Family Search for PF08924 (Rv2525c_GlyHyd-like)

PF08924 hits 14 sequences in PaperBLAST's database above the trusted cutoff. Showing all hits. Or show only hits to curated sequences or try another family.

FADG_BACSU / O34320 Uncharacterized protein FadG from Bacillus subtilis (strain 168) (see paper)
Aligns to 303:489 / 576 (32.5%), covers 99.0% of PF08924, 180.7 bits

cgR_0949 hypothetical protein from Corynebacterium glutamicum R
CgS9114_13715 DUF1906 domain-containing protein from Corynebacterium glutamicum S9114
Aligns to 49:230 / 280 (65.0%), covers 99.5% of PF08924, 175.0 bits

• Cellulosic hydrocarbons production by engineering dual synthesis pathways in Corynebacterium glutamicum
  Xu, Biotechnology for biofuels and bioproducts 2022
  • “...ado-rbs-aar , and pH36- ado- TacM -aar . The signal peptide sequences of Ncgl1289 and cgR_0949 were amplified from C. glutamicum ATCC 13032 and C. glutamicum S9114. Then the signal peptide sequences of Ncgl1289 and the fragment of oleT JE gene were overlapped together and inserted...”
• Corynebacterium glutamicum possesses β-N-acetylglucosaminidase
  Matano, BMC microbiology 2016 (no snippet)
• Construction of a novel twin-arginine translocation (Tat)-dependent type expression vector for secretory production of heterologous proteins in Corynebacterium glutamicum
  Zhang, Plasmid 2015 (PubMed)
  • “...RBS sequence for protein translation, and the strong cgR_0949 signal sequence for protein secretion via the Tat pathway in C. glutamicum. The applicability of...”
  • “...Tat-type signal peptides from <ce:italic>C. glutamicum</ce:italic>, CgR_0949 is the strongest signal sequence that mediates protein secretion (<ce:cross-refs...”
• Influence of SigB inactivation on Corynebacterium glutamicum protein secretion
  Watanabe, Applied microbiology and biotechnology 2013 (PubMed)
  • “...Utilizing a signal peptide derived from C. glutamicum R CgR_0949, a sigB disruption mutant able to secrete 3- to 5-fold more green fluorescence protein (GFP)...”
  • “...GFP productivity reported in C. glutamicum to date. CgR_0949 signal sequence length (30 residues), type (Tat) or the target protein identity (GFP or -amylase)...”
• Proteome analysis guided genetic engineering of Corynebacterium glutamicum S9114 for tween 40-triggered improvement in L-ornithine production
  Jiang, Microbial cell factories 2020
  • “...Putative esterase 3.378 3.5667E05 Down 33.531 UPI0002231962 CgS9114_04952 Putative esterase 3.401 2.0229E08 Down 39.62 UPI000133536B CgS9114_13715 Putative secreted protein 3.413 2.1044E08 Down 29.955 UPI000133510C CgS9114_14352 Hypothetical protein 3.521 0.00018473 Down 24.492 UPI0001335576 CgS9114_00220 Ferredoxin-NADP+ reductase 3.597 5.1049E07 Down 50.056 UPI000223193A CgS9114_01878 protein prenyltransferase 3.774 6.0916E07 Down...”

cg0955 hypothetical protein from Corynebacterium glutamicum ATCC 13032
Aligns to 49:230 / 280 (65.0%), covers 99.5% of PF08924, 174.0 bits

• The Iron Deficiency Response of Corynebacterium glutamicum and a Link to Thiamine Biosynthesis
  Küberl, Applied and environmental microbiology 2020 (secret)
• Corynebacterium glutamicum possesses β-N-acetylglucosaminidase
  Matano, BMC microbiology 2016 (no snippet)
• The DtxR protein acting as dual transcriptional regulator directs a global regulatory network involved in iron metabolism of Corynebacterium glutamicum
  Brune, BMC genomics 2006
  • “...28 n.d. +1010 cg0470 - TTAGGTTAAGCTAATCTAG 32 n.d. +978 cg0591 - TTAGTAAAGGCTCACCTAA 91 n.d. +310 cg0955 - TTACGTGAGCGTAGCCGAA 200 n.d. +2.8 cg1642 - TTAGGTTAGGCAAGCCATA 39 n.d. +4.4 cg3247 cgtR11 ATCAGTAAGGCTAGACTAA 87 n.d. +5.5 cg3394 - TTAAGGTAAGTTCAGCTAA 37 n.d. +4.6 cg1070 - ATAGGTTATCCAAGCCTAA 18 n.d. n.d. cg1088...”
  • “...CE0881 TTAGGTACCCTAACCTCAC CE08820884 iron ABC transport system cg0926 , JK1887 CE0912 GTAGGTTACGCGAACGTAG - hypothetical protein cg0955 CE1009 TTAGGCATCCCTTGCCTCG CE1010 hypothetical proteins DIP0894 CE1346 AGAGTGTAGGCTTACCTAT - hypothetical protein cg1405 CE1860 TTAGGTTATAGTTTCCTTT CE1859 hypothetical proteins - CE1917 GTGGGTGAGGCAAGCCTAA - phage integrase/recombinase - CE1940 TGAAGTAACACTACCCTAA - cation transporting P-type...”

CE0912 conserved hypothetical protein from Corynebacterium efficiens YS-314
Aligns to 61:242 / 292 (62.3%), covers 99.5% of PF08924, 168.1 bits

• The DtxR protein acting as dual transcriptional regulator directs a global regulatory network involved in iron metabolism of Corynebacterium glutamicum
  Brune, BMC genomics 2006
  • “...iron ABC transport system cg0771 CE0881 TTAGGTACCCTAACCTCAC CE08820884 iron ABC transport system cg0926 , JK1887 CE0912 GTAGGTTACGCGAACGTAG - hypothetical protein cg0955 CE1009 TTAGGCATCCCTTGCCTCG CE1010 hypothetical proteins DIP0894 CE1346 AGAGTGTAGGCTTACCTAT - hypothetical protein cg1405 CE1860 TTAGGTTATAGTTTCCTTT CE1859 hypothetical proteins - CE1917 GTGGGTGAGGCAAGCCTAA - phage integrase/recombinase - CE1940...”

MAP2334c hypothetical protein from Mycobacterium avium subsp. paratuberculosis str. k10
Aligns to 52:231 / 240 (75.0%), covers 99.0% of PF08924, 165.3 bits

• Inactivation of Rv2525c, a substrate of the twin arginine translocation (Tat) system of Mycobacterium tuberculosis, increases beta-lactam susceptibility and virulence
  Saint-Joanis, Journal of bacteriology 2006
  • “...Rv2525c; M. tuberculosis; ML1190, M. leprae; MAP2334c, Mycobacterium avium subsp. paratuberculosis; nfa47650, Nocardia farcinica. Stars denote identical...”

LYS25_MYCTU / I6XEI5 Putative peptidoglycan hydrolase Rv2525c; EC 3.2.1.17 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
JTY_RS13125 DUF1906 domain-containing protein from Mycobacterium tuberculosis variant bovis BCG str. Tokyo 172
NP_217041 hypothetical protein from Mycobacterium tuberculosis H37Rv
Rv2525c hypothetical protein from Mycobacterium tuberculosis H37Rv
Aligns to 52:231 / 240 (75.0%), covers 99.0% of PF08924, 163.9 bits

• function: May function as a peptidoglycan hydrolase with glycosidase activity (PubMed:25260828). In vitro, displays esterase activity toward p-nitrophenyl esters of various acyl chain length (C4 to C16), with a preference for p-nitrophenyl butyrate (C4) (PubMed:25869294).
  catalytic activity: Hydrolysis of (1->4)-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins.
  disruption phenotype: Cells lacking this gene display an increase in susceptibility to some beta-lactam antibiotics and, despite slower growth in vitro, enhanced virulence in both cellular and murine models of tuberculosis. No detectable difference in the lipid profiles.
• The prominent alteration in transcriptome and metabolome of Mycobacterium bovis BCG str. Tokyo 172 induced by vitamin B₁
  Song, BMC microbiology 2019
  • “...to those genes, JTY_RS12370 ( Rv2390c ), JTY_RS00960 ( Rv0179c ), JTY_RS08085 ( Rv1535 ), JTY_RS13125 ( Rv2525c ) and JTY_RS09350 ( Rv1799 ) were upregulated more than 2-fold (Additional file 2 : Table S2). Universal stress protein There are 10 universal stress proteins (ups) in...”
• Expression, Purification and Characterisation of Secreted Esterase Rv2525c from Mycobacterium tuberculosis.
  Dang, Applied biochemistry and biotechnology 2015 (PubMed)
  • GeneRIF: Expression, Purification and Characterisation of Secreted Esterase Rv2525c from Mycobacterium tuberculosis.
• Inactivation of Rv2525c, a substrate of the twin arginine translocation (Tat) system of Mycobacterium tuberculosis, increases beta-lactam susceptibility and virulence.
  Saint-Joanis, Journal of bacteriology 2006
  • GeneRIF: Upon exposure to antituberculous drugs, rv2525c expression is significantly up-regulated together with those of other genes involved in cell wall biogenesis
• Mycobacterium tuberculosis Gene Expression Associated With Fluoroquinolone Resistance and Efflux Pump Inhibition
  van, The Journal of infectious diseases 2023
  • “....002 -1.33 .45 Rv1819c -1.85 .004 -1.49 .13 eQTL Analysis Rv2525c -1.82 .004 -1.20 .84 Rv3500c -1.86 .01 -1.65 .03 Rv1522c -1.76 .01 -1.39 .28 Rv0191 +1.64 .01...”
• MtrA modulates Mycobacterium tuberculosis cell division in host microenvironments to mediate intrinsic resistance and drug tolerance
  Peterson, Cell reports 2023
  • “...encode proteins with PG hydrolase activity: ami1 , ripA , ripB , ripD , and Rv2525c . PG hydrolases are present in multiple variant forms in all bacteria, where their activities are harnessed to support cell growth, division, and differentiation, enabling bacteria to propagate and adapt...”
  • “...a non-catalytic PG-binding function. 69 Finally, structural studies suggest a PG glycoside hydrolase function for Rv2525c, although its activity has not been established. 70 To assess the effect of MtrA regulation on these PG cleavage enzymes and the impact on Mtb cell division and growth, we...”
• Phosphorylation of CFP10 modulates Mycobacterium tuberculosis virulence
  Malakar, mBio 2023
  • “...the twin-arginine motif in the signal sequence ( 17 ). Four phospholipase C enzymes and Rv2525c, a conserved hypothetical protein, are known Tat substrates ( 17 , 18 ) in mycobacteria. In addition to the classical Sec and Tat secretion system, most Gram-negative bacteria are equipped...”
• Rv0500A is a transcription factor that links Mycobacterium tuberculosis environmental response with division and impacts host colonization
  Kevorkian, Molecular microbiology 2022
  • “...ripB , ripD , erp (exported repetitive protein, also known as pirG ), lcp1 , rv2525c , and rv2864c ( Figure 2c , d , Tables S4 and S5 ) ( Bellinzoni et al., 2014 ; Berthet et al., 1998 ; Bth et al., 2011 ;...”
  • “...2014 ) Structural studies suggest a peptidoglycan hydrolase function for the mycobacterium tuberculosis tat-secreted protein Rv2525c . Journal of Structural Biology , 188 , 156 164 . 25260828 Berthet FX , Lagranderie M , Gounon P , Laurent-Winter C , Ensergueix D , Chavarot P (...”
• Genome-Wide Study of Drug Resistant Mycobacterium tuberculosis and Its Intra-Host Evolution during Treatment
  Lagutkin, Microorganisms 2022
  • “...a duplication of this repetitive region. Rv1435c was shown to be a part of an Rv2525c -coregulated gene cluster, which consists of cell wall synthesis proteins and penicillin-binding proteins. It was demonstrated that this cluster is upregulated in INH- and ETH-treated MTB [ 66 ]. In...”
  • “...B. Demangel C. Jackson M. Brodin P. Marsollier L. Boshoff H. Cole S.T. Inactivation of Rv2525c, a substrate of the twin arginine translocation (Tat) system of Mycobacterium tuberculosis , increases -Lactam susceptibility and virulence J. Bacteriol. 2006 188 6669 6679 10.1128/JB.00631-06 16952959 67. Chen J. Zhang...”
• Computational identification of significant immunogenic epitopes of the putative outer membrane proteins from Mycobacterium tuberculosis
  Sundar, Journal, genetic engineering & biotechnology 2021
  • “...membrane proteins of Mtb. Among these, certain immunodominant epitopes of Rv0172, Rv0295c, Rv1006, Rv2264c, and Rv2525c were found, which are capable of binding B-cell and a maximum number of MHC alleles. The selected immunodominant epitopes were screened for their allergenic and antigenic properties, their percentage identity...”
  • “...27 0.7743 1.00823 52.17% 16 Rv2307c 115 135 GYGGNPGRPSEQGLAADARAA 12 2 0.9422 0.7492 64.71% 17 Rv2525c a 102 153 YGKGSTADWLGGASAGVQHARRGSELHAAAGGPTSAPIYASIDDNPSYEQYK 27 27 0.9026 0.48836 No significant similarity found 18 Rv2672 33 72 AFGADPRFATYSGAGPQGAATTTPPPAGPPPLAAPKNDLS 21 27 0.7615 0.65308 69.23% 19 Rv2891 33 52 PAHADDSRLGWPLRPPPAVV 21 4 1.2467...”
• Structure-Aware Mycobacterium tuberculosis Functional Annotation Uncloaks Resistance, Metabolic, and Virulence Genes
  Modlin, mSystems 2021
  • “...protein Probable antitoxin VapB/antigen 28066388, 23140854 Rv2272 Transmembrane protein Probable gamma delta T-cell activator 23389928 Rv2525c Tat pathway signal sequence Probable peptidoglycan hydrolase 16952959, 25869294, 25260828 Rv2923c Hypothetical protein Probable osmotically induced bacterial protein C (OsmC, a probable peroxide reductase) 22088319 Rv3632 Membrane protein Putative flippase...”
• The prominent alteration in transcriptome and metabolome of Mycobacterium bovis BCG str. Tokyo 172 induced by vitamin B₁
  Song, BMC microbiology 2019
  • “...genes, JTY_RS12370 ( Rv2390c ), JTY_RS00960 ( Rv0179c ), JTY_RS08085 ( Rv1535 ), JTY_RS13125 ( Rv2525c ) and JTY_RS09350 ( Rv1799 ) were upregulated more than 2-fold (Additional file 2 : Table S2). Universal stress protein There are 10 universal stress proteins (ups) in M. tuberculosis...”
• More

nfa47650 hypothetical protein from Nocardia farcinica IFM 10152
Aligns to 50:229 / 238 (75.6%), covers 99.0% of PF08924, 156.3 bits

• Inactivation of Rv2525c, a substrate of the twin arginine translocation (Tat) system of Mycobacterium tuberculosis, increases beta-lactam susceptibility and virulence
  Saint-Joanis, Journal of bacteriology 2006
  • “...leprae; MAP2334c, Mycobacterium avium subsp. paratuberculosis; nfa47650, Nocardia farcinica. Stars denote identical residues; periods and colons indicate...”

DIP0793 Putative secreted protein from Corynebacterium diphtheriae NCTC 13129
Aligns to 53:235 / 302 (60.6%), covers 99.5% of PF08924, 156.2 bits

• Adherence and invasive properties of Corynebacterium diphtheriae strains correlates with the predicted membrane-associated and secreted proteome
  Sangal, BMC genomics 2015
  • “...copper-binding protein. Both of the non-lipoprotein Tat substrates contain domains of unknown function, of which DIP0793 contains a PF08924 (BacA-like) putative peptidoglycan hydrolase domain. In addition to the Sec and Tat translocase, a single type VII secretion system was identified in the C. diphtheriae core proteome,...”

ML1190 conserved hypothetical protein from Mycobacterium leprae TN
Aligns to 53:230 / 239 (74.5%), covers 99.0% of PF08924, 153.8 bits

• Inactivation of Rv2525c, a substrate of the twin arginine translocation (Tat) system of Mycobacterium tuberculosis, increases beta-lactam susceptibility and virulence
  Saint-Joanis, Journal of bacteriology 2006
  • “...of M. leprae, only one of the corresponding genes, ml1190, escaped inactivation; it is orthologous to the rv2525c gene of M. tuberculosis. The conservation of...”
  • “...C precursor NF plcA Phospholipase C precursor ml1190 Unknown ml0497 ps Similar to G755244 acid phosphatase del ugpB sn-Glycerol-3-phosphate transport del...”

BSQ49_11795 glycoside hydrolase domain-containing protein from Liquorilactobacillus hordei
Aligns to 301:490 / 634 (30.0%), covers 89.9% of PF08924, 151.8 bits

• Living the Sweet Life: How Liquorilactobacillus hordei TMW 1.1822 Changes Its Behavior in the Presence of Sucrose in Comparison to Glucose
  Bechtner, Foods (Basel, Switzerland) 2020
  • “...PTS system, fructose/mannitol specific IICBA components Carbohydrates fig|468911.3.peg.2227 BSQ49_11305 53 0.51 5.61 GH25 muramidase (putative) BSQ49_11795 foods-09-01150-t002_Table 2 Table 2 Significantly (Fishers exact p -value < 0.05) enriched gene ontologies (GO) (GO = biological processes) among differentially released proteins within exoproteomes of glucose and sucrose-treated cells....”

BO233_15685 glycoside hydrolase domain-containing protein from Enterococcus faecium
Aligns to 303:489 / 783 (23.9%), covers 98.0% of PF08924, 146.7 bits

• Molecular Characterisation of Vancomycin-Resistant Enterococcus faecium Isolates Belonging to the Lineage ST117/CT24 Causing Hospital Outbreaks
  Lisotto, Frontiers in microbiology 2021
  • “...BO233_RS12430 Chromosome C5 ST117/CT24 VRE rectal swab 12-3-2013 BO233_15550 Plasmid C6 ST117/CT24 VRE blood 7-7-2012 BO233_15685 Plasmid S1 ST117/CT24 VSE pus 14-9-2016 NA NA S2 ST117/CT24 VSE pleural fluid 9-9-2016 NA NA S3 ST117/CT24 VSE rectal swab 9-9-2016 NA NA E1 ST117/CT24 VSE blood 2010 NA...”
  • “...isolate from 2012 (C6), the transposon integrated into a peptidoglycan-binding protein gene (GenBank locus taq: BO233_15685) located on the plasmid with 260 SNPs; and (iii) the vanB transposon found in isolates C2 (2012) and C3 (2011) was located on another plasmid and integrated upstream of the...”

V5EI62 Lysin from Lactobacillus crispatus EM-LC1
Aligns to 34:227 / 301 (64.5%), covers 63.6% of PF08924, 29.1 bits

• Genetic Elements Orchestrating Lactobacillus crispatus Glycogen Metabolism in the Vagina
  Hertzberger, International journal of molecular sciences 2022
  • “...22 1.6 10 7 2.9 10 7 2.0 10 7 1.6 10 7 0.8 0.3 V5EI62 Lysin (Glycoside Hydrolase Family) 15 2.4 10 6 4.6 10 6 1.1 10 7 7.6 10 6 0.9 0.5 V5EF53 SlpA domain-containing protein 12 2.1 10 7 3.0 10 7...”

D5GXS8 Lysin from Lactobacillus crispatus (strain ST1)
Aligns to 50:284 / 385 (61.0%), covers 64.1% of PF08924, 28.5 bits

• Genetic Elements Orchestrating Lactobacillus crispatus Glycogen Metabolism in the Vagina
  Hertzberger, International journal of molecular sciences 2022
  • “...11 1.5 10 6 3.2 10 6 1.2 10 6 3.2 10 6 1.1 1.4 D5GXS8 Lysin (Glycoside Hydrolase Family) 10 2.9 10 5 3.6 10 5 4.0 10 5 9.7 10 5 0.3 1.3 D5H1Q3 Aggregation promoting factor 4 ND ND 1.5 10 5 2.2...”

LBA1140 lysin from Lactobacillus acidophilus NCFM
Q5FJZ4 Lysin from Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Aligns to 49:274 / 382 (59.2%), covers 49.0% of PF08924, 28.5 bits

• S-layer associated proteins contribute to the adhesive and immunomodulatory properties of Lactobacillus acidophilus NCFM
  Klotz, BMC microbiology 2020
  • “...COG* CELLULAR PROCESSES AND SIGNALING LBA0833 ftsW 1.06 D LBA1883 NLP-P60 secreted protein 2.00 M LBA1140 lysin 1.58 M LBA0520 galactosyltransferase 1.48 M LBA1743 cell wall-associated hydrolase 1.16 M LBA1744 glycosidase 1.13 M LBA1736 epsB 1.09 M LBA0165 pepO 1.40 O LBA1901 thioredoxin 1.38 O LBA1208...”
• Host and body site-specific adaptation of Lactobacillus crispatus genomes
  Pan, NAR genomics and bioinformatics 2020
  • “...the autolysins LBA1351 (containing a - N -acetylmuramidase), AcmB (containing a - N -acetylglucosaminidase) and LBA1140 (containing a - N -acetylmuramidase) ( Supplementary Figure S5B ). AcmB has been linked with binding capacity of L. acidophilus NCFM to a number of extracellular matrices such as mucin,...”
• Deletion of Lipoteichoic Acid Synthase Impacts Expression of Genes Encoding Cell Surface Proteins in Lactobacillus acidophilus
  Selle, Frontiers in microbiology 2017
  • “...LBA0873 Hypothetical protein 1.3 to 1.8 LBA1045 Glutamine ABC transporter ATP-binding protein 1.1 to 2.0 LBA1140 Lysin 1.2 to 1.5 LBA1184 Hypothetical protein 1.1 to 1.7 LBA1497 Hypothetical protein 1.1 to 1.3 LBA1665 oppA 2.1 to 3.4 LBA1679 ABC transporter permease 1.7 to 2.4 LBA1680 ABC...”
  • “...levels. Non-solid bars indicate LTA-deficient strains. Three of the upregulated genes corresponded to N -acetylmuramidases (LBA1140 and LBA1918) and an endopeptidase (LBA1883), which are predicted to function in peptidoglycan turnover ( Table 2 ). To survey how ltaS deletion impacted collective expression of peptidoglycan hydrolases, we...”
• AcmB Is an S-Layer-Associated β-N-Acetylglucosaminidase and Functional Autolysin in Lactobacillus acidophilus NCFM
  Johnson, Applied and environmental microbiology 2016
  • “...uncharacterized protein Q5FLC9 pfam01183 234 lysA ( lba1918 ) Lysin Q5FHV9 pfam01183 323 + + lba1140 Lysin Q5FJZ4 pfam01183 382 + + lba1351 Lysin Q5FJE6 pfam01183 404 + + N -Acetylmuramoyl- l -alanine amidase lba0177 Autolysin/amidase Q5FMJ8 pfam01510 364 + + a Catalytic domain determined by...”
• AcmB Is an S-Layer-Associated β-N-Acetylglucosaminidase and Functional Autolysin in Lactobacillus acidophilus NCFM
  Johnson, Applied and environmental microbiology 2016
  • “...Q5FLC9 pfam01183 234 lysA ( lba1918 ) Lysin Q5FHV9 pfam01183 323 + + lba1140 Lysin Q5FJZ4 pfam01183 382 + + lba1351 Lysin Q5FJE6 pfam01183 404 + + N -Acetylmuramoyl- l -alanine amidase lba0177 Autolysin/amidase Q5FMJ8 pfam01510 364 + + a Catalytic domain determined by pfam (...”

Or search for genetic data about PF08924 in the Fitness Browser