Family Search for PF08551 (DUF1751)
PF08551 hits 20 sequences in PaperBLAST's database above the trusted cutoff. Showing all hits. Or show only hits to curated sequences or try another family.
NP_609033 uncharacterized protein, isoform A from Drosophila melanogaster
Aligns to 54:157 / 450 (23.1%), covers 100.0% of PF08551, 111.1 bits
TM115_YEAST / Q12239 Transmembrane protein 115 homolog from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
YOL107W Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm and colocalizes in a punctate pattern with the early golgi/COPI vesicles; YOL107W is not an essential protein (RefSeq) from Saccharomyces cerevisiae
Aligns to 72:170 / 342 (28.9%), covers 100.0% of PF08551, 108.3 bits
- function: May play a role in retrograde transport of proteins from the Golgi to the endoplasmic reticulum.
subunit: Homooligomer. - A functional genomic screen in Saccharomyces cerevisiae reveals divergent mechanisms of resistance to different alkylphosphocholine chemotherapeutic agents.
Garcia, G3 (Bethesda, Md.) 2021 - “...activating Dnf2p YNR049C MSO1 No Lipid-interacting protein in SNARE assembly YOL018C TLG2 Yes Syntaxin-like t-SNARE YOL107W No Putative protein of unknown function YOR311C DGK1 No Diacylglycerol kinase YPL001W HAT1 No Hat1p-Hat2p histone acetyltransferase complex YPL028W ERG10 No Acetyl-CoA C-acetyltransferase YPR089W No Protein of unknown function YPR117W...”
- Widespread Cumulative Influence of Small Effect Size Mutations on Yeast Quantitative Traits
Hua, Cell systems 2018 - “...YBR287W, YEL040W, YNL125C, YHL003C, YBR283C, YDL121C, YHR045W, YNR075W, YOR377W, YHR039C, YGL010W, YCL025C, YNR044W, YLR050C, YOL137W, YOL107W, YDL018C, YDR307W, YDR297W, YNL190W, YDR503C, YBR177C, YGR266W, YER019C-A, YLR034C, YOR322C, YGR260W, YDR349C, YJR015W, YPL246C, YMR058W, YBR290W, YLL023C, YDR205W, YHR123W, YJL024C, YJL212C, YLR292C, YPL207W, YKR027W, YIL076W, YBR288C, YJL183W, YKL008C, YJL207C, YML067C,...”
- Global changes in gene expression associated with phenotypic switching of wild yeast
Šťovíček, BMC genomics 2014 - “...CTS1 , FLO9, PFS1, PSA1, ZPS1 Secretory transport & processing BST1, LST7, PER1, CWH41, MNN9, YOL107W, APM4, GVP36, YIP4 BTN2, NCE102, GYP7 , KTR4, PEP12, SNC2, TIM17, TIM21 Metabolism JLP1, MLS1, SNZ1, SNZ2, TPI1 YMR226C, BNA1, ENO1, HPT1, MDH2, RHR2, SOL4 DSF1, PIG2, STR3 , CRS5,...”
- The Hsp90-dependent proteome is conserved and enriched for hub proteins with high levels of protein-protein connectivity
Gopinath, Genome biology and evolution 2014 - “...SNO3, SNZ3, YBLO29W, YDR018C Hap1 CTY1, OLE1, PET10, RIP1 Ino4 CHO1, IAH1, ITR1, SPL2, YIRO42C, YOL107W Leu3 CDA1, GDH1, ILV3 Met4 CWP1, MET2, MET3, MET6, MET8, MET14, MUP1, PCL5, SPL2, YGP1, ZWF1, YHRO33W Oaf1 ARG80, CTA1, CUP9, GLC3, YDR344C Rds2 ATP2, ISF1, PTR2, TIP1, UTH1, ZEO1...”
- Genome-wide screen for inositol auxotrophy in Saccharomyces cerevisiae implicates lipid metabolism in stress response signaling
Villa-García, Molecular genetics and genomics : MGG 2011 - “...study YML071C COG8 W W W This study YOR216C RUD3 VW W W This study YOL107W YOL107 W + + S This study D6. Proteins involved in late secretory trafficking YIL044C AGE2 + + S This study YDL192W ARF1 + W S This study YCR094W CDC50...”
- Analysis of gene order conservation in eukaryotes identifies transcriptionally and functionally linked genes
Dávila, PloS one 2010 - “...protein 30 Fp Ft 10 10 0.40 0.00 Protein pdh1 precursor - Uncharacterized membrane protein YOL107W Uncharacterized WD repeat-containing protein C1235.09 Fp Ft 12 12 0.39 0.53 * Elongation of fatty acids protein 2 Cytochrome c oxidase polypeptide VI, mitochondrial precursor Fp Ft 13 13 0.39...”
- Genomic analysis of PIS1 gene expression
Gardocki, Eukaryotic cell 2005 - “...RPS25A VTA1 YBR053C YDL119C YDL129W YDL173W YGL165C YJL178C YNR025C YOL107W YPR123C ACE2 CIK1 CPS1 DFG10 EAP1 GSH1 LSB3 MUD1 NHX1 PEX7 PHO2 PTC1 RPB4 SIN3 SIT4...”
- Characteristic genome rearrangements in experimental evolution of Saccharomyces cerevisiae
Dunham, Proceedings of the National Academy of Sciences of the United States of America 2002 - “...YDR327W 1.076 FUN34 0.574 YNL018C 0.8425 YOR012W 0.974 YOL107W 0.4175 GCD6 3.38 YOR193W 0.796 MPD1 1.811 YNR004W 0.388 SKP1 1.223 RPC34 0.777 YNL019C 0.595...”
- More
AT3G07950 rhomboid protein-related (RefSeq) from Arabidopsis thaliana
Aligns to 44:142 / 304 (32.6%), covers 100.0% of PF08551, 106.8 bits
- Systems genomics approaches provide new insights into Arabidopsis thaliana root growth regulation under combinatorial mineral nutrient limitation
Bouain, PLoS genetics 2019 - “...genes, while no knock-out line was available for 9 genes (AT1G04480: AT1G27470; AT1G76600 AT2G37600; AT3G06650; AT3G07950; AT3G52990; AT4G34650; AT5G54580). We assessed the primary root length of seedlings six days after germination. No significant difference was observed among the genotypes when grown on Ct, with the exception...”
- Mining and visualization of microarray and metabolomic data reveal extensive cell wall remodeling during winter hardening in Sitka spruce (Picea sitchensis)
Grene, Frontiers in plant science 2012 - “...AT2G34310 No match No match Unknown protein AT2G43160 No match Plasma membrane ENTH/VHS family protein AT3G07950 No match Endomembrane system Rhomboid protein-related Golgi response to salt AT3G52120 mRNA processing Nucleus, cytoplasm SWAP (Suppressor-of-White-APricot)/ Splicing factor AT4G22330 Ceramide metabolic process Endoplasmic reticulum membrane ATCES1; catalytic/Hydrolase, acting on...”
- Cross genome comparisons of serine proteases in Arabidopsis and rice
Tripathi, BMC genomics 2006 - “...the second largest cluster supported by significant bootstrap values and consists of five sequences (At2g39060, At3g07950, LOC_Os03g24390, LOC_Os04g01300 and LOC_Os07g46170). Arabidopsis genome encodes for four gene products (see below in bold) that were earlier identified as members of the PARL subfamily, the other major subfamily of...”
B4FAA8 Rhomboid-like protein 19 from Zea mays
Aligns to 67:165 / 319 (31.0%), covers 100.0% of PF08551, 105.7 bits
- Quantitative analysis of changes in the phosphoproteome of maize induced by the plant hormone salicylic acid
Wu, Scientific reports 2015 - “...Probable cellulose synthase a catalytic subunit 2 T(1): 97.6; S(6): 100.0 28.36 0.62 1.63E-02 LAADNAGDTEASPR B4FAA8 100192037 Transmembrane protein 115 S(12): 100.0 86.02 0.77 7.80E-02 0.67 1.01E-03 0.69 6.11E-06 VVSTQAPVQLGSLR B4FBC2 100192102 Tpa: gdp-mannose -epimerase 1 S(12): 100.0 41.32 0.57 1.57E-02 0.88 8.34E-02 0.92 4.34E-01 NLQGHLGHGSE...”
- Phosphoproteomic analysis of the response of maize leaves to drought, heat and their combination stress.
Hu, Frontiers in plant science 2015 - “...K7VBA5; K7W2Z7; K7WC16; Q41729; Q9ATN2 11.33 31 132 55507 1013205 4.29 2 xxxxxxxxxx SP xxxxxxxxx B4FAA8; B4FAB7; B4G272; B6SJ48; B6SRZ6; B6SZ69; B6TB14; B6TDN3; B6TH05; B6U8S7; B6UBN4; B7ZYS1; B8A0K2; C0HE50; C0PCR0; C0PHB9; C0PLM8; C4J1A8; C4J9U8; K7UKJ5; K7V0H0; K7V4D9; K7WBH2; Q8W149; Q9LLI8 9.46 25 101 50073 957698 4.54...”
- “...K7VBI0; K7VBA5; Q41729; Q9ATN2 13.40 34 134 55507 1013205 463 2 xxxxxxxxxx SP xxxxxxxxx BF4F976; B4FAA8; B4FAB7; B6SRZ6; B6TDN3; B6TG30; B6TH05; B6UBN4; B7ZYS1; B8A0K2; C0PHB9; C0PLM8; C4J1A8; K7UKJ5; K7V1I2; K7V0H0; K7V4D9; K7WBH2; Q41735; Q8W149; Q9LLI8 11.13 26 100 50073 957698 4.97 3 xxxxxxxx A x S...”
Q9WUH1 Transmembrane protein 115 from Mus musculus
NP_062678 transmembrane protein 115 from Mus musculus
Aligns to 49:151 / 350 (29.4%), covers 100.0% of PF08551, 102.5 bits
TM115_HUMAN / Q12893 Transmembrane protein 115; Placental protein 6; Protein PL6 from Homo sapiens (Human) (see 3 papers)
NP_008955 transmembrane protein 115 from Homo sapiens
Aligns to 49:151 / 351 (29.3%), covers 100.0% of PF08551, 101.7 bits
- function: May play a role in retrograde transport of proteins from the Golgi to the endoplasmic reticulum. May indirectly play a role in protein glycosylation in the Golgi.
subunit: Homooligomer (PubMed:24806965). Interacts with COPB1 (PubMed:24806965). May interact with LMAN1 (PubMed:24806965). Interacts with the COG complex; probably through COG3 (PubMed:24806965). - TMEM115 is an integral membrane protein of the Golgi complex involved in retrograde transport.
Ong, Journal of cell science 2014 - GeneRIF: Results establish that TMEM115 is an integral membrane protein of the Golgi stack regulating Golgi-to-ER retrograde transport and is likely to be part of the machinery of the COG complex.
Q1D006 Rhomboid family intramembrane serine protease from Myxococcus xanthus (strain DK1622)
Aligns to 52:152 / 242 (41.7%), covers 68.7% of PF08551, 31.9 bits
- Comparative genomics of transport proteins in developmental bacteria: Myxococcus xanthus and Streptomyces coelicolor
Getsin, BMC microbiology 2013 - “...ABC Superfamily 3.A.1.145.1 Q1D520 1200 13 ABC Superfamily 9.B.139.2.1 Q1CXZ2 211 3 SdpC Family 9.B.104.6.1 Q1D006 242 7 Rhomboid Family Proteins were retrieved with GBLAST e-values between 0.1 and 0.001, individually verified and assigned TC numbers as indicated. A single protein (Q1D5P4; 432 aas; 14 TMSs)...”
- “...of the Cannabalism Toxin SdpC (SdpC) Family and was assigned TC# 9.B.139.2.1. The second protein (Q1D006; 242 aas; 7 TMSs) was assigned TC# 9.B.104.6.1. It belongs to the Rhomboid Protease Family and shows sequence similarity to members of the MFS; this result provides preliminary evidence that...”
Q46G03 Rhomboid protein from Methanosarcina barkeri (strain Fusaro / DSM 804)
Aligns to 43:135 / 207 (44.9%), covers 63.6% of PF08551, 31.7 bits
SPD_1920 peptidase, S54 (rhomboid) family protein (NCBI) from Streptococcus pneumoniae D39
SPN23F_21180 rhomboid family membrane protein (RefSeq) from Streptococcus pneumoniae ATCC 700669
Aligns to 49:143 / 225 (42.2%), covers 60.6% of PF08551, 28.8 bits
- Streptococcus pneumoniae serine protease HtrA, but not SFP or PrtA, is a major virulence factor in pneumonia
de, PloS one 2013 - “...performed by examining membership of GO category 0008236, resulting in the identification of SPD_1765 and SPD_1920. Blast analysis of the proteome of S. pneumoniae D39 with HtrA, SFP and PrtA with an E-value cut-off of 0.1 showed limited protein sequence similarity of SFP with PrtA, but...”
- “...additional putative serine proteases were identified by their membership of GO category 0008236 (SPD_1765 and SPD_1920), but they were excluded from further analysis because they did not contain a signal sequence or a cell surface exposed serine protease domain. BLAST analysis of the D39 proteome with...”
- Within-host microevolution of Streptococcus pneumoniae is rapid and adaptive during natural colonisation
Chaguza, Nature communications 2020 - “...blpL, blpH, blpZ and blpR ), immunity ( pncG ) and hypothetical proteins (SPN23F_18220, SPN23F_18240, SPN23F_21180 and SPN23F_04920) had the highest density of SNPs (Fig. 8a and Supplementary Data 8 ). We then used the ratio of the normalised number of non-synonymous to synonymous SNPs (d...”
C9ZUV6 Rhomboid-like protein, putative from Trypanosoma brucei gambiense (strain MHOM/CI/86/DAL972)
Aligns to 36:133 / 312 (31.4%), covers 74.7% of PF08551, 28.3 bits
- Immunoinformatic design of a putative multi-epitope vaccine candidate against Trypanosoma brucei gambiense
Danazumi, Computational and structural biotechnology journal 2022 - “...C9ZXR1 MVSMGTEIAEEDIEN MVSMGTEIAEEDIEN C9ZRE0 KRFSFVLPQPLRKSPIDV KRFSFVLPQPLRKSP D0A7R4 SMGTGSGNTIEQYFRDHNMEYTQE GNTIEQYFRDHNMEY C9ZMP2 QNFQTCFYPDGDTFLVGDRGIRLSGG GDTFLVGDRGIRLSG D0A939 LFPSLAALANVGSVSAASAEAQGPGMDGGT ANVGSVSAASAEAQG C9ZUV6 GAAAGALLPGSTEDEAQRRR GAAAGALLPGSTEDE C9ZJU1 QSSPRAATASPSTCVWQCRQDYLQ QSSPRAATASPSTCV C9ZN41 RSYLSANPGVTVFMARITSTTTTWMGG TVFMARITSTTTTWM C9ZUC9 SDRLRRDPACATNNDGAAAGPTSSAGGGELQ NDGAAAGPTSSAGGG D0AAR0 HETHGRGGTEAQTVGGGAGFPMRSTPSG D0A513 YLSHPFLGVPMKDEEK YLSHPFLGV C9ZN46 VAVLDDNATLVGRLPN VLDDNATLV QTVGGGAGFPMRSTP 3.4 Protein structure prediction confirms the surface exposure of selected...”
NCU03459 UBA domain-containing protein Ucp14 from Neurospora crassa OR74A
Aligns to 38:133 / 275 (34.9%), covers 62.6% of PF08551, 27.7 bits
- Deciphering the Regulatory Network between the SREBP Pathway and Protein Secretion in Neurospora crassa.
Qin, mBio 2017 - “...in the Golgi apparatus E3 ligase complex were named tul-1 (here dsc-1 ; NCU03740), dsc-2 (NCU03459), dsc-3 (NCU11245), dsc-4 (NCU02676), dsc-5 (NCU01928), and dsc-6 (NCU00018). The homolog of the peptide peptidase SppA was named spp-1 (NCU00568) and the homolog of the rhomboid protease Rbd-2/RbdB was named...”
- Deletion of homologs of the SREBP pathway results in hyper-production of cellulases in Neurospora crassa and Trichoderma reesei
Reilly, Biotechnology for biofuels 2015 - “...NCU01291 D 2.5 Hypothetical protein Asco None NCU02336 D 1.9 Capsule associated protein Asco None NCU03459 D 2.9 UBA domain - containing protein Ucp14 Asco, Basidio DSC2 (4.7e17) d NCU03740 D 4.2 Hypothetical protein Asco TUL1 (1.6e28) NCU06650 D 2.3 Secretory phospholipase A2 Asco, Gram +...”
- “...four mutants: two showing consistently increased protein secretion and cellulase activity from the hyper-production mutants (NCU03459 and NCU3740) and two that showed consistently decreased protein secretion and cellulase activity relative to the other hypo-production mutants (NCU00600 and NCU05213) (Table 1 ; italics). The targeted proteins in...”
alr3774 hypothetical protein (NCBI ptt file) from Nostoc sp. PCC 7120
Aligns to 65:155 / 231 (39.4%), covers 59.6% of PF08551, 26.5 bits
ID870_07305 rhomboid family intramembrane serine protease from Streptococcus agalactiae CJB111
Aligns to 50:143 / 225 (41.8%), covers 73.7% of PF08551, 26.1 bits
Nmag_1128 Rhomboid family protein (RefSeq) from Natrialba magadii ATCC 43099
Aligns to 123:195 / 319 (22.9%), covers 62.6% of PF08551, 25.6 bits
- A rhomboid protease gene deletion affects a novel oligosaccharide N-linked to the S-layer glycoprotein of Haloferax volcanii
Parente, The Journal of biological chemistry 2014 - “...haloarchaea examined (Hvo_0727, Hlac_0599, VNG_0361, HQ1233A, rrnAC0675, Nmag_1128, 11308 JOURNAL OF BIOLOGICAL CHEMISTRY and NP1156A). The H. volcanii Hvo_0727...”
- A comparative genomics perspective on the genetic content of the alkaliphilic haloarchaeon Natrialba magadii ATCC 43099T
Siddaramappa, BMC genomics 2012 - “...that cleave transmembrane domains (S2P type peptidases, Nmag_1508, 1514, 2136, and 3494), and rhomboids (Rho, Nmag_1128, 1636, 2518, and 3579). Furthermore, Nab. magadii contained genes encoding type I signal peptidases (sec11-type, Nmag_1326, 1932, 1944, 3375, 3743, and 4175) and a type IV prepilin peptidase (Nmag_1752). The...”
D4GT94 rhomboid protease (EC 3.4.21.105) from Haloferax volcanii (see paper)
HVO_0727 rhomboid-like intramembrane serine protease, N-terminal Zn finger (RefSeq) from Haloferax volcanii DS2
Aligns to 117:214 / 296 (33.1%), covers 84.8% of PF08551, 25.2 bits
- Proteolysis at the Archaeal Membrane: Advances on the Biological Function and Natural Targets of Membrane-Localized Proteases in Haloferax volcanii
De, Frontiers in microbiology 2022 - “...rhomboids in prokaryotes is scarcely known, include control of quorum sensing, and membrane proteostasis RhoII HVO_0727 D4GT94 Intramembrane (I-CliP) SLG N-Glycosylation; cell adhesion; motility/putative substrates PibD, Agl15 Stevenson et al., 2007 ; Parente et al., 2014 ; Began et al., 2020 ; Costa et al., 2020...”
- “...Parente et al., 2014 ). Haloferax volcanii encodes two rhomboid homologs, RhoI (HVO_1474) and RhoII (HVO_0727) ( Table 1 ). KO mutants in the gene encoding rhoII have been constructed and characterized phenotypically and at the proteome level. Haloferax volcanii cells with a deletion in rhoII...”
- A rhomboid protease gene deletion affects a novel oligosaccharide N-linked to the S-layer glycoprotein of Haloferax volcanii
Parente, The Journal of biological chemistry 2014 - “...pHV2 origin. pTA963 with region 207 bp upstream of Hvo_0727 start codon and 103 bp downstream of Hvo_0726 stop codon, cloned between the ApaI and BamHI sites....”
- “...occurs in all of the haloarchaea examined (Hvo_0727, Hlac_0599, VNG_0361, HQ1233A, rrnAC0675, Nmag_1128, 11308 JOURNAL OF BIOLOGICAL CHEMISTRY and NP1156A). The...”
- Proteolysis at the Archaeal Membrane: Advances on the Biological Function and Natural Targets of Membrane-Localized Proteases in Haloferax volcanii
De, Frontiers in microbiology 2022 - “...in prokaryotes is scarcely known, include control of quorum sensing, and membrane proteostasis RhoII HVO_0727 D4GT94 Intramembrane (I-CliP) SLG N-Glycosylation; cell adhesion; motility/putative substrates PibD, Agl15 Stevenson et al., 2007 ; Parente et al., 2014 ; Began et al., 2020 ; Costa et al., 2020 ;...”
- Proteolytic systems of archaea: slicing, dicing, and mincing in the extreme
Maupin-Furlow, Emerging topics in life sciences 2018 - “...(A3CWV0) [ 127 , 138 , 139 ] Rhomboid [S54, -] I-CliP - Hv RhoII (D4GT94) [ 142 , 143 ], Hv RhoI (D4GYA9) Site-2-protease (S2P) [M50, EC:3.4.24.-] I-CliP 3b4r, 2hga, 5g5x, 5g5r Mj S2P (Q57837) [ 148 ]; Mta S2P (O27421) [unpublished]; Af S2P (O29915)...”
AKL23_RS08625 rhomboid family intramembrane serine protease from Streptococcus thermophilus
Aligns to 48:142 / 224 (42.4%), covers 69.7% of PF08551, 24.4 bits
- Technological and Genomic Analysis of Roles of the Cell-Envelope Protease PrtS in Yoghurt Starter Development.
Tian, International journal of molecular sciences 2018 - “...KLDS3.1012. Encoded Proteins Genes of Strains KLDS SM KLDS3.1012 Rhomboid family intramembrane serine protease A9497_05030 AKL23_RS08625 Membrane-bound protease2C CAAX family A9497_04220 A9497_05120 A9497_05125 A9497_05130 A9497_05135 A9497_09495 AKL23_RS07830 AKL23_RS08710 AKL23_RS08715 AKL23_RS08720 AKL23_RS08725 AKL23_RS10450 Serine protease A9497_00565 AKL23_RS04060 C3-degrading protease A9497_04215 AKL23_RS07825 CPBP family intramembrane metalloprotease A9497_09585 AKL23_RS03380...”
stu1836 Conserved hypothetical, predicted membrane protein (TMS6) (NCBI) from Streptococcus thermophilus LMG 18311
Aligns to 49:143 / 224 (42.4%), covers 68.7% of PF08551, 23.7 bits
A9497_05030 rhomboid family intramembrane serine protease from Streptococcus thermophilus
Aligns to 50:142 / 224 (41.5%), covers 68.7% of PF08551, 23.5 bits
- Technological and Genomic Analysis of Roles of the Cell-Envelope Protease PrtS in Yoghurt Starter Development.
Tian, International journal of molecular sciences 2018 - “...and KLDS3.1012. Encoded Proteins Genes of Strains KLDS SM KLDS3.1012 Rhomboid family intramembrane serine protease A9497_05030 AKL23_RS08625 Membrane-bound protease2C CAAX family A9497_04220 A9497_05120 A9497_05125 A9497_05130 A9497_05135 A9497_09495 AKL23_RS07830 AKL23_RS08710 AKL23_RS08715 AKL23_RS08720 AKL23_RS08725 AKL23_RS10450 Serine protease A9497_00565 AKL23_RS04060 C3-degrading protease A9497_04215 AKL23_RS07825 CPBP family intramembrane metalloprotease A9497_09585...”
CCC13826_1263 peptidase E (RefSeq) from Campylobacter concisus 13826
Aligns to 38:134 / 191 (50.8%), covers 88.9% of PF08551, 22.9 bits
CPE1452 conserved hypothetical protein (NCBI ptt file) from Clostridium perfringens str. 13
Aligns to 194:269 / 342 (22.2%), covers 57.6% of PF08551, 22.1 bits
Or search for genetic data about PF08551 in the Fitness Browser
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory