC R...”
- “...molecular weight antigen MTB12 0 0 0 4 MAV_2763 Hypothetical protein 0 1 0 2 MAV_1419 Hypothetical protein 0 2 0 1 MAV_4707 60 kDa chaperonin 2 0 0 2 1 MAV_1204 Transcription elongation factor 0 0 0 2 MAV_0589 Hypothetical protein 0 0 0 3...”
MAV_2912 hypothetical protein from Mycobacterium avium 104
Aligns to 25:96 / 111 (64.9%), covers 100.0% of PF05305, 77.2 bits
- RNA-Seq analysis of Mycobacterium avium non-coding transcriptome
Ignatov, PloS one 2013 - “...PE protein (MAV_2915), 2 proline-proline-glutamate (PPE) proteins (MAV_2913 and MAV_2914), and a conserved hypothetical protein (MAV_2912). The close proximity between these genes suggests that they constitute a single operon. PE/PPE proteins, possessing conserved proline-glutamate or proline-proline-glutamate motifs at their N terminus, are secreted or localized to...”
MAP2786c hypothetical protein from Mycobacterium avium subsp. paratuberculosis str. k10
Aligns to 25:96 / 114 (63.2%), covers 98.6% of PF05305, 74.5 bits
- Marked Differences in Mucosal Immune Responses Induced in Ileal versus Jejunal Peyer's Patches to Mycobacterium avium subsp. paratuberculosis Secreted Proteins following Targeted Enteric Infection in Young Calves
Facciuolo, PloS one 2016 - “...were detected for 9 of the 13 recombinant proteins (MAP0196c, MAP0471, MAP1569, MAP1693c, MAP1981c, MAP2785c, MAP2786c, MAP4340, MAP4339,) and M . avium subsp. paratuberculosis lysate when using PPs isolated from M . avium subsp. paratuberculosis -infected compartments in mid-jejunal segments from all three calves ( Fig...”
- “...compartments for 5 of the 13 recombinant M . avium subsp. paratuberculosis proteins (MAP1569, MAP2785c, MAP2786c, MAP4339, MAP4340) and the M . avium subsp. paratuberculosis lysate ( Table 3 , Fig 4A ). Although the magnitude of IgA-ASC frequency varied among the recombinant proteins tested the...”
Rv1291c CONSERVED HYPOTHETICAL SECRETED PROTEIN from Mycobacterium tuberculosis H37Rv
Aligns to 36:106 / 111 (64.0%), covers 98.6% of PF05305, 71.7 bits
- Genomic characteristics of two most widely used BCG vaccine strains: Danish 1331 and Pasteur 1173P2
Asadian, BMC genomics 2022 - “...protein nSNP + + 9474 Rv2608 PPE42 PPE family protein PPE42 nSNP + + 18,059 Rv1291c - Hypothetical protein sSNP b + + 24,566 Rv1037c esx I ESAT-6 like protein EsxI nSNP + - 32,710 Rv3467 - Hypothetical protein nSNPs + + 32,860 Rv0670 end Endonuclease...”
- Peptide-Based Vaccines for Tuberculosis
Gong, Frontiers in immunology 2022 - “...197 ) 15 peptides from Rv0203, Rv3106, Rv2223c, Rv3201c, Rv3296, Rv1242, Rv1184c, Rv3207c, Rv1157c, Rv1158c, Rv1291c, Rv1860, Rv2190c, Rv333c, Rv0309 PBMCs - 15 peptides stimulated IFN- response, and eight peptides stimulated lymphocyte proliferation in vitro . ( 235 ) pcDNA3-M-38 vaccine, MPT64 190-198 (FAVTNDGVI) and 38...”
- “...(WRRRPLSSALLSFGLLLGGLPL), Rv3201c (GQLLRRVRSRLARL), Rv3296 (RVILHSPYGLRVHGPLAL), Rv1242 (FLRIATSARVLAAPLPT), Rv1184c (LVPVNHLPLTLPL), Rv3207c (QGGLAPVMMQQTFST), Rv1157c (TQLLMAAASA), Rv1158c (GVNAPIPGI), Rv1291c (FTRRFAASMVG), Rv1860 (RKGRLAALAIA), Rv2190c (ARVIMRSAIG), Rv333c (VMRLYPVRLTTTMTR), Rv0309 (SVVMGVNKAK); These 21 PE/PPE peptides can be found at https://doi.org/10.1016/j.bbrc.2018.06.017 . 3.1 Peptide-Based TB Vaccines Evaluated for Immunogenicity As early as 2004,...”
- High Persister Mutants in Mycobacterium tuberculosis
Torrey, PloS one 2016 - “...S16 Table ). Three of these genes, including a transcriptional regulator (Rv2989), a hypothetical protein (Rv1291c), and an amino acid cysteine synthase (Rv0848), were uniquely upregulated in the hip isolates while the other 10 were upregulated >4-fold in all of the low persister isolates ( S17...”
- Transcriptional profiling of mycobacterium tuberculosis during infection: lessons learned
Ward, Frontiers in microbiology 2010 - “...rv3555c , rv3626c , rv3706c , rv3776 , rv3860 , rv3861 rv0150c , rv1190 , rv1291c , rv1518 , rv1587c , rv1734c , rv1945 , rv3706c , rv3845 *Genes were identified as upregulated within cell culture experiments (Schnappinger et al., 2003 ; Rachman et al., 2006a...”
- From Corynebacterium glutamicum to Mycobacterium tuberculosis--towards transfers of gene regulatory networks and integrated data analyses with MycoRegNet
Krawczyk, Nucleic acids research 2009 - “...e Rv1157c e Rv1159 pimE 77 TGTGA CTCAAG TGACA Rv1230c 79 GGTGA TCTAGT TCACG b Rv1291c 323 TGTGA TCGGCG CCACC Rv1314c 294 GGTGA TCCGGG CCACG Rv1324 e 104 TGTGA TCTTGG TCATA Rv1482c 23 TGTGA CTCAGC ACACT Rv1566c 235 CGTGA CTGAAA TCACA Rv1568 bioA 553 TGTGA TTTCAG...”
- Identification of secreted proteins of Mycobacterium tuberculosis by a bioinformatic approach
Gomez, Infection and immunity 2000 - “...MKALVAVSAVAVVALLGVSSAQADP MGVIARVVGVAACGLSLAVLAAAPTAGAEP VHRRTALKLPLLLAAGTVLGQAPRAAAEE rv3354* rv1291c rv0559c rv1891 rv3333c rv0040c rv1269c* rv2253 rv1860...”
MMAR_2672 hypothetical protein from Mycobacterium marinum M
Aligns to 27:98 / 106 (67.9%), covers 100.0% of PF05305, 71.0 bits
Rv1271c CONSERVED HYPOTHETICAL SECRETED PROTEIN from Mycobacterium tuberculosis H37Rv
Aligns to 37:107 / 113 (62.8%), covers 100.0% of PF05305, 70.4 bits
- Conserved mycobacterial lipoglycoproteins activate TLR2 but also require glycosylation for MHC class II-restricted T cell activation
Sieling, Journal of immunology (Baltimore, Md. : 1950) 2008 - “...large genome fragment of six genes (rv1266c to rv1271c) that includes lprA. Moreover, sequence alignment displays several stretches of nine or more amino acids...”
- The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes
Fu, BMC microbiology 2007 - “...Rv2956 TRPB Rv2808 Rv2128 Rv1695 NUOI Rv1312 NUOL NUOD Rv3806C Rv2759C Rv2966C FOLK Rv2879C Rv1780 Rv1271C Rv3693 PLCB DRRC Rv2600 NUOM NUOH Rv0875C Rv3220C Rv3885C MMPL7 Rv2475C LTP1 Rv0236C NUOJ NUOB NUON MMPL9 Rv2752C Rv0177 Rv0176 HEMB PRCA Rv2553C Rv2367C RPLT GID CMK Rv3122 EMBB Rv1303...”
- Immunological characterization of novel secreted antigens of Mycobacterium tuberculosis
Ben, Scandinavian journal of immunology 2005 (PubMed)- “...at least one of five novel proteins (Rv0203, Rv0603, Rv1271c, Rv1804c and Rv2253), 56% with the 38 kDa lipoprotein, a M. tuberculosis antigen known to be highly...”
- “...proteins (<15 kDa, predicted molecular weight), such as Rv1271c and Rv1804c, were also cloned into pET102 (Invitrogen Corporation, Carlsbad, CA, USA), an...”
- Identification of secreted proteins of Mycobacterium tuberculosis by a bioinformatic approach
Gomez, Infection and immunity 2000 - “...MTTSKIATAFKTATFALAAGAVALGLASPADAAA rv1174c rv2376c rv2450c* rv1271c rv1980c rv0617 rv0674 rv1906c* rv1006 rv2389c rv2878c rv3036c...”
MAV_3557 hypothetical protein from Mycobacterium avium 104
Aligns to 26:97 / 114 (63.2%), covers 100.0% of PF05305, 69.8 bits
Rv1810 hypothetical protein from Mycobacterium tuberculosis H37Rv
Mb1840 CONSERVED HYPOTHETICAL PROTEIN from Mycobacterium bovis AF2122/97
Aligns to 40:111 / 118 (61.0%), covers 100.0% of PF05305, 69.3 bits
- Genomic characteristics of two most widely used BCG vaccine strains: Danish 1331 and Pasteur 1173P2
Asadian, BMC genomics 2022 - “...al. [ 25 ]. Furthermore, we detected RD Denmark/Glaxo, which truncated PPE33 (Rv1809) and removed Rv1810 (equivalent to MB1840 from M. bovis ) for Danish 1331, as described by Abdallah et al. [ 25 ]. Consistent with the previous study [ 23 ], we identified a...”
- Screening Mycobacterium tuberculosis Secreted Proteins Identifies Mpt64 as a Eukaryotic Membrane-Binding Bacterial Effector
Stamm, mSphere 2019 - “...to those that bound eukaryotic membranes and identified five proteins with overlapping activities: Rv0594, Rv1646, Rv1810, Rv1980c, and Rv2295 ( Fig.3D ). During expression in HeLa cells, all but one protein localized to the ER, and all five proteins reduced hGH release ( Fig.3E ). FIG3...”
- Mycobacterium marinum MgtC plays a role in phagocytosis but is dispensable for intracellular multiplication
Belon, PloS one 2014 - “...PPE proteins and is adjacent to a gene coding for a protein of unknown function (Rv1810 or MMAR_2686). This genomic organization differs from the one of S. Typhimurium where mgtC is in operon with a gene that encodes a Mg 2+ transporter. The position of the...”
- “...M. tuberculosis and M. marinum genomes. In both species, the mgtC gene is adjacent to Rv1810 that is homologous to MMAR_2686 (black arrows) and to PPE genes (grey arrows). The MMAR_2688 gene is homologous to Rv1812c . To investigate the role of mgtC in M. marinum...”
- Nonclassical transpeptidases of Mycobacterium tuberculosis alter cell size, morphology, the cytosolic matrix, protein localization, virulence, and resistance to β-lactams
Schoonmaker, Journal of bacteriology 2014 - “...from major secreted antigens encoded by Rv1174c (37), Rv1810 (38), Rv1926c (39), Rv1980c (38-40), Rv3004 (37), and Rv3312A (41) to integral membrane proteins...”
- The C-terminal domain of the virulence factor MgtC is a divergent ACT domain
Yang, Journal of bacteriology 2012 - “...immediately upstream of M. tuberculosis mgtC (rv1806 through rv1810) were found to be clearly upregulated following Mg2 deprivation (38). To reinvestigate the...”
- Genetic requirements for the survival of tubercle bacilli in primates
Dutta, The Journal of infectious diseases 2010 - “...MT3037, MT3536, Rv0079, Rv0157A, Rv0157A, Rv0163, Rv0250c, Rv0466, Rv0502, Rv0580c, Rv0910, Rv0948c, Rv1176c, Rv1489, Rv1804c, Rv1810, Rv1864c, Rv1879, Rv1894c, Rv1978, Rv2091c, Rv2309A, Rv2387, Rv2387, Rv2478c, Rv2694c, Rv2819c, Rv2820c, Rv2879c, Rv3094c, Rv3486, Rv3683, Rv3787c 35.40 Total 326 33.13 Survival of mutants in NHP lungs: data for genes...”
- Descriptive proteomic analysis shows protein variability between closely related clinical isolates of Mycobacterium tuberculosis
Mehaffy, Proteomics 2010 - “...significant differences between at least two of the four strains ( Table 1 ). Cfp2, Rv1810, and a spot containing Mpt64 and LprA presented higher abundance in CDC1551 when compared to the closely related strains BE, C28 and H6. Meanwhile, Ag85A was absent from CDC1551 and...”
- “...17 , 21 , 23 , 24 , 68 , 69 ] 21 gi|15608947 gi|57117165 Rv1810 d Rv3875 -- EsxA, Esat-6 2 2 27% 33% 12.14/8.42 9.93/nss 6.06/4.5 4.19/nss CDC1551 vs C28, H6 [ 23 ] [ 16 , 17 , 21 , 23 , 24...”
- Mycobacterium tuberculosis modulates its cell surface via an oligopeptide permease (Opp) transport system
Flores-Valdez, FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2009 - “...1.6 0.6 1.0 1.0 0.9 1.4 0.9 1.0 Rv1806 Rv1807 Rv1808 Rv1809 Rv1810 Rv1843c Rv1855c 1.0 1.2 1.0 1.0 0.9 1.1 0.5 2.0 1.9 1.7 1.7 1.4 0.5 1.4 1.5 1.2 1.2 1.4 1.7...”
- More
- Genomic characteristics of two most widely used BCG vaccine strains: Danish 1331 and Pasteur 1173P2
Asadian, BMC genomics 2022 - “...]. Furthermore, we detected RD Denmark/Glaxo, which truncated PPE33 (Rv1809) and removed Rv1810 (equivalent to MB1840 from M. bovis ) for Danish 1331, as described by Abdallah et al. [ 25 ]. Consistent with the previous study [ 23 ], we identified a DU1-like region with...”
MMAR_2686 hypothetical protein from Mycobacterium marinum M
Aligns to 30:101 / 106 (67.9%), covers 98.6% of PF05305, 69.0 bits
- Mycobacterium marinum MgtC plays a role in phagocytosis but is dispensable for intracellular multiplication
Belon, PloS one 2014 - “...the mgtC gene and 840 bp upstream (which contains the intergenic region between MMAR_2685 and MMAR_2686 as well as MMAR_2687 gene) was amplified by PCR using primers pMV306- Xba I-5 and pMV306- Hind III-3 and was cloned at the Xba I and Hind III sites of...”
- “...and is adjacent to a gene coding for a protein of unknown function (Rv1810 or MMAR_2686). This genomic organization differs from the one of S. Typhimurium where mgtC is in operon with a gene that encodes a Mg 2+ transporter. The position of the regulatory sequences...”
MAP2785c hypothetical protein from Mycobacterium avium subsp. paratuberculosis str. k10
Aligns to 73:144 / 161 (44.7%), covers 100.0% of PF05305, 68.6 bits
- Marked Differences in Mucosal Immune Responses Induced in Ileal versus Jejunal Peyer's Patches to Mycobacterium avium subsp. paratuberculosis Secreted Proteins following Targeted Enteric Infection in Young Calves
Facciuolo, PloS one 2016 - “...responses were detected for 9 of the 13 recombinant proteins (MAP0196c, MAP0471, MAP1569, MAP1693c, MAP1981c, MAP2785c, MAP2786c, MAP4340, MAP4339,) and M . avium subsp. paratuberculosis lysate when using PPs isolated from M . avium subsp. paratuberculosis -infected compartments in mid-jejunal segments from all three calves (...”
- “...uninfected compartments for 5 of the 13 recombinant M . avium subsp. paratuberculosis proteins (MAP1569, MAP2785c, MAP2786c, MAP4339, MAP4340) and the M . avium subsp. paratuberculosis lysate ( Table 3 , Fig 4A ). Although the magnitude of IgA-ASC frequency varied among the recombinant proteins tested...”
MAP1154 hypothetical protein from Mycobacterium avium subsp. paratuberculosis str. k10
Aligns to 27:105 / 117 (67.5%), covers 94.4% of PF05305, 66.3 bits
- Generation and screening of a comprehensive Mycobacterium avium subsp. paratuberculosis transposon mutant bank
Rathnaiah, Frontiers in cellular and infection microbiology 2014 - “...68 in MTB) (Li et al., 2005 ). The other members of the gene cluster, MAP1154 and MAP1156, encode proteins of an uncharacterized protein family. MAP1154 encodes a hypothetical protein, while MAP1156 has putative diacyglycerol O-acyltransferase activity (Bannantine et al., 2011 ). Mutant 4H2 was clearly...”
- Immunogenicity and reactivity of novel Mycobacterium avium subsp. paratuberculosis PPE MAP1152 and conserved MAP1156 proteins with sera from experimentally and naturally infected animals
Bannantine, Clinical and vaccine immunology : CVI 2011 - “...putative open reading frame (ORF) of unknown function (MAP1154; 11.8 kDa) and MAP1156 (50.7 kDa), a member of the uncharacterized protein family (UPF0089)...”
- “...E78 Rv1809 (PPE33)/1.0 E84 PPE, GxxSVPxxW PPE, GxxSVPxxW MAP1154 MAP1155 117, 11.7 320, 32.2 Rv1810/8.0 E19 Rv1807 (PPE31)/4.0 E24 DUF732 superfamily PPE,...”
MT49_RS09400 DUF732 domain-containing protein from Mycobacterium tuberculosis 49-02
Rv1804c hypothetical protein from Mycobacterium tuberculosis H37Rv
Mb1833c CONSERVED HYPOTHETICAL PROTEIN from Mycobacterium bovis AF2122/97
Aligns to 26:98 / 108 (67.6%), covers 98.6% of PF05305, 66.1 bits
- Insertion and deletion evolution reflects antibiotics selection pressure in a Mycobacterium tuberculosis outbreak
Godfroid, PLoS pathogens 2020 - “...nsSNP MT49_RS03490 Rv0667 rpoB DNA-directed RNA polymerase subunit beta Essential and ABR-conferring Intergenic IS6110 insertion MT49_RS09400 Rv1804c hypothetical protein Predicted secreted protein Gene names and additional information are displayed according to the Mycobrowser annotations ( https://mycobrowser.epfl.ch/ , last accessed 28 November 2019), when available. Locus tags...”
- Mycobacterial Rv1804c binds to the PEST domain of IκBα and activates macrophage-mediated proinflammatory responses
Zheng, iScience 2024 - “...However, the recognition of Mtb-secretory proteins by the receptor-independent pathways of the host remains unclear. Rv1804c is a highly conserved secretory protein in Mtb. However, its exact function and underlying mechanism in Mtb infection remain poorly understood. In the present study, we observed that Rv1804c activates...”
- “...we noted that Rv1804c inhibits mycobacterial survival. By elucidating the underlying mechanisms, we observed that Rv1804c activates I B by directly interacting with its PEST domain. Moreover, Rv1804c was enriched in attenuated but not in virulent mycobacteria and associated with the disease process of tuberculosis. Our findings...”
- Identification of Autophagy-Inhibiting Factors of Mycobacterium tuberculosis by High-Throughput Loss-of-Function Screening
Strong, Infection and immunity 2020 (secret) - Insertion and deletion evolution reflects antibiotics selection pressure in a Mycobacterium tuberculosis outbreak
Godfroid, PLoS pathogens 2020 - “...MT49_RS03490 Rv0667 rpoB DNA-directed RNA polymerase subunit beta Essential and ABR-conferring Intergenic IS6110 insertion MT49_RS09400 Rv1804c hypothetical protein Predicted secreted protein Gene names and additional information are displayed according to the Mycobrowser annotations ( https://mycobrowser.epfl.ch/ , last accessed 28 November 2019), when available. Locus tags and...”
- An Mtb-Human Protein-Protein Interaction Map Identifies a Switch between Host Antiviral and Antibacterial Responses
Penn, Molecular cell 2018 - “...Rv3722c and seven components of the CCT chaperone complex. Furthermore, we uncovered a connection between Rv1804c and Rv1075c and the host STRIPAK signal transduction complex, which has been recently linked to innate immunity and autophagy targeting ( Liu et al., 2016 ; Neisch et al., 2017...”
- “...restriction factor for Mtb. (A) In vivo competition assay. Bacterial mutant strains ( lpqN/Rv0583c, Rv2469c, Rv1804c, Rv0999 ) and cognate complemented strains were pooled and used to infect mice via the respiratory route. At the indicated times, bacteria were recovered from lung homogenates and the relative...”
- Identification of Novel Potential Vaccine Candidates against Tuberculosis Based on Reverse Vaccinology
Monterrubio-López, BioMed research international 2015 - “...91 Related with PE family proteins of Mycobacterium gi_15608277_ref_NP_215653_1_ Rv1137c 0.76 122 No matches gi_15608941_ref_NP_216320_1_ Rv1804c 0.575 108 Related with Mycobacterium lipoproteins and gp53 Mycobacterium phage gi_15609051_ref_NP_216430_1_ Rv1914c 0.5202 135 No matches gi_15609215_ref_NP_216594_1_ Rv2078 0.5425 104 No matches gi_15609220_ref_NP_216599_1_ Rv2083 0.8189 314 No matches gi_15609401_ref_NP_216780_1_ Rv2264c...”
- Genetic requirements for the survival of tubercle bacilli in primates
Dutta, The Journal of infectious diseases 2010 - “...MT2960, MT3037, MT3536, Rv0079, Rv0157A, Rv0157A, Rv0163, Rv0250c, Rv0466, Rv0502, Rv0580c, Rv0910, Rv0948c, Rv1176c, Rv1489, Rv1804c, Rv1810, Rv1864c, Rv1879, Rv1894c, Rv1978, Rv2091c, Rv2309A, Rv2387, Rv2387, Rv2478c, Rv2694c, Rv2819c, Rv2820c, Rv2879c, Rv3094c, Rv3486, Rv3683, Rv3787c 35.40 Total 326 33.13 Survival of mutants in NHP lungs: data for...”
- Identification of outer membrane proteins of Mycobacterium tuberculosis
Song, Tuberculosis (Edinburgh, Scotland) 2008 - “...family protein 606 0.7 7 0.14 0.20 0 3.73 67 Rv1804c CAA17725 None Conserved hypothetical protein 85 0.8 3 0.24 0.59 4 6.76 68 Rv1813c* CAB09499 None Conserved...”
- Immunological characterization of novel secreted antigens of Mycobacterium tuberculosis
Ben, Scandinavian journal of immunology 2005 (PubMed)- “...least one of five novel proteins (Rv0203, Rv0603, Rv1271c, Rv1804c and Rv2253), 56% with the 38 kDa lipoprotein, a M. tuberculosis antigen known to be highly...”
- “...kDa, predicted molecular weight), such as Rv1271c and Rv1804c, were also cloned into pET102 (Invitrogen Corporation, Carlsbad, CA, USA), an expression vector...”
- More
- Towards Reverse Vaccinology for Bovine TB: High Throughput Expression of Full Length Recombinant Mycobacterium bovis Proteins
Paliwal, Frontiers in molecular biosciences 2022 - “...E. coli & Insect ++ ++ Mb3743c Conserved protein E. coli & Insect +++ +++ Mb1833c Conserved protein Insect +++ +++ Mb0854c Conserved protein E. coli & Insect +++ +++ Mb2058 Conserved protein Acg E. coli & Insect ++ - Mb0337c hypothetical protein E. coli &...”
- Genome-level analyses of Mycobacterium bovis lineages reveal the role of SNPs and antisense transcription in differential gene expression
Golby, BMC genomics 2013 - “...only ; C-T (G to D) Mb1750c Rv1721c 6 3 9 5 conserved hypothetical protein Mb1833c Rv1804 3 conserved hypothetical protein Mb1834c Rv1805c 4 hypothetical protein Mb1835 Rv1806 PE20 3 PE family protein Mb1885c Rv1854c ndh 3 probable nadh dehydrogenase Mb1914c Rv1882c 6 3 6 probable...”
MAVA5_06970 DUF732 domain-containing protein from Mycobacterium avium subsp. hominissuis A5
MAV_1445 hypothetical protein from Mycobacterium avium 104
Aligns to 22:95 / 95 (77.9%), covers 98.6% of PF05305, 64.6 bits
- Genetic Involvement of Mycobacterium avium Complex in the Regulation and Manipulation of Innate Immune Functions of Host Cells
Shin, International journal of molecular sciences 2021 - “...death via ROS production and the mitochondrial pathway MAH 104 [ 96 , 97 ] MAVA5_06970 - a secreted protein induction of cell death Hijacking OPN to hinder the operation of OPN Induction of cell death and limitation of the activation of the type I immunity...”
- “...that induced rapid apoptosis and entered secondarily infected host cells were identified, and among them, MAVA5_06970, which was postulated to be a secreted protein, was studied [ 59 ]. This protein was necessary for virulence and survival in macrophages and mice, and in particular, interacted with...”
- Mycobacterium avium Subsp. hominissuis Interactions with Macrophage Killing Mechanisms
Abukhalid, Pathogens (Basel, Switzerland) 2021 - “...MAV_2052, which induces apoptosis by TLR-4-dependent ROS production [ 65 ]. Whereas the secreted protein, MAVA5_06970, was shown to induce apoptosis in THP-1 macrophages, as well as in vivo [ 66 ]. The apoptosis reaches the greatest level five days after infection by tumor necrosis factor...”
- “...Rojony R. Carson K.L. Palmer A.L. Rose S.J. Bermudez L.E. Mycobacterium avium subsp. hominissuis effector MAVA5_06970 promotes rapid apoptosis in secondary-infected macrophages during cell-to-cell spread Virulence 2018 9 1287 1300 10.1080/21505594.2018.1504559 30134761 67. Balcewicz-Sablinska M.K. Gan H. Remold H.G. Interleukin 10 produced by macrophages inoculated with...”
- Mycobacterium avium subsp. hominissuis effector MAVA5_06970 promotes rapid apoptosis in secondary-infected macrophages during cell-to-cell spread
Danelishvili, Virulence 2018 - “...2150-5608 Taylor & Francis 6177253 30134761 1504559 10.1080/21505594.2018.1504559 Research Paper Mycobacterium avium subsp. hominissuis effector MAVA5_06970 promotes rapid apoptosis in secondary-infected macrophages during cell-to-cell spread L. DANELISHVILI ET AL. VIRULENCE Danelishvili Lia a Rojony Rajoana a Carson Kylee L. a Palmer Amy L. a Rose Sasha...”
- “...host cell apoptosis, which is only observed upon entry into the secondary-infected macrophages. Inactivation of MAVA5_06970 gene lead to significant attenuation in intracellular growth within macrophages and mice, and impaired M. avium to induce rapid apoptosis in the secondary-infected cells as measured by Annexin V-FITC detection...”
- Mycobacterium avium subsp. hominissuis effector MAVA5_06970 promotes rapid apoptosis in secondary-infected macrophages during cell-to-cell spread
Danelishvili, Virulence 2018 - “...avium that contributes to the cell-to-cell spread of the pathogen. KEYWORDS M. avium macrophages MAVA5_06970 MAV_1445 SPP1 osteopontin apoptosis IL-12 NIH Office of the Director 10.13039/100000052 S10 OD020111 National Institute of Allergy and Infectious Diseases 10.13039/100000060 R01AI043199 This work was supported by the NIAID R01AI043199 and...”
- “...Multiple A0A0E2W9D0 MAVA5_06720 Major Facilitator Superfamily (MFS) transporter MAV_1387 Rv1250 AM4_32 A0A0E2W8Z5 MAVA5_06970 Hypothetical protein MAV_1445 none AM1_18 A0A0E2W504 MAVA5_13300 Adenylate cyclase MAV_3122 Rv1647 Multiple A0A0E2W528 MAVA5_18200 Short-chain dehydrogenase none none AM4_30 A0A0E2W2P8 MAVA5_18830 Thiosulfate sulfurtransferase MAV_4253 Rv3283 Multiple A0A0E2WK23 MAVA5_20300 Acyltransferase MAV_4648 Rv0502 AM4_29 A0A0E2VZZ6...”
MMAR_2929 hypothetical protein from Mycobacterium marinum M
Aligns to 32:107 / 107 (71.0%), covers 98.6% of PF05305, 62.9 bits
- A Small Protein but with Diverse Roles: A Review of EsxA in Mycobacterium-Host Interaction
Bao, Cells 2021 - “...as well as EsxN encoded within the ESX-5 locus, but it upregulates the secretion of MMAR_2929 from the Sec system [ 54 ]. Moreover, the disruption of other ESX-1 genes alters the expression or secretion of EsxA. The deletion of espE or espF significantly upregulates the...”
- Mycobacterium avium subsp. hominissuis effector MAVA5_06970 promotes rapid apoptosis in secondary-infected macrophages during cell-to-cell spread
Danelishvili, Virulence 2018 - “...in MAVA5_06970 protein as well as significant homology to uncharacterized secreted effectors of M. marinum MMAR_2929 and M. avium subsp. paratuberculosis MAP_2476, we hypothesized that MAVA5_06970 undergoes proteolytic cleavage before secretion, and either it is located on the outer membrane of M. avium or translocated into...”
- “...Sec secretion system. The bioinformatics analysis has identified highly homologous secreted effector of M. marinum MMAR_2929 proven to undergo to proteolytic cleavage and secreted in culture filtrates [28,29]. We identified an M. avium transposon clone with a nonfunctional MAVA5_06970 gene to be deficient in the induction...”
- Correlation of phenotypic profiles using targeted proteomics identifies mycobacterial esx-1 substrates
Champion, Journal of proteome research 2014 - “...appropriate normalization proteins and schemes simultaneously, including the use of multiple normalization proteins such as MMAR_2929, GroEL2, GroES, MPT64, and MPT32 used here and in numerous mycobacterial studies. We hypothesized that by using nLCMRM-MS on a larger scale to measure Esx-1-associated proteins in a collection of...”
- “...the levels of the EspF substrate in the CL and CF. (E) nLCMRM analysis of MMAR_2929. (F) nLCMRM analysis of EsxN. Error bars represent the average propagated standard error and were calculated as described in the Experimental Procedures . In all graphs changes in the levels...”
- A novel ESX-1 locus reveals that surface-associated ESX-1 substrates mediate virulence in Mycobacterium marinum
Kennedy, Journal of bacteriology 2014 - “...experiments were controlled by measuring relative changes in MMAR_2929, a secreted protein bearing an Sec signal sequence (59) (Fig. 5A). We observed a relative...”
- “...marinum. Relative levels of EsxA, EsxB, and MMAR_2929 in whole-cell lysates and Cell-Associated EsxA/B Mediate Mycobacterial Virulence type strain. Together,...”
- Capillary zone electrophoresis-electrospray ionization-tandem mass spectrometry for top-down characterization of the Mycobacterium marinum secretome
Zhao, Analytical chemistry 2014 - “...gi|183985108 cold shock protein A CspA_1 7.2 M. marinum M LC 8 gi|183982932 hypothetical protein MMAR_2929 8.3 M. marinum M CE,LC 9 gi|183985378 hypothetical protein MMAR_5548 4.2 M. marinum M 10 gi|183982679 hypothetical protein MMAR_2672 8.9 M. marinum M 11 gi|183985410 hypothetical protein MMAR_5439 3.7 M....”
- Homeostasis of N-α-terminal acetylation of EsxA correlates with virulence in Mycobacterium marinum
Mba, Infection and immunity 2014 - “...by Kennedy et al. (27) from GroES, EsxA, MMAR_2929, and the N-terminal peptide of EsxA (NT-EsxA) with and without acetylation (New England Peptide). All...”
- “...stock, 130 fmol on-column with each sample; MMAR_2929, 116 M; EsxA (internal), 142 M. NT-EsxA (TE QQWNFAGIEAASSAIQGNVTSISHLLDEGK) and EsxA (Ac-TEQQWN...”
MSMEG_4689 hypothetical protein from Mycobacterium smegmatis str. MC2 155
Aligns to 38:110 / 134 (54.5%), covers 98.6% of PF05305, 62.6 bits
- Genome-Wide Transcriptional Response of Mycobacterium smegmatis MC2155 to G-Quadruplex Ligands BRACO-19 and TMPyP4
Shitikov, Frontiers in microbiology 2022 - “...examples of DEGs that are co-regulated by both compounds and harbor/neighbor PQSs include MSMEG_4727, MSMEG_1680, MSMEG_4689, MSMEG_3948, MSMEG_2242, MSMEG_3121, and MSMEG_2148 (contain PQSs on the template strand of the gene); MSMEG_1488, MSMEG_0868, MSMEG_6223, MSMEG_5397, and MSMEG_4202 (contain PQSs on the mRNA-like strand); MSMEG_6567 (contains one PQS...”
MAP1703c hypothetical protein from Mycobacterium avium subsp. paratuberculosis str. k10
Aligns to 32:107 / 117 (65.0%), covers 98.6% of PF05305, 61.6 bits
- Genomic variations associated with attenuation in Mycobacterium avium subsp. paratuberculosis vaccine strains
Bull, BMC microbiology 2013 - “...Protein Stress protein MAP1699 thil Thiamine biosynthesis MAP1700c -lactamase MAP1701c Biotin carboxylase subunit MAP1702c Thioredoxin MAP1703c Unknown MAP1704c Glyoxalase Anti-host killing factor MAP1705c Transcriptional regulator MAP1706 Chitinase-like protein MAP1707 3-ketoacyl-(acp) reductase Fatty Acid Metabolism MAP1708 Phosphohydrolase-like protein MAP1709 fadD11_2 LuxE like Acyl-protein synthetase Fatty Acid Metabolism...”
BCG_3092 hypothetical protein from Mycobacterium bovis BCG str. Pasteur 1173P2
Aligns to 56:127 / 136 (52.9%), covers 98.6% of PF05305, 59.5 bits
- Antimycobacterial Activities of Hydroxamic Acids and Their Iron(II/III), Nickel(II), Copper(II) and Zinc(II) Complexes
Yang, Microorganisms 2023 - “...Furthermore, we also observed some up-regulated proteins, encoded by BCG_1100c , narK2 , BCG_0259c and BCG_3092 in HA10FeCl-treated M. bovis BCG, and down-regulated proteins, encoded by genes PE15 and mmpL9a ( BCG_2361 ) in the control, that were not identified from the proteomic profiles ( Table...”
Rv3067 hypothetical protein from Mycobacterium tuberculosis H37Rv
Aligns to 56:127 / 136 (52.9%), covers 98.6% of PF05305, 59.5 bits
- GlnA3Mtis able to glutamylate spermine but it is not essential for the detoxification of spermine inMycobacterium tuberculosis
Krysenko, 2023 - Identification of Mycobacterium tuberculosis adherence-mediating components: a review of key methods to confirm adhesin function
Ramsugit, Iranian journal of basic medical sciences 2016 - “..., Rv0988 , Rv1115 , Rv1116A , Rv1269c , Rv2190c , Rv2730 , Rv3036c , Rv3067 , Rv3207c , Rv3337 , Rv3491 , Rv3705c , Rv3811 , and Rv3822 Immunogenic protein Mpt64 Rv1980c Low-molecular-weight antigen CFP2 Rv2376c Major secreted immunogenic protein Mpt70 Rv2875 Mce-family protein Rv0590...”
- Identification of Novel Potential Vaccine Candidates against Tuberculosis Based on Reverse Vaccinology
Monterrubio-López, BioMed research international 2015 - “...No matches gi_15610097_ref_NP_217476_1_ Rv2960c 0.6945 82 No matches gi_15610135_ref_NP_217514_1_ Rv2998 0.8339 153 No matches gi_15610204_ref_NP_217583_1_ Rv3067 0.566 136 No matches gi_15610316_ref_NP_217696_1_ Rv3180c 0.5182 144 Related with proteins which have pilT domain and with DNA binding proteins from Mycobacterium gi_15610343_ref_NP_217723_1_ Rv3207c 0.6281 285 Related with membrane proteins...”
- Mycobacterium tuberculosis Transcriptome Profiling in Mice with Genetically Different Susceptibility to Tuberculosis
Skvortsov, Acta naturae 2013 - “...Rv0145, Rv0332, Rv0712, Rv0785, Rv0998, Rv1514c, Rv1515c, wbbL2, Rv1760, Rv2077A, Rv2135c, Rv2466c, Rv2699c, Rv2751, Rv2823c, Rv3067, Rv3090, Rv3094c, Rv3510c CH conserved hypotheticals Rv0051, Rv0309, lprL, Rv0621, Rv0876c, lytB2, irtA, Rv1687c, secA2, Rv2209, Rv2265, mmpL7, Rv3194c, Rv3658c, embC, espE, ponA1, Rv0072, narK3, iniA, cpsY, lpqR, pstS1, Rv0996,...”
- “...as having universally increased expression and selected eight genes (Rv0140, Rv0145, atsA, Rv2466c, fadD26, ilvC, Rv3067, and kstD ) that were featured in both lists. Such an insignificant coincidence can be attributed to the fact that a) the infection of cultured macrophages is a relatively simplified...”
- Identification of novel adhesins of M. tuberculosis H37Rv using integrated approach of multiple computational algorithms and experimental analysis
Kumar, PloS one 2013 - “...bacteria (1.65e-15) Rv3337 Conserved hypothetical protein 13.180 0.698 Undecided Globular Abhydrolase_6[pfam12697], Alpha/beta hydrolase family (5.08e-04) Rv3067 Conserved hypothetical protein 13.930 0.768 Undecided Globular Protein of unknown function (DUF732) pfam05305 (1.27e-19) Rv3705c Conserved protein 22.360 0.689 Undecided Globular PknH_C[pfam14032], PknH-like extracellular domain (6.95e-37) Rv1115 Possible exported protein...”
NP_217871 hypothetical protein from Mycobacterium tuberculosis H37Rv
O50383 DUF732 domain-containing protein from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Rv3354 hypothetical protein from Mycobacterium tuberculosis H37Rv
Aligns to 35:107 / 129 (56.6%), covers 97.2% of PF05305, 58.1 bits
- Mycobacterium tuberculosis alters the metalloprotease activity of the COP9 signalosome.
Danelishvili, mBio 2014 - GeneRIF: findings show the Rv3354 gene encodes a protein kinase that is secreted within mononuclear phagocytic cells and is required for M. tuberculosis virulence; the Rv3354 effector targets the metalloprotease (JAMM) domain within subunit 5 of the COP9 signalosome
- B in TB: B Cells as Mediators of Clinically Relevant Immune Responses in Tuberculosis
Rao, Clinical infectious diseases : an official publication of the Infectious Diseases Society of America 2015 - “...Rv2629/MT2704 Rv2629 61 Q7U2P4 Conserved protein tb18.5 Rv0164 62 Q7TYY1 Conserved protein tb16.3 Rv2185c 63 O50383 Putative uncharacterized protein Rv3354 Serum from 34 patients with pulmonary tuberculosis from Armenia, 6 patients from Stockholm, and 35 healthy individuals from the United States were used for differential Mtb...”
- Genome-wide screen identifies host loci that modulate Mycobacterium tuberculosis fitness in immunodivergent mice
Meade, G3 (Bethesda, Md.) 2023 - “...27.520 3.75 11.145 102.347 1.79E02 hp115 Rv3013 Rv3013 15 28.265 3.98 12.673 28.312 1.65E02 hp116 Rv3354 Rv3354 15 28.312 2.83 9.237 102.347 4.35E02 hp117 Rv1664 pks9 15 32.262 2.86 7.168 72.449 3.57E02 hp118 Rv1366 Rv1366 15 64.513 3.43 42.380 84.022 9.72E03 hp119 Rv3765c tcrX 15 74.502...”
- Different modalities of host cell death and their impact on Mycobacterium tuberculosis infection
Nisa, American journal of physiology. Cell physiology 2022 (secret) - Structure-Aware Mycobacterium tuberculosis Functional Annotation Uncloaks Resistance, Metabolic, and Virulence Genes
Modlin, mSystems 2021 - “...Esterase 25224799 Probable conserved secreted protein TB22.2 Probable conserved secreted protein TB22.2 Possible membrane protein Rv3354 Protein kinase 25139900 Conserved hypothetical protein Lipoprotein Possible lipoprotein LprJ Orthogonal annotation Rv0256c* B cell antigen/probable INOS promoter binding protein 23827809, 28071726 PPE family protein PPE2 Uncharacterized PPE family protein...”
- New insights into the evasion of host innate immunity by Mycobacterium tuberculosis
Chai, Cellular & molecular immunology 2020 - “...cellular ubiquitination processes. Another early study confirmed this assumption by showing that Mtb-secreted virulence factor Rv3354 was able to interact with the metalloprotease (JAMM) domain of subunit 5 in the constitutive photomorphogenesis 9 signalosome (CSN5), resulting in the disruption of CSN5-mediated stabilization of cullin-really interesting new...”
- Innate immunity in tuberculosis: host defense vs pathogen evasion
Liu, Cellular & molecular immunology 2017 - “...NuoG, PknE, SecA2, SodA, SigH, MPT64 and Rv3354) apoptosis; EsxA and Mtb DNA can activate, whereas Zmp1 can inhibit inflammasome activation.</p></div></div><div...”
- Microaggregate-associated protein involved in invasion of epithelial cells by Mycobacterium avium subsp. hominissuis
Babrak, Virulence 2015 - “...better than microaggregates treated with non-specific protein (Rv3354) or HBSS (Fig. 1D). Regardless of their treatment, planktonic bacteria did not show...”
- “...at 37 C and invasion was assessed. Non-specific protein (Rv3354) and HBSS were used as negative controls. This is one representative with 3 technical replicates...”
- The environment of "Mycobacterium avium subsp. hominissuis" microaggregates induces synthesis of small proteins associated with efficient infection of respiratory epithelial cells
Babrak, Infection and immunity 2015 - “...2 h at 4C. The nonspecific protein was purified Rv3354, a mycobacterial protein. Nonbound bacteria were washed, and HEp-2 cells were lysed and plated for CFU (n...”
- Evidence for genes associated with the ability of Mycobacterium avium subsp. hominissuis to escape apoptotic macrophages
Bermudez, Frontiers in cellular and infection microbiology 2015 - “...involved in the activation of the ubiquitin. We have found that a M. tuberculosis protein, Rv3354, targets the metalloprtease comain (JAMM) of the signalosome COP9, resulting in suppression of apoptosis (Danelishvili et al., 2014 ). MAV_2210 interacts with COP9 probably in a different location of the...”
- More
MAP1397 LprJ from Mycobacterium avium subsp. paratuberculosis str. k10
Aligns to 39:110 / 122 (59.0%), covers 94.4% of PF05305, 55.7 bits
Rv3333c HYPOTHETICAL PROLINE RICH PROTEIN from Mycobacterium tuberculosis H37Rv
Aligns to 36:118 / 281 (29.5%), covers 100.0% of PF05305, 49.4 bits
- Close Related Drug-Resistance Beijing Isolates of Mycobacterium tuberculosis Reveal a Different Transcriptomic Signature in a Murine Disease Progression Model
Cerezo-Cortés, International journal of molecular sciences 2022 - “...the Rv0004 , involved in the replication of DNA [ 43 ], the Ppr1 ( Rv3333c ) which control the sigma factor SigM by hydrolysis of its Anti-SigM factor [ 44 ], the pknB ( Rv0014c ) which is involved in the peptidoglycan synthesis and maintenance...”
- In Vivo Methods to Study Protein-Protein Interactions as Key Players in Mycobacterium Tuberculosis Virulence
Veyron-Churlet, Pathogens (Basel, Switzerland) 2019 - “...to the identification of PDZ-interacting protease regulators 1 and 2 (Ppr1 and Ppr2, corresponding to Rv3333c and Rv3439c, respectively) and these interactions are thought to prevent nonspecific activation of the Rip1 pathway [ 42 ]. 2.3. Pros and Cons The Y2H system allows direct assessment of...”
- Conserved hypothetical protein Rv1977 in Mycobacterium tuberculosis strains contains sequence polymorphisms and might be involved in ongoing immune evasion
Jiang, International journal of clinical and experimental pathology 2015 (secret) - Site-2 protease substrate specificity and coupling in trans by a PDZ-substrate adapter protein
Schneider, Proceedings of the National Academy of Sciences of the United States of America 2013 - “...contained fusions to the uncharacterized proteins encoded by rv3333c and rv3439c, which we named Ppr1 and Ppr2, respectively. Both Ppr1 and Ppr2 interact with...”
- “...encoding AD fusions to Ppr1 (encoded by M. tuberculosis Rv3333c) or Ppr2 (encoded by M. tuberculosis Rv3439c) and a LexA-LacZ reporter plasmid were tested with...”
- Identification of outer membrane proteins of Mycobacterium tuberculosis
Song, Tuberculosis (Edinburgh, Scotland) 2008 - “...protein) 473 0.9 11 0.20 0.51 2 4.67 119 Rv3333c CAA17105 None Hypothetical proline rich protein 248 0.5 2 0.11 0.36 2 6.95 120 Rv3351c CAA15736 None...”
- Identification of secreted proteins of Mycobacterium tuberculosis by a bioinformatic approach
Gomez, Infection and immunity 2000 - “...MGVIARVVGVAACGLSLAVLAAAPTAGAEP VHRRTALKLPLLLAAGTVLGQAPRAAAEE rv3354* rv1291c rv0559c rv1891 rv3333c rv0040c rv1269c* rv2253 rv1860 rv0455c rv1268c* A B B A A...”
MSMEG_5766 DUF732 domain-containing protein from Mycolicibacterium smegmatis MC2 155
Aligns to 42:116 / 123 (61.0%), covers 100.0% of PF05305, 48.9 bits
LPRJ_MYCTU / O33192 Putative lipoprotein LprJ from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
Rv1690 PROBABLE LIPOPROTEIN LPRJ from Mycobacterium tuberculosis H37Rv
MT1729 hypothetical protein from Mycobacterium tuberculosis CDC1551
Aligns to 42:115 / 127 (58.3%), covers 94.4% of PF05305, 48.9 bits
- function: Overexpression induces expression of sensor protein kdpD gene at low K(+) concentrations (0 and 250 uM, tested in M.smegatis).
subunit: May interact with sensor protein KdpD. - MTS1338, A Small Mycobacterium tuberculosis RNA, Regulates Transcriptional Shifts Consistent With Bacterial Adaptation for Entering Into Dormancy and Survival Within Host Macrophages
Salina, Frontiers in cellular and infection microbiology 2019 - “...oxidase (subunit II) CydB (cytochrome BD-I oxidase subunit II) Intermediary metabolism and respiration ES 5.7 rv1690 lprJ Probable lipoprotein LprJ Cell wall and cell processes 0.3 rv1772 Conserved hypotheticals 0.3 rv2033c Conserved hypotheticals 0.2 rv2812 Probable transposase Insertion seqs and phages 0,1 rv2947c pks15 Probable polyketide...”
- Transcriptional Profiling of Mycobacterium tuberculosis Exposed to In Vitro Lysosomal Stress
Lin, Infection and immunity 2016 - “...MT3988 MT3989 Rv0040c Rv0173 Rv0341 Rv0888 Rv1197 Rv1198 Rv1690 Rv1737c Rv1884c Rv2346c Rv2347c Rv2346c Rv2389c Rv3874 Rv3875 mtc28 mce1E (lprK) iniB Secreted...”
- B in TB: B Cells as Mediators of Clinically Relevant Immune Responses in Tuberculosis
Rao, Clinical infectious diseases : an official publication of the Infectious Diseases Society of America 2015 - “...P67300 Putative membrane protein insertion efficiency factor Rv3922c 34 O33192 Lipoprotein LprJ (probable lipoprotein LprJ) Rv1690 35 P0A521 60 kDa chaperonin 2 (65 kDa antigen) (cell wall protein A) Rv0440 Proteins involved in central biochemistry of Mtb 36 O05870 Phosphate-binding protein pstS 2 (PBP 2) (PstS-2)...”
- Mycobacterium tuberculosis Is Resistant to Isoniazid at a Slow Growth Rate by Single Nucleotide Polymorphisms in katG Codon Ser315
Jeeves, PloS one 2015 - “...that were significantly differentially regulated). Four of the up-regulated genes encoded for lipoproteins (Rv0179c, Rv1244, Rv1690, and Rv3016). They have a diverse range of functions and their role in adaptation to antibiotic exposure is still unclear. However, two were up-regulated in a previous study upon isoniazid...”
- Synthetic lethality reveals mechanisms of Mycobacterium tuberculosis resistance to β-lactams
Lun, mBio 2014 - “...genes in our study. The finding that cell wall-associated proteins besides Rv3717, such as Rv1987, Rv1690, and Rv0129, overlapped in these two studies demonstrated the consistency of the two methodologies. Our data indicate that both the high-throughput alamarBlue assay and the pooled-mutant qPCR analysis are suitable...”
- Differential cellular recognition pattern to M. tuberculosis targets defined by IFN-γ and IL-17 production in blood from TB + patients from Honduras as compared to health care workers: TB and immune responses in patients from Honduras
Alvarez-Corrales, BMC infectious diseases 2013 - “...protein, also located at cell wall, plasma membrane. [ 18 , 28 - 31 ] Rv1690 CAB10947 (Pool 6) Probable lipoprotein 127 Putative uncharacterized protein. Protein binding, cellular component plasma membrane.[ 18 , 24 , 32 ] Rv3019c CAA16104 (Pool 7) ESAT-6 like protein 96 Belongs...”
- “...9/29 (31) Rv1886c 14/38 (37) 10/38 (26) 37/81 (46) 27/81 (33) 15/29 (52) 14/29 (48) Rv1690 6/38 (16) 18/81 (22) 8/29 (28) Rv3019c 8/38 (21) 10/38 (26) 29/81 (36) 37/81 (46) 9/29 (31) 16/29 (55) Rv2957 7/38 (18) 11/38 (29) 30/81 (37) 33/81 (41) 11/29 (38)...”
- Pattern recognition and cellular immune responses to novel Mycobacterium tuberculosis-antigens in individuals from Belarus
Ahmed, BMC infectious diseases 2012 - “...for the high affinity of mycobacteria to fibronectin Cell- wall associated protein Probable lipoprotein LPRJ Rv1690 Contains possible signal sequence and a prokaryotic membrane lipoprotein lipid attachment site Secreted ESAT-6 like protein ESXH (TB10.3) ESAT-6 Rv3019 Rv3875 (p) M.tb pathogenicity Possible glycosyl transferase Rv2957c, Rv2958c Rv2962c...”
- “...the study. The selected peptides have shown to be expressed in replicating bacteria (Rv0477c, Rv2940c, Rv1690, Rv1085c, Rv1886, Rv2962c, Rv2958c, Rv2957c), non-replicating bacteria (Rv2453c, yet also Rv0477c, Rv2940c) and are suggested to be able to differentiate between M.tb , MOTT and BCG (Rv3019, Rv0066c, Rv3347c). Some...”
- Non-coding RNA and its potential role in Mycobacterium tuberculosis pathogenesis
Arnvig, RNA biology 2012 - “...phase, infection 8,42 MTS1082 F Rv1373 Rv1375 130 Exponential phase 8 MTS1310 G2 R Rv1689 Rv1690 65 - 29 MTS1338 F Rv1733c Rv1735c 120 DosR, hypoxia, infection 8 MTS2774 mpr17 F Rv3596c RV3597c 80, 110 - 42 MTS2822 B11 R Rv3660c Rv3661 95 H 2 O...”
- More
- B in TB: B Cells as Mediators of Clinically Relevant Immune Responses in Tuberculosis
Rao, Clinical infectious diseases : an official publication of the Infectious Diseases Society of America 2015 - “...1A (MCE-family protein Mce1A) Rv0169 33 P67300 Putative membrane protein insertion efficiency factor Rv3922c 34 O33192 Lipoprotein LprJ (probable lipoprotein LprJ) Rv1690 35 P0A521 60 kDa chaperonin 2 (65 kDa antigen) (cell wall protein A) Rv0440 Proteins involved in central biochemistry of Mtb 36 O05870 Phosphate-binding...”
- Scoring protein relationships in functional interaction networks predicted from sequence data
Mazandu, PloS one 2011 - “...annotated to the lipid metabolism class. Similarly, protein lprJ (MT1729 or Rv1690), named lipoprotein LPRJ (O33192), is also known to be involved in lipid metabolism ( figure 12 ). All its direct interacting partners are of the unknown class, in which case if the class of...”
- Transcriptional Profiling of Mycobacterium tuberculosis Exposed to In Vitro Lysosomal Stress
Lin, Infection and immunity 2016 - “...cell processes MT0046 MT0182 MT0356 MT0911 MT1235 MT1236 MT1729 MT1779 MT1932 MT2411 MT2412 MT2420 MT2458 MT3988 MT3989 Rv0040c Rv0173 Rv0341 Rv0888 Rv1197...”
- Scoring protein relationships in functional interaction networks predicted from sequence data
Mazandu, PloS one 2011 - “...likely that fadA6 would have been annotated to the lipid metabolism class. Similarly, protein lprJ (MT1729 or Rv1690), named lipoprotein LPRJ (O33192), is also known to be involved in lipid metabolism ( figure 12 ). All its direct interacting partners are of the unknown class, in...”
- Microsatellite polymorphism across the M. tuberculosis and M. bovis genomes: implications on genome evolution and plasticity
Sreenu, BMC genomics 2006 - “...protein *Rv1246c (97) MT1284 (143) Mb1278c (97) AC5 6 lprJ *Rv1690 (127) S prob 0.939 MT1729 (127) S prob 0.939 Mb1716 (139) S prob 0.005 G5 4 Conserve membrane protein *Rv3693 (440) S prob: 0.994 MT3795 (475) S prob: 0.0 Mb3718 (440) c) Length decrease from...”
A0R4A7 DUF732 domain-containing protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
MSMEG_5766 hypothetical protein from Mycobacterium smegmatis str. MC2 155
Aligns to 32:106 / 113 (66.4%), covers 100.0% of PF05305, 48.8 bits
Mb1716 PROBABLE LIPOPROTEIN LPRJ from Mycobacterium bovis AF2122/97
Aligns to 56:127 / 139 (51.8%), covers 94.4% of PF05305, 48.8 bits
- Gut microbiota contributes to the methionine metabolism in host
Wu, Frontiers in microbiology 2022 - “...supplemented with ampicillin (MB1407, 1mg/ml, meilunbio), colistin (MB1064, 1mg/ml, meilunbio), metronidazole (B300250, 1mg/ml, Aladdin), neomycin (MB1716, 1mg/ml, meilunbio), and vancomycin (V301569, 0.5mg/ml, Aladdin) in drinking water for 2weeks. Mice were then euthanized by CO 2 asphyxiation and colon samples were collected ( Figure 1C ). Standard...”
- Microsatellite polymorphism across the M. tuberculosis and M. bovis genomes: implications on genome evolution and plasticity
Sreenu, BMC genomics 2006 - “...Mb1278c (97) AC5 6 lprJ *Rv1690 (127) S prob 0.939 MT1729 (127) S prob 0.939 Mb1716 (139) S prob 0.005 G5 4 Conserve membrane protein *Rv3693 (440) S prob: 0.994 MT3795 (475) S prob: 0.0 Mb3718 (440) c) Length decrease from N-terminal (6) G2 3 PBP-4...”
MMAR_0908 hypothetical protein from Mycobacterium marinum M
Aligns to 24:101 / 111 (70.3%), covers 97.2% of PF05305, 43.8 bits
Rv1974 PROBABLE CONSERVED MEMBRANE PROTEIN from Mycobacterium tuberculosis H37Rv
Aligns to 36:109 / 125 (59.2%), covers 94.4% of PF05305, 43.4 bits
- Structural and functional characterization of a hypothetical protein in the RD7 region in clinical isolates of Mycobacterium tuberculosis - an in silico approach to candidate vaccines
Kootery, Journal, genetic engineering & biotechnology 2022 - “...possess eight mce-associated membrane proteins (Rv1966-Rv1973), two integral proteins (Rv1964, Rv1965), and one membrane protein (Rv1974). Although the function of mce genes is not completely studied, computational studies of mce2 genes have shown T-cell epitopes inducing property revealing the immunogenic nature of mce genes [ 12...”
- In silico comparisons of lipid-related genes between Mycobacterium tuberculosis and BCG vaccine strains
Sarno, Genetics and molecular biology 2021 - “...operon: four were in the cell wall and cell processes category (Rv1970 and Rv1972 to Rv1974) and six (Rv1965 to Rv1969 and Rv1971) in the virulence, detoxification, adaptation category. The gene encoding enoyl-CoA hydratase (Rv0222), which is part of the fatty acid degradation metabolism, was categorized...”
- “...Jia et al., 2017 ; Wright et al., 2017 ). Genes at loci Rv1965 to Rv1974, which encode proteins from the mce3 operon, were found to be absent in all BCG strains, accounting for 10 of the 14 non-homologous genes identified. The mce3 operon is an...”
- The Bioinformatics Analysis of Comparative Genomics of Mycobacterium tuberculosis Complex (MTBC) Provides Insight into Dissimilarities between Intraspecific Groups Differing in Host Association, Virulence, and Epitope Diversity
Jia, Frontiers in cellular and infection microbiology 2017 - “...RD7 Rv1972 191 Mce associated membrane protein RD7 Rv1973 160 Mce associated membrane protein RD7 Rv1974 125 Membrane protein RD7 Rv1975 221 COG2340S Hypothetical protein RD7 Rv1976c 135 Hypothetical protein RD7 Rv1977 348 COG0501O Hypothetical protein RD7 Rv2073c 249 COG0300R Oxidoreductase RD9 Rv2074 137 Pyridoxamine 5'-phosphate...”
- “...yrbEA and yrbEB ) from the eight mce3 genes and the four genes downstream ( Rv1974, Rv1975, Rv1976c , and Rv1977 ) from the eight mce3 genes encode integral membrane proteins and signal sequences, respectively (Harboe et al., 2002 ). Their absence in animal isolates might...”
- Metabolic Perspectives on Persistence
Hartman, Microbiology spectrum 2017 - “...transport and metabolism aftB 3805c capsule polysaccharide biosynthetic process rv3472 3472 CHP rv0199 0199 CMP rv1974 1974 CMP aceE 2241 energy production and conversion - pyruvate dehydrogenase E1 rv0100 0100 extracellular region rv0098 0098 fatty acid biosynthetic process rv1021 1021 general functional prediction only rv3649 3649...”
- Whole Genome Sequencing of Mycobacterium africanum Strains from Mali Provides Insights into the Mechanisms of Geographic Restriction
Winglee, PLoS neglected tropical diseases 2016 - “...protein RD7 Rv2073c oxidoreductase RD9 Rv1973 MCE-associated membrane protein RD7 Rv2074 pyridoxamine 5'-phosphate oxidase RD9 Rv1974 membrane protein RD7 Rv2084 hypothetical protein Rv1975 hypothetical protein RD7 Rv1976c hypothetical protein RD7 gained Annotation RD Rv3617 epoxide hydrolase EphA RD8 O850451604 PPE family protein Rv3618 monooxygenase RD8 Rv3619c...”
- Identification of outer membrane proteins of Mycobacterium tuberculosis
Song, Tuberculosis (Edinburgh, Scotland) 2008 - “...membrane protein 136 0.6 4 0.24 0.65 0 6.52 81 Rv1974 CAA17847 None Probable conserved membrane protein 88 0.6 3 0.23 0.65 2 8.19 82 Rv1975 CAA17848 None...”
- Revisiting the evolution of Mycobacterium bovis
Mostowy, Journal of bacteriology 2005 - “...Together with the loss of genes Rv1514c, Rv1563c, Rv1974, and cobL (Rv2072c) in deletions previously documented (RD4, RD17, RD7, and RD9, respectively), this...”
- Cloning and expression of multiple integral membrane proteins from Mycobacterium tuberculosis in Escherichia coli
Korepanova, Protein science : a publication of the Protein Society 2005 - “...Rv1635c Rv1819c Rv1824 Rv1857 Rv1861 Rv1892 Rv1902c Rv1924c Rv1974 Rv2076c Rv2144c Rv2146c Rv2169c Rv2198c Rv2199c Rv2272 Rv2273 Rv2287 10.4 26.9 50.8 11.8 13.9...”
- More
ML2274 putative secreted protein from Mycobacterium leprae TN
Aligns to 25:101 / 112 (68.8%), covers 98.6% of PF05305, 42.8 bits
MAP4056c hypothetical protein from Mycobacterium avium subsp. paratuberculosis str. k10
Aligns to 46:120 / 130 (57.7%), covers 98.6% of PF05305, 42.4 bits
- Identification of Sero-Diagnostic Antigens for the Early Diagnosis of Johne's Disease using MAP Protein Microarrays
Li, Scientific reports 2019 - “...30 . It is noteworthy as well that several recombinant MAP proteins, including MAP0334, MAP0435c, MAP4056c, and MAP1204+MAP1272c that have been previously recognized as reactive in infected animals were not seen to be differentially reactive in our current studies with MAP arrays 10 12 , 29...”
- “...group although with a p-value for comparison of mean intensity <0.01. The results showed that MAP4056c, a secreted protein, was previously identified from MAP culture filtrate and shown to be recognized by infected cows 11 , but was not included in our final list of candidates...”
MAV_4583 hypothetical protein from Mycobacterium avium 104
Aligns to 50:124 / 134 (56.0%), covers 98.6% of PF05305, 42.3 bits
Y559_MYCTU / P9WKL3 Uncharacterized protein Rv0559c from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
MRA_0566 putative conserved secreted protein from Mycobacterium tuberculosis H37Ra
NP_215073 hypothetical protein from Mycobacterium tuberculosis H37Rv
Rv0559c POSSIBLE CONSERVED SECRETED PROTEIN from Mycobacterium tuberculosis H37Rv
Aligns to 23:101 / 112 (70.5%), covers 95.8% of PF05305, 42.3 bits
- The Inhibitory Effect of GlmU Acetyltransferase Inhibitor TPSA on Mycobacterium tuberculosis May Be Affected Due to Its Methylation by Methyltransferase Rv0560c
Chen, Frontiers in cellular and infection microbiology 2019 - “...drew our attention to the upstream or downstream genes of MRA_0567 , including MRA_0564, MRA_0565, MRA_0566 , and MRA_0568 . Three of these genes, MRA_0565 (61.82-fold), MRA_0566 (112.99-fold), and MRA_0568 (5.58-fold) were also upregulated ( Supplementary Figure 7D ). H37Ra Transcriptome Profile Changed in Response to...”
- “...and molecular functions ( Supplementary Figure 8B ). Three genes with increased expression were MRA_0565, MRA_0566 , and MRA_0567 . These results were consistent with the proteome results. Meanwhile, the genes with diminished expression were MRA_RS02635, MRA_0731, MRA_1749, MRA_2046, rnpB, Novel 00016 (a novel transcript) and...”
- A comparison of Rv0559c and Rv0560c expression in drug-resistant Mycobacterium tuberculosis in response to first-line antituberculosis drugs.
Gamngoen, Tuberculosis (Edinburgh, Scotland) 2018 (PubMed)- GeneRIF: Rv0559c and Rv0560c expression in drug-resistant Mycobacterium tuberculosis is altered in response to first-line antituberculosis drugs.
- Insight into the drug-resistant characteristics and genetic diversity of multidrug-resistant Mycobacterium tuberculosis in China
Song, Microbiology spectrum 2023 - “...L2.2.1. In addition, the genes fhaA , fadD34 , Rv0063 , Rv0140 , Rv0538 , Rv0559c , fbiC , Rv1435c , Rv1667c , Rv1730 , Rv1883c , Rv2006 , qcrB , Rv2407 , Rv2434c , mmuM , Rv3080c , accE5, and Rv3785 have varying degree of...”
- “...Function unknown 12 L2.2.1(12) Rv0538 631326 DEL 72 bp, 36 bp Unknown 31 L4.2(30), L4.5(1) Rv0559c 650639 DEL 29 bp Unknown 14 L2.2.1(14) fbiC (Rv1173) 1305494 DEL 124 bp, 62 bp Essential for coenzyme F420 production 52 L2.2.1(13), L2.2.2(1), L4.2(2), L4.2(3), L4.5(33) Rv1435c 1612624 INS 21...”
- Contribution and Future of High-Throughput Transcriptomics in Battling Tuberculosis
Martínez-Pérez, Frontiers in microbiology 2022 - “...). Some of the main findings of these studies included a possible role of genes Rv0559c and Rv0560c ( Knegt et al., 2013 ) in rifampicine resistance; they also found a set of genes upregulated in Mtb persisters, including UspA , SigF , or dnaE2 (...”
- Functional and Biochemical Characterization of the MazEF6 Toxin-Antitoxin System of Mycobacterium tuberculosis
Chattopadhyay, Journal of bacteriology 2022 (secret) - Genome-Wide Transcriptional Responses of Mycobacterium to Antibiotics
Briffotaux, Frontiers in microbiology 2019 - “...isoniazide exposure ( Gamngoen et al., 2018 ). The mechanism and function of Rv0560c and Rv0559c in response to two of the first-line TB drugs, rifampicin and isoniazid, merit further study. The mutation in rpoB can be associated with a fitness cost for bacteria ( Mariam...”
- “...R. Putim C. Salee P. Phunpae P. Butr-Indr B. ( 2018 ). A comparison of Rv0559c and Rv0560c expression in drug-resistant Mycobacterium tuberculosis in response to first-line antituberculosis drugs. Tuberc 108 64 69 . 10.1016/j.tube.2017.11.002 29523329 Geiman D. E. Raghunand T. R. Agarwal N. Bishai W....”
- A comparison of Rv0559c and Rv0560c expression in drug-resistant Mycobacterium tuberculosis in response to first-line antituberculosis drugs
Gamngoen, Tuberculosis (Edinburgh, Scotland) 2018 (PubMed)- “...Rv0559c and Rv0560c expression in drug-resistant Mycobacterium tuberculosis in response to first-line antituberculosis drugs Tuberculosis Journal 14729792 108 64 69 64-69...”
- “...of M. tuberculosis was performed in this study. Rv0559c is an unknown secreted protein. Rv0560c is a putative benzoquinone methyltransferase of M. tuberculosis...”
- Genome-wide DNA methylation and transcriptome changes in Mycobacterium tuberculosis with rifampicin and isoniazid resistance
Chen, International journal of clinical and experimental pathology 2018 (secret) - The EXIT Strategy: an Approach for Identifying Bacterial Proteins Exported during Host Infection
Perkowski, mBio 2017 - “...exported proteins with roles promoting growth in macrophages ( rv1508 :: tn , rv3707c:tn , rv0559c :: tn , and rv2536 :: tn ). Murine bone marrow-derived macrophages were infected with M.tuberculosis CDC1551 transposon mutants lacking individual in vivo induced exported proteins. At specific times postinfection,...”
- “...mice ( 14 , 78 , 79 ) 0.028 Rv0506 mmpS2 Unknown SP, TM 0.007 Rv0559c Unknown SP 0.008 Rv0593 lprL , mce2E Mce family lipoprotein Lipo, TM In mice ( 80 ) 0.006 Rv0615 Unknown TM 0.017 Rv0713 Unknown TM 0.001 Rv0817c Unknown SP, TM...”
- Mycobacterium tuberculosis Rv0560c is not essential for growth in vitro or in macrophages
Kokoczka, Tuberculosis (Edinburgh, Scotland) 2017 - “...6 ]. Rv0560c is transcribed from a highly inducible promoter as a bicistronic transcript with Rv0559c [ 6 ]. Based on its chromosomal location near other genes involved in menaquinone or isoprenoid biosynthesis, it is proposed to be a benzoquinone methyl transferase involved in the synthesis...”
- More
MSMEG_3493 putative secreted protein from Mycobacterium smegmatis str. MC2 155
Aligns to 26:99 / 113 (65.5%), covers 100.0% of PF05305, 42.1 bits
MMAR_2891 hypothetical protein from Mycobacterium marinum M
Aligns to 34:105 / 122 (59.0%), covers 83.3% of PF05305, 33.4 bits
- Capillary zone electrophoresis-electrospray ionization-tandem mass spectrometry for top-down characterization of the Mycobacterium marinum secretome
Zhao, Analytical chemistry 2014 - “...19 gi|183980785 PPE family protein, PPE10 8.6 M. marinum M CE,LC 20 gi|183982895 hypothetical protein MMAR_2891 10.2 M. marinum M 21 gi|183982952 hypothetical protein MMAR_2949 15.3 M. marinum M CE,LC 22 gi|183983815 hypothetical protein MMAR_3840 9.8 M. marinum M CE,LC a Rank is based on E...”
- Differential gene repertoire in Mycobacterium ulcerans identifies candidate genes for patho-adaptation
Käser, PLoS neglected tropical diseases 2008 - “...proteins, probably surface exposed MMAR_2842 MUL_2900 ion dependent/ short-chain fatty acid transporter MMAR_2890 * , MMAR_2891 * , MMAR_2897 * , MMAR_3540 conserved hypothetical secreted proteins, potentially antigenic MMAR_2896 * WcaG-like nucleoside-diphosphate-sugar epimerase, NAD dependend dehydratase, possibly involved in cell wall biogenesis; epimerases may be potential...”
Rv0622 POSSIBLE MEMBRANE PROTEIN from Mycobacterium tuberculosis H37Rv
Aligns to 139:195 / 315 (18.1%), covers 51.4% of PF05305, 31.7 bits
- Newly Identified Mycobacterium africanum Lineage 10, Central Africa
Guyeux, Emerging infectious diseases 2024 (no snippet) - Rv0500A is a transcription factor that links Mycobacterium tuberculosis environmental response with division and impacts host colonization
Kevorkian, Molecular microbiology 2022 - “...greatest number of hits (8/28, all with the same insertion site) in this group was rv0622 , annotated as a possible membrane protein ( Kapopoulou et al., 2011 ). As the basal level of rv2390c ::GFP expression in the secondary screen for the rv0622 ::Tn( rv2390c...”
- “...conditions, suggesting potential issues with the reporter, we cured the rv2390c ::GFP plasmid from a rv0622 ::Tn mutant and reintroduced it into the cured strain. This new rv0622 ::Tn( rv2390c ::GFP) mutant demonstrated no change in reporter induction versus WT Mtb ( Figure S1b ), indicating...”
- Beijing sublineages of Mycobacterium tuberculosis differ in pathogenicity in the guinea pig
Kato-Maeda, Clinical and vaccine immunology : CVI 2012 - “...Mutations in sublineage RD207 Rv0327c Rv0380c Rv0411c Rv0622 Rv0859 Rv0892 Rv0944 Rv0989c Rv1073 Rv1523 Rv1557 Rv1894c Rv1934c Rv2579 Rv2688c Rv2821c Rv2959c...”
- Proteomic definition of the cell wall of Mycobacterium tuberculosis
Wolfe, Journal of proteome research 2010 - “...DELTA-AMINOLEVULINIC ACID DEHYDRATASE HEMB 7 I.G.12 C Rv0614 Rv0614 CONSERVED HYPOTHETICAL PROTEIN 10 V A Rv0622 Rv0622 POSSIBLE MEMBRANE PROTEIN 3 II.C.5 B Rv0638 secE1 PROBABLE PREPROTEIN TRANSLOCASE SECE1 3 III.D D Rv0712 Rv0712 CONSERVED HYPOTHETICAL PROTEIN 10 V B Rv0771 Rv0771 POSSIBLE 4-CARBOXYMUCONOLACTONE DECARBOXYLASE (CMD)...”
- “...( 42 , 16 ) Rv0583c lpqN x yes yes ( 16 , 19 ) Rv0622 Rv0622 x Rv0830 Rv0830 x ( 46 ) Rv0858c Rv0858c x Rv0892 Rv0892 x Rv0902c prrB x Rv0928 pstS3 x yes yes ( 16 , 45 ) Rv0934 pstS1 x...”
Or search for genetic data about PF05305 in the Fitness Browser
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory