Family Search for PF08924 (DUF1906)

PF08924 hits 15 sequences in PaperBLAST's database above the trusted cutoff. Showing all hits. Or show only hits to curated sequences or try another family.

FADG_BACSU / O34320 Uncharacterized protein FadG from Bacillus subtilis (strain 168) (see paper)
Aligns to 303:489 / 576 (32.5%), covers 99.0% of PF08924, 170.0 bits

CgS9114_13715 DUF1906 domain-containing protein from Corynebacterium glutamicum S9114
cgR_0949 hypothetical protein (RefSeq) from Corynebacterium glutamicum R
Aligns to 49:230 / 280 (65.0%), covers 99.0% of PF08924, 152.9 bits

• Proteome analysis guided genetic engineering of Corynebacterium glutamicum S9114 for tween 40-triggered improvement in L-ornithine production
  Jiang, Microbial cell factories 2020
  • “...Putative esterase 3.378 3.5667E05 Down 33.531 UPI0002231962 CgS9114_04952 Putative esterase 3.401 2.0229E08 Down 39.62 UPI000133536B CgS9114_13715 Putative secreted protein 3.413 2.1044E08 Down 29.955 UPI000133510C CgS9114_14352 Hypothetical protein 3.521 0.00018473 Down 24.492 UPI0001335576 CgS9114_00220 Ferredoxin-NADP+ reductase 3.597 5.1049E07 Down 50.056 UPI000223193A CgS9114_01878 protein prenyltransferase 3.774 6.0916E07 Down...”
• Cellulosic hydrocarbons production by engineering dual synthesis pathways in Corynebacterium glutamicum
  Xu, Biotechnology for biofuels and bioproducts 2022
  • “...ado-rbs-aar , and pH36- ado- TacM -aar . The signal peptide sequences of Ncgl1289 and cgR_0949 were amplified from C. glutamicum ATCC 13032 and C. glutamicum S9114. Then the signal peptide sequences of Ncgl1289 and the fragment of oleT JE gene were overlapped together and inserted...”
• Corynebacterium glutamicum possesses β-N-acetylglucosaminidase
  Matano, BMC microbiology 2016
  • “...this work (Table 2 ): SP0955, a TAT secretion signal homologous to C. glutamicum R cgR_0949 [ 42 , 43 ]; PS2, a Sec-pathway signal peptide of C. glutamicum ATCC 14067 PS2 protein, which is missing in C. glutamicum ATCC 13032 [ 44 , 45 ];...”
• Construction of a novel twin-arginine translocation (Tat)-dependent type expression vector for secretory production of heterologous proteins in Corynebacterium glutamicum
  Zhang, Plasmid 2015 (PubMed)
  • “...RBS sequence for protein translation, and the strong cgR_0949 signal sequence for protein secretion via the Tat pathway in C. glutamicum. The applicability of...”
  • “...Tat-type signal peptides from <ce:italic>C. glutamicum</ce:italic>, CgR_0949 is the strongest signal sequence that mediates protein secretion (<ce:cross-refs...”
• Influence of SigB inactivation on Corynebacterium glutamicum protein secretion
  Watanabe, Applied microbiology and biotechnology 2013 (PubMed)
  • “...Utilizing a signal peptide derived from C. glutamicum R CgR_0949, a sigB disruption mutant able to secrete 3- to 5-fold more green fluorescence protein (GFP)...”
  • “...GFP productivity reported in C. glutamicum to date. CgR_0949 signal sequence length (30 residues), type (Tat) or the target protein identity (GFP or -amylase)...”

cg0955 hypothetical protein (RefSeq) from Corynebacterium glutamicum ATCC 13032
Aligns to 49:230 / 280 (65.0%), covers 99.0% of PF08924, 151.9 bits

• The Iron Deficiency Response of Corynebacterium glutamicum and a Link to Thiamine Biosynthesis.
  Küberl, Applied and environmental microbiology 2020 (secret)
• Corynebacterium glutamicum possesses β-N-acetylglucosaminidase
  Matano, BMC microbiology 2016
  • “...in C. glutamicum Protein ID, locus tag Annotation Signal sequence a Length (aa) Secretion pathway Cg0955, cg0955 secreted protein MQINRRGFLKATTGLATIGAASMFMPK ANA / LG 30 TAT PS2, cgR_2070 S-layer protein MGKHRRNNSNATRKAVAASAVALGATAAIASP AQA / AE 35 Sec PhoD, cg2485 alkaline Phosphatase MPQLSRRQFLQTTAVTAGLATFAGTP ARA / EE 29 TAT Cmt4,...”
  • “...amount of enzyme activity retrieved in the supernatant. Notably, fusion to the signal peptide from Cg0955 increased intracellular enzyme activity, whereas fusion to signal peptide Cmt4 led to reduced intracellular N-acetylglucosaminidase activity (Fig. 1 ). Overexpression of ChiB fused with a secretion signal peptide from C....”
• The DtxR protein acting as dual transcriptional regulator directs a global regulatory network involved in iron metabolism of Corynebacterium glutamicum
  Brune, BMC genomics 2006
  • “...28 n.d. +1010 cg0470 - TTAGGTTAAGCTAATCTAG 32 n.d. +978 cg0591 - TTAGTAAAGGCTCACCTAA 91 n.d. +310 cg0955 - TTACGTGAGCGTAGCCGAA 200 n.d. +2.8 cg1642 - TTAGGTTAGGCAAGCCATA 39 n.d. +4.4 cg3247 cgtR11 ATCAGTAAGGCTAGACTAA 87 n.d. +5.5 cg3394 - TTAAGGTAAGTTCAGCTAA 37 n.d. +4.6 cg1070 - ATAGGTTATCCAAGCCTAA 18 n.d. n.d. cg1088...”
  • “...CE0881 TTAGGTACCCTAACCTCAC CE08820884 iron ABC transport system cg0926 , JK1887 CE0912 GTAGGTTACGCGAACGTAG - hypothetical protein cg0955 CE1009 TTAGGCATCCCTTGCCTCG CE1010 hypothetical proteins DIP0894 CE1346 AGAGTGTAGGCTTACCTAT - hypothetical protein cg1405 CE1860 TTAGGTTATAGTTTCCTTT CE1859 hypothetical proteins - CE1917 GTGGGTGAGGCAAGCCTAA - phage integrase/recombinase - CE1940 TGAAGTAACACTACCCTAA - cation transporting P-type...”

BSQ49_11795 DUF1906 domain-containing protein from Liquorilactobacillus hordei
Aligns to 301:492 / 634 (30.3%), covers 88.9% of PF08924, 146.9 bits

• Living the Sweet Life: How Liquorilactobacillus hordei TMW 1.1822 Changes Its Behavior in the Presence of Sucrose in Comparison to Glucose.
  Bechtner, Foods (Basel, Switzerland) 2020
  • “...PTS system, fructose/mannitol specific IICBA components Carbohydrates fig|468911.3.peg.2227 BSQ49_11305 53 0.51 5.61 GH25 muramidase (putative) BSQ49_11795 foods-09-01150-t002_Table 2 Table 2 Significantly (Fishers exact p -value < 0.05) enriched gene ontologies (GO) (GO = biological processes) among differentially released proteins within exoproteomes of glucose and sucrose-treated cells....”

CE0912 conserved hypothetical protein (NCBI ptt file) from Corynebacterium efficiens YS-314
Aligns to 61:242 / 292 (62.3%), covers 99.0% of PF08924, 145.9 bits

• The DtxR protein acting as dual transcriptional regulator directs a global regulatory network involved in iron metabolism of Corynebacterium glutamicum
  Brune, BMC genomics 2006
  • “...iron ABC transport system cg0771 CE0881 TTAGGTACCCTAACCTCAC CE08820884 iron ABC transport system cg0926 , JK1887 CE0912 GTAGGTTACGCGAACGTAG - hypothetical protein cg0955 CE1009 TTAGGCATCCCTTGCCTCG CE1010 hypothetical proteins DIP0894 CE1346 AGAGTGTAGGCTTACCTAT - hypothetical protein cg1405 CE1860 TTAGGTTATAGTTTCCTTT CE1859 hypothetical proteins - CE1917 GTGGGTGAGGCAAGCCTAA - phage integrase/recombinase - CE1940...”

BO233_15685 DUF1906 domain-containing protein from Enterococcus faecium
Aligns to 303:489 / 783 (23.9%), covers 97.5% of PF08924, 141.7 bits

• Molecular Characterisation of Vancomycin-Resistant Enterococcus faecium Isolates Belonging to the Lineage ST117/CT24 Causing Hospital Outbreaks
  Lisotto, Frontiers in microbiology 2021
  • “...BO233_RS12430 Chromosome C5 ST117/CT24 VRE rectal swab 12-3-2013 BO233_15550 Plasmid C6 ST117/CT24 VRE blood 7-7-2012 BO233_15685 Plasmid S1 ST117/CT24 VSE pus 14-9-2016 NA NA S2 ST117/CT24 VSE pleural fluid 9-9-2016 NA NA S3 ST117/CT24 VSE rectal swab 9-9-2016 NA NA E1 ST117/CT24 VSE blood 2010 NA...”
  • “...isolate from 2012 (C6), the transposon integrated into a peptidoglycan-binding protein gene (GenBank locus taq: BO233_15685) located on the plasmid with 260 SNPs; and (iii) the vanB transposon found in isolates C2 (2012) and C3 (2011) was located on another plasmid and integrated upstream of the...”

MAP2334c hypothetical protein (NCBI) from Mycobacterium avium subsp. paratuberculosis str. k10
Aligns to 52:231 / 240 (75.0%), covers 99.0% of PF08924, 141.5 bits

• Inactivation of Rv2525c, a substrate of the twin arginine translocation (Tat) system of Mycobacterium tuberculosis, increases beta-lactam susceptibility and virulence
  Saint-Joanis, Journal of bacteriology 2006
  • “...Rv2525c; M. tuberculosis; ML1190, M. leprae; MAP2334c, Mycobacterium avium subsp. paratuberculosis; nfa47650, Nocardia farcinica. Stars denote identical...”

LYS25_MYCTU / I6XEI5 Putative peptidoglycan hydrolase Rv2525c; EC 3.2.1.17 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
JTY_RS13125 DUF1906 domain-containing protein from Mycobacterium tuberculosis variant bovis BCG str. Tokyo 172
NP_217041 hypothetical protein from Mycobacterium tuberculosis H37Rv
Rv2525c hypothetical protein (NCBI) from Mycobacterium tuberculosis H37Rv
Aligns to 52:231 / 240 (75.0%), covers 99.0% of PF08924, 140.1 bits

• function: May function as a peptidoglycan hydrolase with glycosidase activity (PubMed:25260828). In vitro, displays esterase activity toward p-nitrophenyl esters of various acyl chain length (C4 to C16), with a preference for p-nitrophenyl butyrate (C4) (PubMed:25869294).
  catalytic activity: Hydrolysis of (1->4)-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins.
  disruption phenotype: Cells lacking this gene display an increase in susceptibility to some beta-lactam antibiotics and, despite slower growth in vitro, enhanced virulence in both cellular and murine models of tuberculosis. No detectable difference in the lipid profiles.
• The prominent alteration in transcriptome and metabolome of Mycobacterium bovis BCG str. Tokyo 172 induced by vitamin B1
  Song, BMC microbiology 2019
  • “...to those genes, JTY_RS12370 ( Rv2390c ), JTY_RS00960 ( Rv0179c ), JTY_RS08085 ( Rv1535 ), JTY_RS13125 ( Rv2525c ) and JTY_RS09350 ( Rv1799 ) were upregulated more than 2-fold (Additional file 2 : Table S2). Universal stress protein There are 10 universal stress proteins (ups) in...”
• Expression, Purification and Characterisation of Secreted Esterase Rv2525c from Mycobacterium tuberculosis.
  Dang, Applied biochemistry and biotechnology 2015 (PubMed)
  • GeneRIF: Expression, Purification and Characterisation of Secreted Esterase Rv2525c from Mycobacterium tuberculosis.
• Inactivation of Rv2525c, a substrate of the twin arginine translocation (Tat) system of Mycobacterium tuberculosis, increases beta-lactam susceptibility and virulence.
  Saint-Joanis, Journal of bacteriology 2006
  • GeneRIF: Upon exposure to antituberculous drugs, rv2525c expression is significantly up-regulated together with those of other genes involved in cell wall biogenesis
• Genome-Wide Study of Drug Resistant Mycobacterium tuberculosis and Its Intra-Host Evolution during Treatment
  Lagutkin, Microorganisms 2022
  • “...a duplication of this repetitive region. Rv1435c was shown to be a part of an Rv2525c -coregulated gene cluster, which consists of cell wall synthesis proteins and penicillin-binding proteins. It was demonstrated that this cluster is upregulated in INH- and ETH-treated MTB [ 66 ]. In...”
  • “...B. Demangel C. Jackson M. Brodin P. Marsollier L. Boshoff H. Cole S.T. Inactivation of Rv2525c, a substrate of the twin arginine translocation (Tat) system of Mycobacterium tuberculosis , increases -Lactam susceptibility and virulence J. Bacteriol. 2006 188 6669 6679 10.1128/JB.00631-06 16952959 67. Chen J. Zhang...”
• Computational identification of significant immunogenic epitopes of the putative outer membrane proteins from Mycobacterium tuberculosis
  Sundar, Journal, genetic engineering & biotechnology 2021
  • “...membrane proteins of Mtb. Among these, certain immunodominant epitopes of Rv0172, Rv0295c, Rv1006, Rv2264c, and Rv2525c were found, which are capable of binding B-cell and a maximum number of MHC alleles. The selected immunodominant epitopes were screened for their allergenic and antigenic properties, their percentage identity...”
  • “...27 0.7743 1.00823 52.17% 16 Rv2307c 115 135 GYGGNPGRPSEQGLAADARAA 12 2 0.9422 0.7492 64.71% 17 Rv2525c a 102 153 YGKGSTADWLGGASAGVQHARRGSELHAAAGGPTSAPIYASIDDNPSYEQYK 27 27 0.9026 0.48836 No significant similarity found 18 Rv2672 33 72 AFGADPRFATYSGAGPQGAATTTPPPAGPPPLAAPKNDLS 21 27 0.7615 0.65308 69.23% 19 Rv2891 33 52 PAHADDSRLGWPLRPPPAVV 21 4 1.2467...”
• Structure-Aware Mycobacterium tuberculosis Functional Annotation Uncloaks Resistance, Metabolic, and Virulence Genes
  Modlin, mSystems 2021
  • “...protein Probable antitoxin VapB/antigen 28066388, 23140854 Rv2272 Transmembrane protein Probable gamma delta T-cell activator 23389928 Rv2525c Tat pathway signal sequence Probable peptidoglycan hydrolase 16952959, 25869294, 25260828 Rv2923c Hypothetical protein Probable osmotically induced bacterial protein C (OsmC, a probable peroxide reductase) 22088319 Rv3632 Membrane protein Putative flippase...”
• The prominent alteration in transcriptome and metabolome of Mycobacterium bovis BCG str. Tokyo 172 induced by vitamin B1
  Song, BMC microbiology 2019
  • “...genes, JTY_RS12370 ( Rv2390c ), JTY_RS00960 ( Rv0179c ), JTY_RS08085 ( Rv1535 ), JTY_RS13125 ( Rv2525c ) and JTY_RS09350 ( Rv1799 ) were upregulated more than 2-fold (Additional file 2 : Table S2). Universal stress protein There are 10 universal stress proteins (ups) in M. tuberculosis...”
• Interaction of Mycobacterium tuberculosis Virulence Factor RipA with Chaperone MoxR1 Is Required for Transport through the TAT Secretion System
  Bhuwan, mBio 2016
  • “...and have been shown to have a role in virulence ( 7 ). Another protein, Rv2525c, a homolog of transglycosidase enzyme, is involved in peptidoglycan metabolism and virulence and is secreted by the TAT secretion system ( 8 ). Previous studies on resuscitation-promoting factors (Rpf), expressed...”
  • “..., Brodin P , Marsollier L , Boshoff H , Cole ST 2006 Inactivation of Rv2525c, a substrate of the twin arginine translocation (Tat) system of Mycobacterium tuberculosis, increases beta-lactam susceptibility and virulence . J Bacteriol 188 : 6669 6679 . doi: 10.1128/JB.00631-06 . 16952959 9....”
• Expression, Purification and Characterisation of Secreted Esterase Rv2525c from Mycobacterium tuberculosis
  Dang, Applied biochemistry and biotechnology 2015 (PubMed)
  • “...and Characterisation of Secreted Esterase Rv2525c from Mycobacterium tuberculosis Guanghui Dang & Liping Chen & Zhaoli Li & Xiaoxia Deng & Yingying Cui & Jun...”
  • “...Springer Science+Business Media New York 2015 Abstract Rv2525c from Mycobacterium tuberculosis belongs to the domain of unknown function (DUF) 1906 superfamily,...”
• Disruption of an M. tuberculosis membrane protein causes a magnesium-dependent cell division defect and failure to persist in mice
  Goodsmith, PLoS pathogens 2015
  • “...division protein sepF Cell division Rv2864c* 3.5 Penicillin-binding lipoprotein Possible transpeptidase PbpD Cell wall biosynthesis Rv2525c 2.8 Conserved hypothetical protein Cell wall biosynthesis Rv0129c fbpC 2.7 Secreted fibronectin-binding protein C Possible trehalose mycolyltransferase Cell wall biosynthesis Rv3330 dacB1 2.7 Penicillin-binding protein Cell wall biosynthesis Rv1433 2.6...”
• Structural studies suggest a peptidoglycan hydrolase function for the Mycobacterium tuberculosis Tat-secreted protein Rv2525c
  Bellinzoni, Journal of structural biology 2014 (PubMed)
  • “...for the Mycobacterium tuberculosis Tat-secreted protein Rv2525c Journal of Structural Biology Journal 10478477 188 2 156 164 156-164 2 text/plain 2014-11-30...”
  • “...secreted by the Tat system in Mycobacterium tuberculosis, Rv2525c is of particular interest, since its gene is conserved in the minimal genome of Mycobacterium...”
• More

DIP0793 Putative secreted protein (NCBI) from Corynebacterium diphtheriae NCTC 13129
Aligns to 53:235 / 302 (60.6%), covers 99.0% of PF08924, 133.8 bits

• Adherence and invasive properties of Corynebacterium diphtheriae strains correlates with the predicted membrane-associated and secreted proteome
  Sangal, BMC genomics 2015
  • “...copper-binding protein. Both of the non-lipoprotein Tat substrates contain domains of unknown function, of which DIP0793 contains a PF08924 (BacA-like) putative peptidoglycan hydrolase domain. In addition to the Sec and Tat translocase, a single type VII secretion system was identified in the C. diphtheriae core proteome,...”

nfa47650 hypothetical protein (NCBI) from Nocardia farcinica IFM 10152
Aligns to 50:229 / 238 (75.6%), covers 99.0% of PF08924, 132.2 bits

• Inactivation of Rv2525c, a substrate of the twin arginine translocation (Tat) system of Mycobacterium tuberculosis, increases beta-lactam susceptibility and virulence
  Saint-Joanis, Journal of bacteriology 2006
  • “...leprae; MAP2334c, Mycobacterium avium subsp. paratuberculosis; nfa47650, Nocardia farcinica. Stars denote identical residues; periods and colons indicate...”

ML1190 conserved hypothetical protein (NCBI ptt file) from Mycobacterium leprae TN
Aligns to 53:230 / 239 (74.5%), covers 99.0% of PF08924, 131.3 bits

• Inactivation of Rv2525c, a substrate of the twin arginine translocation (Tat) system of Mycobacterium tuberculosis, increases beta-lactam susceptibility and virulence
  Saint-Joanis, Journal of bacteriology 2006
  • “...of M. leprae, only one of the corresponding genes, ml1190, escaped inactivation; it is orthologous to the rv2525c gene of M. tuberculosis. The conservation of...”
  • “...C precursor NF plcA Phospholipase C precursor ml1190 Unknown ml0497 ps Similar to G755244 acid phosphatase del ugpB sn-Glycerol-3-phosphate transport del...”

V5EI62 Lysin from Lactobacillus crispatus EM-LC1
Aligns to 20:226 / 301 (68.8%), covers 62.6% of PF08924, 30.8 bits

• Genetic Elements Orchestrating Lactobacillus crispatus Glycogen Metabolism in the Vagina
  Hertzberger, International journal of molecular sciences 2022
  • “...22 1.6 10 7 2.9 10 7 2.0 10 7 1.6 10 7 0.8 0.3 V5EI62 Lysin (Glycoside Hydrolase Family) 15 2.4 10 6 4.6 10 6 1.1 10 7 7.6 10 6 0.9 0.5 V5EF53 SlpA domain-containing protein 12 2.1 10 7 3.0 10 7...”

Q5FHV9 Lysin from Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
LBA1918 lysin (RefSeq) from Lactobacillus acidophilus NCFM
Aligns to 50:264 / 323 (66.6%), covers 51.0% of PF08924, 28.3 bits

• AcmB Is an S-Layer-Associated β-N-Acetylglucosaminidase and Functional Autolysin in Lactobacillus acidophilus NCFM
  Johnson, Applied and environmental microbiology 2016
  • “...- N -Acetylmuramidase lba0616 Putative uncharacterized protein Q5FLC9 pfam01183 234 lysA ( lba1918 ) Lysin Q5FHV9 pfam01183 323 + + lba1140 Lysin Q5FJZ4 pfam01183 382 + + lba1351 Lysin Q5FJE6 pfam01183 404 + + N -Acetylmuramoyl- l -alanine amidase lba0177 Autolysin/amidase Q5FMJ8 pfam01510 364 + +...”
• Deletion of S-Layer Associated Ig-Like Domain Protein Disrupts the Lactobacillus acidophilus Cell Surface
  Klotz, Frontiers in microbiology 2020
  • “...0.25(0.000) lba0957 kpyK Pyruvate kinase 0.04(0.598) 0.38(0.000) lba0845 tuf Elongation factor Tu 0.00 (0.941) 0.15(0.000) lba1918 lysA Lysin 0.37 (0.000) 0.07(0.341) lba1763 pepF Oligopeptidase 0.26(0.000) 0.71(0.000) lba0185 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 0.09 (0.190) 0.92(0.000) lba0222 Putative uncharacterized protein 0.39 (0.000) 1.16 (0.000) lba0831 bipA GTP-binding protein-BipA-EF-TU...”
• Deletion of Lipoteichoic Acid Synthase Impacts Expression of Genes Encoding Cell Surface Proteins in Lactobacillus acidophilus
  Selle, Frontiers in microbiology 2017
  • “...to 1.2 LBA1870 Maltose phosphorylase 1.4 to 3.9 LBA1883 NLP-P60 secreted protein 1.1 to 1.5 LBA1918 lysA 1.7 to 2.4 LBA1928 Hypothetical protein 1.0 to 1.8 FIGURE 2 (A) RNA-seq transcriptional profiles of L. acidophilus derivatives visualized by two-way hierarchical clustering of trimmed mean of M-values...”
  • “...bars indicate LTA-deficient strains. Three of the upregulated genes corresponded to N -acetylmuramidases (LBA1140 and LBA1918) and an endopeptidase (LBA1883), which are predicted to function in peptidoglycan turnover ( Table 2 ). To survey how ltaS deletion impacted collective expression of peptidoglycan hydrolases, we compared expression...”
• Investigating the Effect of Growth Phase on the Surface-Layer Associated Proteome of Lactobacillus acidophilus Using Quantitative Proteomics
  Klotz, Frontiers in microbiology 2017
  • “...Other LBA0957 KpyKPyruvate kinase 0.27 0.204266652 Other * LBA0845 TufElongation factor Tu 1.36 4.72E-05 Cytoplasm LBA1918 LysALysin 1.75 1.49E-05 Signal LBA1763 PepFOligopeptidase 2.65 8.61E-06 Other LBA0185 GpmA2, 3-bisphosphoglycerate-dependent phosphoglycerate mutase 1.80 8.02E-06 Other LBA0222 Putative uncharacterized protein 1.19 0.003670271 Signal LBA0831 BipAGTP-binding protein-BipA-EF-TU family 2.30 5.14E-06...”
• AcmB Is an S-Layer-Associated β-N-Acetylglucosaminidase and Functional Autolysin in Lactobacillus acidophilus NCFM
  Johnson, Applied and environmental microbiology 2016
  • “...409 + + - N -Acetylmuramidase lba0616 Putative uncharacterized protein Q5FLC9 pfam01183 234 lysA ( lba1918 ) Lysin Q5FHV9 pfam01183 323 + + lba1140 Lysin Q5FJZ4 pfam01183 382 + + lba1351 Lysin Q5FJE6 pfam01183 404 + + N -Acetylmuramoyl- l -alanine amidase lba0177 Autolysin/amidase Q5FMJ8 pfam01510...”

Q5FJZ4 Lysin from Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
LBA1140 lysin (RefSeq) from Lactobacillus acidophilus NCFM
Aligns to 42:314 / 382 (71.5%), covers 64.1% of PF08924, 28.3 bits

• AcmB Is an S-Layer-Associated β-N-Acetylglucosaminidase and Functional Autolysin in Lactobacillus acidophilus NCFM
  Johnson, Applied and environmental microbiology 2016
  • “...Q5FLC9 pfam01183 234 lysA ( lba1918 ) Lysin Q5FHV9 pfam01183 323 + + lba1140 Lysin Q5FJZ4 pfam01183 382 + + lba1351 Lysin Q5FJE6 pfam01183 404 + + N -Acetylmuramoyl- l -alanine amidase lba0177 Autolysin/amidase Q5FMJ8 pfam01510 364 + + a Catalytic domain determined by pfam (...”
• S-layer associated proteins contribute to the adhesive and immunomodulatory properties of Lactobacillus acidophilus NCFM
  Klotz, BMC microbiology 2020
  • “...COG* CELLULAR PROCESSES AND SIGNALING LBA0833 ftsW 1.06 D LBA1883 NLP-P60 secreted protein 2.00 M LBA1140 lysin 1.58 M LBA0520 galactosyltransferase 1.48 M LBA1743 cell wall-associated hydrolase 1.16 M LBA1744 glycosidase 1.13 M LBA1736 epsB 1.09 M LBA0165 pepO 1.40 O LBA1901 thioredoxin 1.38 O LBA1208...”
• Host and body site-specific adaptation of Lactobacillus crispatus genomes
  Pan, NAR genomics and bioinformatics 2020
  • “...the autolysins LBA1351 (containing a - N -acetylmuramidase), AcmB (containing a - N -acetylglucosaminidase) and LBA1140 (containing a - N -acetylmuramidase) ( Supplementary Figure S5B ). AcmB has been linked with binding capacity of L. acidophilus NCFM to a number of extracellular matrices such as mucin,...”
• Deletion of Lipoteichoic Acid Synthase Impacts Expression of Genes Encoding Cell Surface Proteins in Lactobacillus acidophilus
  Selle, Frontiers in microbiology 2017
  • “...LBA0873 Hypothetical protein 1.3 to 1.8 LBA1045 Glutamine ABC transporter ATP-binding protein 1.1 to 2.0 LBA1140 Lysin 1.2 to 1.5 LBA1184 Hypothetical protein 1.1 to 1.7 LBA1497 Hypothetical protein 1.1 to 1.3 LBA1665 oppA 2.1 to 3.4 LBA1679 ABC transporter permease 1.7 to 2.4 LBA1680 ABC...”
  • “...levels. Non-solid bars indicate LTA-deficient strains. Three of the upregulated genes corresponded to N -acetylmuramidases (LBA1140 and LBA1918) and an endopeptidase (LBA1883), which are predicted to function in peptidoglycan turnover ( Table 2 ). To survey how ltaS deletion impacted collective expression of peptidoglycan hydrolases, we...”
• AcmB Is an S-Layer-Associated β-N-Acetylglucosaminidase and Functional Autolysin in Lactobacillus acidophilus NCFM
  Johnson, Applied and environmental microbiology 2016
  • “...uncharacterized protein Q5FLC9 pfam01183 234 lysA ( lba1918 ) Lysin Q5FHV9 pfam01183 323 + + lba1140 Lysin Q5FJZ4 pfam01183 382 + + lba1351 Lysin Q5FJE6 pfam01183 404 + + N -Acetylmuramoyl- l -alanine amidase lba0177 Autolysin/amidase Q5FMJ8 pfam01510 364 + + a Catalytic domain determined by...”

D5GXS8 Lysin from Lactobacillus crispatus (strain ST1)
Aligns to 46:293 / 385 (64.4%), covers 65.7% of PF08924, 28.2 bits

• Genetic Elements Orchestrating Lactobacillus crispatus Glycogen Metabolism in the Vagina
  Hertzberger, International journal of molecular sciences 2022
  • “...11 1.5 10 6 3.2 10 6 1.2 10 6 3.2 10 6 1.1 1.4 D5GXS8 Lysin (Glycoside Hydrolase Family) 10 2.9 10 5 3.6 10 5 4.0 10 5 9.7 10 5 0.3 1.3 D5H1Q3 Aggregation promoting factor 4 ND ND 1.5 10 5 2.2...”

Or search for genetic data about PF08924 in the Fitness Browser