Family Search for PF06916 (FAM210A-B_dom)
April 2024: See Interactive Tools for Functional Annotation of Bacterial Genomes for advice on using these tools.
PF06916 hits 13 sequences in PaperBLAST's database above the trusted cutoff. Showing all hits. Or show only hits to curated sequences or try another family.
F210B_HUMAN / Q96KR6 Protein FAM210B, mitochondrial from Homo sapiens (Human) (see 2 papers)
NP_543011 protein FAM210B, mitochondrial from Homo sapiens
Aligns to 87:174 / 192 (45.8%), covers 100.0% of PF06916, 107.0 bits
- function: Plays a role in erythroid differentiation (PubMed:26968549). Involved in cell proliferation and tumor cell growth suppression (PubMed:28594398). Involved in the metabolic reprogramming of cancer cells in a PDK4-dependent manner (PubMed:28594398).
- Elucidation of the Role of FAM210B in Mitochondrial Metabolism and Erythropoiesis.
Suzuki, Molecular and cellular biology 2022 - GeneRIF: Elucidation of the Role of FAM210B in Mitochondrial Metabolism and Erythropoiesis.
- FAM210B is an erythropoietin target and regulates erythroid heme synthesis by controlling mitochondrial iron import and ferrochelatase activity.
Yien, The Journal of biological chemistry 2018 - GeneRIF: FAM210B is an erythropoietin target and regulates erythroid heme synthesis by controlling mitochondrial iron import and ferrochelatase activity
- Loss of the novel mitochondrial protein FAM210B promotes metastasis via PDK4-dependent metabolic reprogramming.
Sun, Cell death & disease 2017 - GeneRIF: it was found that low expression of FAM210B was significantly correlated with decreased survival and enhanced metastasis in vivo and in vitro, and the loss of FAM210B led to an increased mitochondrial respiratory capacity and reduced glycolysis through the downregulation of pyruvate dehydrogenase kinase 4 (PDK4).
- Identification of a novel putative mitochondrial protein FAM210B associated with erythroid differentiation.
Kondo, International journal of hematology 2016 (PubMed)- GeneRIF: Both human and murine FAM210B are abundantly expressed in the later stages of erythroblast development. Moreover, the deduced amino acid sequence predicted that FAM210B is a membrane protein, and Western blot analysis demonstrated its mitochondrial localization. Loss-of-function analysis in erythroid cells suggested that FAM210B may be involved in erythroid differentiation.
- Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
Palmieri, Cancer epidemiology, biomarkers & prevention : a publication of the American Association for Cancer Research, cosponsored by the American Society of Preventive Oncology 2008 - GeneRIF: Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
- Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
Rose, Molecular medicine (Cambridge, Mass.) - GeneRIF: Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
- Integrated Bottom-Up and Top-Down Proteomics of Patient-Derived Breast Tumor Xenografts.
Ntai, Molecular & cellular proteomics : MCP 2016 - “...and H101 NP_037519 Q9UDW1 Cytochrome b-c1 complex subunit 9 I47V I47 and V47 I47 NP_543011 Q96KR6 Protein FAM210B P126S P126 and S126 P126 a not detected. Fig. 2. Protein identifications in WHIM2 and WHIM16. ( A ) TD spectrum of gamma-synuclein displaying the distinctive pattern of...”
- Discovery of colorectal cancer biomarker candidates by membrane proteomic analysis and subsequent verification using selected reaction monitoring (SRM) and tissue microarray (TMA) analysis
Kume, Molecular & cellular proteomics : MCP 2014 - “...2 Q8N6Q3 CD177 antigen P07093 Glia-derived nexin Q96KR6 Transmembrane protein C20orf108 P09619 Beta-type platelet-derived growth factor receptor Q7L4E1 Protein...”
F210B_MOUSE / Q9D8B6 Protein FAM210B, mitochondrial from Mus musculus (Mouse) (see paper)
XP_006500122 protein FAM210B, mitochondrial isoform X1 from Mus musculus
Aligns to 85:172 / 190 (46.3%), covers 100.0% of PF06916, 105.0 bits
LOC109011575 uncharacterized protein LOC109011575 from Juglans regia
Aligns to 103:186 / 199 (42.2%), covers 98.9% of PF06916, 98.7 bits
- Integrated physiological, proteomic, and metabolomic analyses of pecan cultivar 'Pawnee' adaptation to salt stress
Jiao, Scientific reports 2022 - “...LOC108986997, LOC108987294, LOC108990523, LOC108993800, LOC108995000, LOC108995788, LOC108998475, LOC109003002, LOC109005150, LOC109005909, LOC109007845, LOC109010267, LOC109010467, LOC109010561, LOC109011398, LOC109011575, LOC109012612, LOC109020284) from various pathways, including those of fructose metabolism, glutamine biosynthesis, glucose metabolism, photosynthetic subunit of subcomplex, ribosomal protein, and HSPs, and performed PRM analysis (Table 2 , Table...”
- “...16 A0A2I4GSU9 AT1G64770 LOC109010561 YETLDQGR 0.25 17 A0A2I4GW66 AT1G12230 LOC109011398 LAYDTHGIIR 0.38 18 A0A2I4GWV0 AT2G27290 LOC109011575 VGISTNETGEK 0.36 19 A0A2I4H153 AT4G13010 LOC109012612 AVQYNAYGGGPDGLQHVEVPVPTPNKDEVLLR 0.15 20 A0A2I4HQ33 AT5G48480 LOC109020284 ASDAIQFYK 0.26 *Gene code was derived from Arabidopsis thaliana (TAIR10) ( https://www.arabidopsis.org/index.jsp ). PRM, parallel reaction monitoring; DEPs,...”
Q5XIJ4 Protein FAM210A from Rattus norvegicus
Aligns to 125:212 / 273 (32.2%), covers 98.9% of PF06916, 97.7 bits
- The mitochondrial proteomic changes of rat hippocampus induced by 28-day simulated microgravity.
Ji, PloS one 2022 - “...Aldehyde dehydrogenase X, mitochondrial 1.60 0.006674 D3ZKG1_RAT D3ZKG1 Mmut Methylmalonyl CoA mutase 1.60 0.015932 F210A_RAT Q5XIJ4 Fam210a Protein FAM210A 1.60 0.013908 FMT_RAT Q5I0C5 Mtfmt Methionyl-tRNA formyltransferase, mitochondrial 1.60 0.018123 CEGT_RAT Q9R0E0 Ugcg Ceramide glucosyltransferase 1.60 0.020969 A0A0H2UI21_RAT A0A0H2UI21 Crat Carnitine O-acetyltransferase 1.59 0.011738 M0R3V4_RAT M0R3V4 Mydgf...”
- Integrative proteomics and pharmacogenomics analysis of methylphenidate treatment response
da, Translational psychiatry 2019 - “...P84100 60S ribosomal protein L19 Rpl19 1.052 0.0373 Q4KM74 Vesicle-trafficking protein SEC22b Sec22b 1.048 0.0462 Q5XIJ4 Protein FAM210A Fam210a 1.035 0.0177 A0A0G2K4T7 General transcription factor II-I Gtf2i 1.031 0.0020 Q641Y2 NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial Ndufs2 1.029 0.0243 P62332 ADP-ribosylation factor 6 Arf6 1.025...”
F210A_MOUSE / Q8BGY7 Protein FAM210A from Mus musculus (Mouse) (see paper)
XP_006525587 protein FAM210A isoform X1 from Mus musculus
Aligns to 125:212 / 273 (32.2%), covers 98.9% of PF06916, 96.9 bits
- function: May play a role in the structure and strength of both muscle and bone.
subunit: Interacts with ATAD3A.
disruption phenotype: Embryonic lethality in homozygotes mice after embryonic day 9.5 (PubMed:29618611). Tamoxifen-inducible Fam210a homozygous knockout mice exhibit decreased grip strength, lean mass of all limbs, bone mineral density, bone biomechanical strength, and elevated osteoclast activity with microarchitectural deterioration of trabecular and cortical bones (PubMed:29618611). - FAM210A regulates mitochondrial translation and maintains cardiac mitochondrial homeostasis.
Wu, Cardiovascular research 2023 - GeneRIF: FAM210A regulates mitochondrial translation and maintains cardiac mitochondrial homeostasis.
- FAM210A is essential for cold-induced mitochondrial remodeling in brown adipocytes.
Qiu, Nature communications 2023 - GeneRIF: FAM210A is essential for cold-induced mitochondrial remodeling in brown adipocytes.
- MicroRNA-574 regulates FAM210A expression and influences pathological cardiac remodeling.
Wu, EMBO molecular medicine 2021 - GeneRIF: MicroRNA-574 regulates FAM210A expression and influences pathological cardiac remodeling.
- Modulators of Fam210a and Roles of Fam210a in the Function of Myoblasts.
Tanaka, Calcified tissue international 2020 (PubMed)- GeneRIF: Modulators of Fam210a and Roles of Fam210a in the Function of Myoblasts.
- FAM210A is a novel determinant of bone and muscle structure and strength.
Tanaka, Proceedings of the National Academy of Sciences of the United States of America 2018 - GeneRIF: Fam210a was expressed in muscle mitochondria and cytoplasm but not in bone. Nevertheless, in genetically modified mouse models, Fam210a strongly influenced the structure and strength of both muscle and bone.
- Proteomic Assessment of C57BL/6 Hippocampi after Non-Selective Pharmacological Inhibition of Nitric Oxide Synthase Activity: Implications of Seizure-like Neuronal Hyperexcitability Followed by Tauopathy
Hendrickx, Biomedicines 2022 - “...TPR 0.979 0.0253 Q9WUM3 Coro1b Coronin-1B 0.43 0.0253 Q9CPT4 Mydgf Myeloid-derived growth factor 1.1 0.0255 Q8BGY7 Fam210a Protein FAM210A 0.831 0.0261 Q9CR00 Psmd9 26S proteasome non-ATPase regulatory subunit 9 0.754 0.0261 Q9D7H3 RtcA RNA 3-terminal phosphate cyclase 0.973 0.0261 P61294 Rab6b Ras-related protein Rab-6B 1.08 0.0267...”
- Rabbit Antidiethoxyphosphotyrosine Antibody, Made by Single B Cell Cloning, Detects Chlorpyrifos Oxon-Modified Proteins in Cultured Cells and Immunopurifies Modified Peptides for Mass Spectrometry
Onder, Journal of proteome research 2021 - “...[C12]; diethoxyphosphate [Y3] Q8CIG8 protein arginine N -methyltransferase5 2566.1949 856.0686 76.4 54 YTVTLGGTSFTVK diethoxyphosphate [Y1] Q8BGY7 protein FAM210A 1509.76 755.3835 67.8 55 TYFLKPSK diethoxyphosphate [Y2] Q9CQE1 protein NipSnap homologue 3B 1119.585 560.2958 76.8 56 LGQIYQSWLDK diethoxyphosphate [Y5] Q9CQU3 protein RER1 1486.7342 743.8709 94.5 57 LLACYK carbamidomethyl...”
- Maternal High Fat Diet and in-Utero Metformin Exposure Significantly Impact upon the Fetal Renal Proteome of Male Mice.
Nüsken, Journal of clinical medicine 2019 - “...Ts, mitochondrial <0.05 4.6 0 3 Tsfm Q8R409 Protein HEXIM1 <0.05 4.4 0 3 Hexim1 Q8BGY7 Protein FAM210A <0.05 4.3 0 3 Fam210a O88665 Bromodomain-containing protein 7 <0.001 4.3 0 3 Brd7 Q3UIX4 N/A <0.05 4.1 0 3 Srsf11 # E9QMC1 Cingulin <0.05 4.0 0 3...”
AT2G27290 hypothetical protein from Arabidopsis thaliana
Aligns to 101:184 / 201 (41.8%), covers 98.9% of PF06916, 95.4 bits
- The thylakoid membrane protein NTA1 is an assembly factor of the cytochrome b6f complex essential for chloroplast development in Arabidopsis
Li, Plant communications 2023 - “...in Arabidopsis and is defective in the same gene locus as the deip1 mutant , AT2G27290 . Similar to deip1 , nta1 had severe defects in chloroplast development and plant growth, including albinism, seedling lethality, and collapse of thylakoid membranes. Functional characterization indicated that NTA1 localizes...”
- “...of the T-DNA insertions (d) was inserted in the second intron of the NTA1 ( AT2G27290 ) gene, which caused the nta1 phenotype. NTA1-S1 and NTA1-N1 indicate the two sequences mutated by CRISPR-Cas9, and NTA1 -WT shows the wild-type NTA1 sequences selected for CRISPR targeting. The...”
- De-etiolation-induced protein 1 (DEIP1) mediates assembly of the cytochrome b6f complex in Arabidopsis
Sandoval-Ibáñez, Nature communications 2022 - “...factor for Cyt b 6 f complex biogenesis in Arabidopsis. The protein, encoded by locus AT2G27290, facilitates the assembly of the core protein subunits of the complex. The corresponding gene was found in a time-resolved analysis of gene expression during the greening of etiolated tobacco (...”
- “...product de-etiolation induced protein 1 (DEIP1). Its putative ortholog in Arabidopsis is encoded by locus AT2G27290 and shows high expression in all green tissues, including cotyledons and true leaves (Supplementary Fig. 1b ) 41 , 42 . The predicted protein comprises 201 amino acids, and contains...”
- RLPredictiOme, a Machine Learning-Derived Method for High-Throughput Prediction of Plant Receptor-like Proteins, Reveals Novel Classes of Transmembrane Receptors
Silva, International journal of molecular sciences 2022 - “...isomerase, putative, expressed AT2G22425 0.0 0.33333333 1 4 signal peptidase complex subunit 1, putative, expressed AT2G27290 0.0 0.33333333 1 4 protein of unknown function DUF1279 domain containing protein, expressed AT5G49540 0.0 0.33333333 1 4 transmembrane protein 93, putative, expressed AT1G13770 0.0 0.33333333 1 4 DUF647 domain...”
- Integrated physiological, proteomic, and metabolomic analyses of pecan cultivar 'Pawnee' adaptation to salt stress
Jiao, Scientific reports 2022 - “...0.15 16 A0A2I4GSU9 AT1G64770 LOC109010561 YETLDQGR 0.25 17 A0A2I4GW66 AT1G12230 LOC109011398 LAYDTHGIIR 0.38 18 A0A2I4GWV0 AT2G27290 LOC109011575 VGISTNETGEK 0.36 19 A0A2I4H153 AT4G13010 LOC109012612 AVQYNAYGGGPDGLQHVEVPVPTPNKDEVLLR 0.15 20 A0A2I4HQ33 AT5G48480 LOC109020284 ASDAIQFYK 0.26 *Gene code was derived from Arabidopsis thaliana (TAIR10) ( https://www.arabidopsis.org/index.jsp ). PRM, parallel reaction monitoring;...”
- Identification of miRNAs and Their Targets in the Liverwort Marchantia polymorpha by Integrating RNA-Seq and Degradome Analyses
Lin, Plant & cell physiology 2016 - “...CO-TRANSPORTER 1 Mpo-miR11677 LW11685 LW9386 NA AT1G48380 HYPOCOTYL 7 LW28862 NA EFJ23241 NA LW798 NA AT2G27290 NA LW8919 NA AT2G20780 Carbohydrate transmembrane transporter activity LW3390 NA AT1G55350 DEFECTIVE KERNEL 1 LW2282 NA AT4G38160 PIGMENT DEFECTIVE 191 LW3379 NA AT1G75200 Radical SAM domain-containing protein LW769 NA AT5G47390...”
F210A_HUMAN / Q96ND0 Protein FAM210A from Homo sapiens (Human) (see paper)
NP_689565 protein FAM210A from Homo sapiens
Aligns to 124:211 / 272 (32.4%), covers 98.9% of PF06916, 92.8 bits
- function: May play a role in the structure and strength of both muscle and bone.
subunit: Interacts with ATAD3A. - Expression and purification of the mitochondrial transmembrane protein FAM210A in Escherichia coli.
Hollinger, bioRxiv : the preprint server for biology 2023 - “...the mitochondrial targeting sequence (dMTS) of the human FAM210A coding sequence (CDS; Uniprot Entry # Q96ND0) region was amplified using Q5 DNA polymerase (NEB, Cat # M0491). The FAM210A DNA was inserted into 2Cc-T and 2CT-10 vectors using the Ligation Independent Cloning (LIC) method. The plasmids...”
- Chronic Occupational Exposure to Ionizing Radiation Induces Alterations in the Structure and Metabolism of the Heart: A Proteomic Analysis of Human Formalin-Fixed Paraffin-Embedded (FFPE) Cardiac Tissue.
Azimzadeh, International journal of molecular sciences 2020 - “...1 alpha 7 0.59 8.36 10 3 Q9NQR4 NIT2 Omega-amidase NIT2 0.59 1.48 10 2 Q96ND0 FAM210A Protein FAM210A 0.58 3.74 10 2 P46109 CRKL Crk-like protein 0.58 2.56 10 2 Q13409 DYNC1I2 Cytoplasmic dynein 1 intermediate chain 2 0.57 9.61 10 3 P62906 RPL10A 60S...”
- Advancing the Role of Gamma-Tocotrienol as Proteasomes Inhibitor: A Quantitative Proteomic Analysis of MDA-MB-231 Human Breast Cancer Cells
Ramdas, Biomolecules 2019 - “...Histone H2B type 1-K HIST1H2BK -1.88 Q01085 Nucleolysin TIAR TIAL1 -1.89 O75923 Dysferlin DYSF -1.23 Q96ND0 Protein FAM210A FAM210A -3.82 M2P21980 Protein-glutamine gamma-glutamyltransferase 2 TGM2 -1.54 * p < 0.05. biomolecules-10-00019-t003_Table 3 Table 3 List of the unique proteins in the union and intersections between the...”
- Presence of Round Cells Proteins do not Interfere with Identification of Human Sperm Proteins from Frozen Semen Samples by LC-MS/MS.
Panner, International journal of molecular sciences 2019 - “...UE Q8TF71 SLC16A10 Monocarboxylate transporter 10 2.0 VL 0.0 - 0.00 Unique to Group 2 Q96ND0 FAM210A Protein FAM210A 5.0 VL 0.7 VL 0.14 OE P12074 COX6A1 Cytochrome c oxidase subunit 6A1, mitochondrial 10.0 L 21.0 M 2.15 OE VL: very low; L: low; M: medium;...”
- Circular RNA cFAM210A, degradable by HBx, inhibits HCC tumorigenesis by suppressing YBX1 transactivation.
Yu, Experimental & molecular medicine 2023 - GeneRIF: Circular RNA cFAM210A, degradable by HBx, inhibits HCC tumorigenesis by suppressing YBX1 transactivation.
- FAM210A is a novel determinant of bone and muscle structure and strength.
Tanaka, Proceedings of the National Academy of Sciences of the United States of America 2018 - GeneRIF: Genetic variation near FAM210A, a gene of previously unknown function, was strongly associated with both appendicular and whole body lean mass, as well as bone mineral density.
- Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
Hendrickson, PloS one 2010 - GeneRIF: Observational study of gene-disease association. (HuGE Navigator)
NAT2 potential N-terminal peptidyl-methionine acetyltransferase from Candida albicans (see paper)
Aligns to 33:157 / 212 (59.0%), covers 98.9% of PF06916, 92.6 bits
- CharProtDB CGD description: Predicted ORF in Assemblies 19, 20 and 21; mutation confers hypersensitivity to toxic ergosterol analog
NP_499555 DUF1279 domain-containing protein from Caenorhabditis elegans
Aligns to 82:171 / 263 (34.2%), covers 97.7% of PF06916, 88.0 bits
SPBC106.07c N alpha-acetyltransferase Nat2 (predicted) from Schizosaccharomyces pombe
Aligns to 52:155 / 167 (62.3%), covers 98.9% of PF06916, 85.2 bits
- Global Fitness Profiling Identifies Arsenic and Cadmium Tolerance Mechanisms in Fission Yeast
Guo, G3 (Bethesda, Md.) 2016 - “...gim6 , pac10 Mitochondrion 39.19% (29) 14.10% (724) 1.89e05 SPAC1071.11 , SPAC1486.01 , SPAC823.10c , SPBC106.07c , SPBC336. 13 C , SPBC365.16 , SPBC3H7.03c , abc1 , atp1 , atp10 , atp11 , atp14 , atp2 , cit1 , coq11 , coq7 , eca39 , hot15...”
- A genomic Multiprocess survey of machineries that control and link cell shape, microtubule organization, and cell-cycle progression
Graml, Developmental cell 2014 - “...and mitochondria (Vps25, Vps66, Tlg2, Ryh1, SPAC823.10c, Tom7, SPAC1F3.03, Sat1, and Rrf1, SPAC823.10c, SPAC1610.02c, Cys11, SPBC106.07c, Coq5; slightly more microtubules) and tubulin folding (the Prefoldin complex subunits SPBC1D7.01, Pac10, SPAC227.10, Bob1; fewer microtubules). We next assessed whether differences in tubulin content could account for the mutants...”
- A genomewide screen in Schizosaccharomyces pombe for genes affecting the sensitivity of antifungal drugs that target ergosterol biosynthesis
Fang, Antimicrobial agents and chemotherapy 2012 - “...complex subunit 2.0 0.5 Unknown functions SPBC1861.05 SPBC106.07c NA nat2b Carbohydrate kinase N-alpha-acetylation-related protein 2.0 2.0 0.5 0.5 php3 NA tom7...”
- “...ubr11, amo1, apl3, tom7, ssr4, tom13, nat2 (SPBC106.07c), mss116 (SPBC691.04), SPBC1861.05, and SPCC1442.05c. It is interesting that tom13 deletion mutants...”
- Schizosaccharomyces pombe essential genes: a pilot study
Decottignies, Genome research 2003 - “...SPBC106.03 SPBC106.04 SPBC106.05c SPBC106.06 SPBC106.07c SPBC106.08c SPBC106.09/cut4 SPBC106.10/pka1 SPBC106.11c SPBC106.12c SPBC106.13 SPBC106.14c SPBC106.15...”
PF3D7_1328400 conserved protein, unknown function from Plasmodium falciparum 3D7
Aligns to 392:486 / 500 (19.0%), covers 98.9% of PF06916, 80.0 bits
- Machine learning for artemisinin resistance in malaria treatment across in vivo-in vitro platforms
Zhang, iScience 2022 - “...0.022131747 0.056972396 Multidrug resistance protein 1 PF3D7_1372000 0.020715635 0.018587311 Plasmodium exported protein (PHISTa), unknown function PF3D7_1328400 0.020094142 0.010121155 Conserved protein, unknown function PF3D7_1349200 0.017402912 0.016821882 Glutamate--tRNA ligase, putative PF3D7_0525700 0.016087702 0.010102856 Conserved protein, unknown function PF3D7_1466400 0.013496112 0.020929573 AP2 domain transcription factor AP2-EXP PF3D7_1243000 0.01083543 0.009874289...”
- Artemisinin resistance in the malaria parasite, Plasmodium falciparum, originates from its initial transcriptional response
Zhu, Communications biology 2022 - “...these, 60S ribosomal protein gene, L35ae (PF3D7_1142600), PHISTa (PF3D7_1372000) erythrocyte membrane protein PfEMP3 (PF3D7_0219000), and PF3D7_1328400, BEM46 (PF3D7_0818600), and PF3D7_1012000 showed the strongest correlations with PC for up- and downregulated genes, respectively. Overall, both the upregulated and downregulated genes contribute to a broad but defined set...”
- Ensemble machine learning modeling for the prediction of artemisinin resistance in malaria
Ford, F1000Research 2020 - “...Overall Importance 1 PF3D7_1245300 0.292 0.118 0.000 0.410 2 PF3D7_1107700 0.020 0.274 0.000 0.294 3 PF3D7_1328400 0.154 0.123 0.000 0.277 4 PF3D7_1372000 0.172 0.095 0.000 0.267 5 PF3D7_1115600 0.083 0.179 0.000 0.262 6 PF3D7_0608100 0.000 0.000 0.243 0.243 7 PF3D7_0523000 0.154 0.087 0.000 0.241 8 PF3D7_1205300...”
NAT2_YEAST / P37293 Putative N-terminal acetyltransferase 2; Amino-terminal, alpha-amino, acetyltransferase 2; EC 2.3.1.- from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
YGR147C N alpha-acetyl-transferase, transfers acetyl group from acetyl coenzyme A to the N-terminal methionine residues of proteins from Saccharomyces cerevisiae
Aligns to 91:222 / 288 (45.8%), covers 96.6% of PF06916, 63.4 bits
- function: Maybe involved in N-terminal acetylation of proteins. N- acetylation plays a role in normal eukaryotic translation and processing, protect against proteolytic degradation and protein turnover
subunit: Heterooligomeric. - Using Gene Essentiality and Synthetic Lethality Information to Correct Yeast and CHO Cell Genome-Scale Models
Chowdhury, Metabolites 2015 - “...CoA [m] + L-2 amino 3-oxobutanoate [m] acetyl-CoA [m] + L-glycine [m] GPR: YDL040C or YGR147C or YHR013C Correctly adds NAT1, NAT2 and ARD1 as GG This adds a missing reaction and identifies the associated genes correctly as non-essential. [ 36 ] [ 37 ] GPR...”
- Genome-wide association analysis of clinical vs. nonclinical origin provides insights into Saccharomyces cerevisiae pathogenesis
Muller, Molecular ecology 2011 - “...chromosome 7 overlaps with the heat shock transcription factor Hsf1p binding site between YGR146C-A and YGR147C (see Figure 3b ). The partially overlapping SFPs 65,184, 65,185 and 65,186 ( P -values 4.04 10 8 , ORs = ) are located within YHR102W ( KIC1 ) on...”
- Schizosaccharomyces pombe essential genes: a pilot study
Decottignies, Genome research 2003 - “...YGL022w/STT3 YKL086w YML035c/AMD1 YDL143w/CCT4 YGR147c YNL172w/APC1 YPL203w/TPK2 YIL097w YGR245c/SDA1 YPL117c/IDI1 YOL038w/PRE6 YNL277w/MET2 YOL127w/RPL25...”
- “...deletion cassette. duplicated in S. cerevisiae. Similarly, the YGR147c, EXO70, and YMR093w ORFs of S. cerevisiae, which do not have essential homologs in...”
- Identification and specificities of N-terminal acetyltransferases from Saccharomyces cerevisiae
Polevoda, The EMBO journal 1999 - “...ARD1 MAK3 NAT3 NAT2 VIP1 YDL040C YHR013C YPR051W YPR131C YGR147C YLR410W Mullen et al. (1989) Mullen et al. (1989) Tercero et al. (1993) this study Kulkarni and...”
NAT2 / AAA34812.1 N-acetyltransferase from Saccharomyces cerevisiae (see paper)
Aligns to 91:222 / 288 (45.8%), covers 96.6% of PF06916, 63.0 bits
Or search for genetic data about PF06916 in the Fitness Browser
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory