Family Search for PF12478 (DUF3697)
PF12478 hits 15 sequences in PaperBLAST's database above the trusted cutoff. Showing all hits. Or show only hits to curated sequences or try another family.
LIG_AEDAE / Q16VD3 Protein lingerer from Aedes aegypti (Yellowfever mosquito) (Culex aegypti) (see paper)
Aligns to 538:572 / 1250 (2.8%), covers 100.0% of PF12478, 75.4 bits
- function: Acts in the nervous system to mediate the control of copulatory organs during courtship.
LIG_DROME / Q86S05 Protein lingerer from Drosophila melanogaster (Fruit fly) (see 3 papers)
Aligns to 575:610 / 1375 (2.6%), covers 100.0% of PF12478, 72.9 bits
- function: Acts in the nervous system to mediate the control of copulatory organs during courtship.
disruption phenotype: Male flies exhibit abnormal copulation. They fail to successfully withdraw their genitalia upon termination of copulation so end up 'stuck' to the female, tugging to separate. There is also a 'non-copulating' behavioral phenotype. There are no morphological defects in the male genitalia. Females can mate successfully but have reduced fertility. Complete loss of lig function results in lethality during early pupal stages. - Rasputin functions as a positive regulator of orb in Drosophila oogenesis
Costa, PloS one 2013 - “...ct % Cov Seq ct Spec ct % Cov Lingerer (CNS; behavior; Grk signaling) (CG8715) Q86S05 74 329 41.3% 25 55 23.7% Drosophila Fragile X Mental Retardation (dFMR1) (CNS: translation factor; Orb regultor) (CG6203) Q9NFU0 31 65 41.2% 5 9 11.1% CG5726 (RNAi) Q7JRH5 30 62...”
NP_995778 lingerer, isoform C from Drosophila melanogaster
Aligns to 575:610 / 1343 (2.7%), covers 100.0% of PF12478, 72.9 bits
UBAP2_HUMAN / Q5T6F2 Ubiquitin-associated protein 2; UBAP-2; RNA polymerase II degradation factor UBAP2 from Homo sapiens (Human) (see 2 papers)
NP_060919 ubiquitin-associated protein 2 isoform 1 from Homo sapiens
Aligns to 512:544 / 1119 (2.9%), covers 100.0% of PF12478, 61.9 bits
- function: Recruits the ubiquitination machinery to RNA polymerase II for polyubiquitination, removal and degradation, when the transcription-coupled nucleotide excision repair (TC-NER) machinery fails to resolve DNA damage (PubMed:35633597). May promote the degradation of ANXA2 (PubMed:27121050).
subunit: May interact with ANXA2. - Epstein-Barr Virus BGLF2 commandeers RISC to interfere with cellular miRNA function.
Campbell, PLoS pathogens 2022 - “...[ 47 ] Q14674 ESPL1 0 60|44 1 0.02453 Q9Y697 NFS1 0 53|74 2.7 0.13895 Q5T6F2 UBAP2 0 41|52 5.9 0.04155 SG [ 47 ] Q9Y5X1 SNX9 0 40|57 2.3 0.08151 Q8TD19 HNEK9 0 38|38 3.4 0.03882 Q9HCJ0 TNRC6C 0 38|17 1 0.01627 SG and PB...”
- Understanding the activating mechanism of the immune system against COVID-19 by Traditional Indian Medicine: Network pharmacology approach.
Thirumal, Advances in protein chemistry and structural biology 2022 - “...605898 Q9NYU1 TRIM59 TRIM59 ENSG00000213186 30834 286827 616148 Q8IWR1 UBAP2 UBAP2 ENSG00000137073 14185 55833 NA Q5T6F2 TYSND1 TYSND1 ENSG00000156521 28531 219743 611017 Q2T9J0 UBAP2L UBAP2L ENSG00000143569 29877 9898 616472 Q14157 UPF1 UPF1 ENSG00000005007 9962 5976 601430 Q92900 ITGB1 ITGB1 ENSG00000150093 6153 3688 135630 P05556 PUSL1 PUSL1...”
- The HLA Ligandome Comprises a Limited Repertoire of O-GlcNAcylated Antigens Preferentially Associated With HLA-B*07:02.
Mukherjee, Frontiers in immunology 2021 - “...TPASSSSAL 9 Q9NPG3 Ubinuclein-1 Nucleus HLA-B*07:02 5 875-883 CS, ( 26 ) 51 KPPTSQSSVL 10 Q5T6F2 Ubiquitin-associated protein 2 Nucleus, Cytoplasm HLA-B*07:02 32 411420 CS, ( 26 ) 52 VPVgSSASEL 9 Q7Z2W4-3 Zinc finger CCCH-type, antiviral 1 Nucleus, Cytoplasm HLA-B*07:02 36 596603 ( 26 ) 53...”
- Alignment of virus-host protein-protein interaction networks by integer linear programming: SARS-CoV-2.
Llabrés, PloS one 2020 - “...P62820 0.289 0.761 Q99471 Q8N6S5 Q9UQN3 O43633 0.932 0.885 O43447 Q9H2H8 0.723 0.929 0.694 P46379 Q5T6F2 0.799 0.102 Q9H000 Q96IZ5 0.188 0.733 Q92802 O95391 0.811 0.209 P98161 O75592 0.379 0.725 0.596 (b) Non-structural protein nsp12 (NP_828869, P0DTD1-PRO_0000449629) SARS-CoV-1 SARS-CoV-2 BPO CCO MFO P20290 P51148 0.521 0.666...”
- A proteomic approach to understanding the pathogenesis of idiopathic macular hole formation.
Zhang, Clinical proteomics 2017 - “...Neuronal cell surface protein involved in cell recognition and cell adhesion Ubiquitin-associated protein 2 UBAP2 Q5T6F2 Cadherin binding involved in cellcell adhesion Spondin-1 SPON1 Q9HCB6 Cell adhesion protein; found in ECM Apolipoprotein B-100 APOB P04114 Phospholipid/cholesterol transporter activity Metallothionein-1A MT1A P04731 Zinc ion binding; negative regulation...”
- Identification of Glycopeptides as Posttranslationally Modified Neoantigens in Leukemia.
Malaker, Cancer immunology research 2017 - “...Q06413 AML, ALL, CLL1, JY, S, To Myocyte-specific enhancer factor 2C 15 f KPP(ts)QSSVL 411420 Q5T6F2 ALL Ubiquitin associated protein 2 16 g KPPVsFFSL 95103 Q6PKC3 ALL Thioredoxin domain containing protein 11 17 h KPTLLYnVSL 373381 P04220 CLL1, CLL2 Ig Mu heavy chain disease protein 18...”
- Intrinsically disordered linkers determine the interplay between phase separation and gelation in multivalent proteins.
Harmon, eLife 2017 - “...Q9BQG0 EAYRLSLEADRAKREAHEREMAEQFRLEQIRKEQEEEREA 0.55 0.10 0.88 Q9UNN5 RRQRRWEDIFNQHEEELRQVDKDKEDESSDNDEVFHSIQA 0.50 0.15 0.73 Q7Z2Y5 NNRKGRGGNRGREFRGEENGIDCNQVDKPSDRGKRARGRG 0.45 0.15 0.76 Q5T6F2 QKQKLRLLSSVKPKTGEKSRDDALEAIKGNLDGFSRDAKM 0.40 0.10 0.75 Q9UMZ2 AEMKVLESPENKSGTFKAQEAEAGVLGNEKGKEAEGSLTE 0.35 0.10 0.78 Q8N3D4 MAAAESDKDSGFSDGSSECLSSAEQMESEDMLSALGWSRE 0.30 0.20 0.78 Q9C0C6 DHFMKSGFASGRNFGNRDAGECNKRDNTSTMGGFGVGKSF 0.25 0.05 0.68 Q9NQI0 TAVSTSGPEDICSSSSSHERGGEATWSGSEFEVSFLDSPG 0.20 0.15 0.80 Q9BQQ3 FSTLGRLRNGIGGAAGIPRANASRTNFSSHTNQSGGSELR 0.15 0.10 0.73 Q9Y252...”
- Identification of CTCF as a master regulator of the clustered protocadherin genes.
Golan-Mashiach, Nucleic acids research 2012 - “...Q99417 C-Myc-binding protein MYCBP Stimulates the activation of E box-dependent transcription by MYC 5 16 Q5T6F2 Ubiquitin-associated protein 2 UBAP2 The function of this protein has not been determined 5 17 Q6PJG2 Uncharacterized protein C14orf43 CN043 unknown 6 To test which of the proteins identified by...”
- More
- UBAP2/UBAP2L regulate UV-induced ubiquitylation of RNA polymerase II and are the human orthologues of yeast Def1.
Herlihy, DNA repair 2022 (PubMed)- GeneRIF: UBAP2/UBAP2L regulate UV-induced ubiquitylation of RNA polymerase II and are the human orthologues of yeast Def1.
- Circ-UBAP2 functions as sponges of miR-1205 and miR-382 to promote glioma progression by modulating STC1 expression.
Wang, Cancer medicine 2021 - GeneRIF: Circ-UBAP2 functions as sponges of miR-1205 and miR-382 to promote glioma progression by modulating STC1 expression.
- Emerging roles of circUBAP2 targeting miR-370-3p in proliferation, apoptosis, and invasion of papillary thyroid cancer cells.
Xiong, Human cell 2021 (PubMed)- GeneRIF: Emerging roles of circUBAP2 targeting miR-370-3p in proliferation, apoptosis, and invasion of papillary thyroid cancer cells.
- circRNA-UBAP2 promotes the proliferation and inhibits apoptosis of ovarian cancer though miR-382-5p/PRPF8 axis.
Xu, Journal of ovarian research 2020 - GeneRIF: circRNA-UBAP2 promotes the proliferation and inhibits apoptosis of ovarian cancer though miR-382-5p/PRPF8 axis.
- Ubiquitin-binding associated protein 2 regulates KRAS activation and macropinocytosis in pancreatic cancer.
Xiong, FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2020 - GeneRIF: Ubiquitin-binding associated protein 2 regulates KRAS activation and macropinocytosis in pancreatic cancer.
- Upregulation of circ-UBAP2 predicts poor prognosis and promotes triple-negative breast cancer progression through the miR-661/MTA1 pathway.
Wang, Biochemical and biophysical research communications 2018 (PubMed)- GeneRIF: The circ-UBAP2 plays a vital regulatory role in triple-negative breast cancer (TNBC) via the miR-661/MTA1 axis and may serve as a promising therapeutic target for TNBC patients.
- [Effect of Circular RNA UBAP2 Silencing on Proliferation and Invasion of Human Lung Cancer A549 Cells and Its Mechanism].
Yin, Zhongguo fei ai za zhi = Chinese journal of lung cancer 2017 - GeneRIF: Effect of Circular RNA UBAP2 Silencing on Proliferation and Invasion of Human Lung Cancer A549 Cells
- Amplification of the 9p13.3 chromosomal region in prostate cancer.
Latonen, Genes, chromosomes & cancer 2016 (PubMed)- GeneRIF: We found that the 9p13.3 amplification harbors several genes that are able to affect the growth of PC cells when downregulated using siRNA. Of these, UBAP2 was the most prominently upregulated gene in the clinical prostate tumor samples
- More
F1SEA5 Ubiquitin associated protein 2 from Sus scrofa
Aligns to 436:468 / 1053 (3.1%), covers 100.0% of PF12478, 60.4 bits
Q91VX2 Ubiquitin-associated protein 2 from Mus musculus
Aligns to 512:544 / 1132 (2.9%), covers 100.0% of PF12478, 58.2 bits
Q4V8A7 Atp8b2 protein from Rattus norvegicus
Aligns to 520:551 / 580 (5.5%), covers 94.3% of PF12478, 57.3 bits
NP_001120792 ubiquitin-associated protein 2-like isoform b from Homo sapiens
Aligns to 495:526 / 983 (3.3%), covers 94.3% of PF12478, 56.4 bits
- UBAP2/UBAP2L regulate UV-induced ubiquitylation of RNA polymerase II and are the human orthologues of yeast Def1.
Herlihy, DNA repair 2022 (PubMed)- GeneRIF: UBAP2/UBAP2L regulate UV-induced ubiquitylation of RNA polymerase II and are the human orthologues of yeast Def1.
- Molecular Insights into the Recruiting Between UCP2 and DDX5/UBAP2L in the Metabolic Plasticity of Non-Small-Cell Lung Cancer.
Yang, Journal of chemical information and modeling 2021 (PubMed)- GeneRIF: Molecular Insights into the Recruiting Between UCP2 and DDX5/UBAP2L in the Metabolic Plasticity of Non-Small-Cell Lung Cancer.
- Ubiquitin-associated protein 2 like (UBAP2L) enhances growth and metastasis of gastric cancer cells.
Lin, Bioengineered 2021 - GeneRIF: Ubiquitin-associated protein 2 like (UBAP2L) enhances growth and metastasis of gastric cancer cells.
- UBAP2L arginine methylation by PRMT1 modulates stress granule assembly.
Huang, Cell death and differentiation 2020 - GeneRIF: UBAP2L arginine methylation by PRMT1 modulates stress granule assembly.
- UBAP2L Forms Distinct Cores that Act in Nucleating Stress Granules Upstream of G3BP1.
Cirillo, Current biology : CB 2020 (PubMed)- GeneRIF: UBAP2L Forms Distinct Cores that Act in Nucleating Stress Granules Upstream of G3BP1.
- Large-scale tethered function assays identify factors that regulate mRNA stability and translation.
Luo, Nature structural & molecular biology 2020 - GeneRIF: Large-scale tethered function assays identify factors that regulate mRNA stability and translation.
- UBAP2L silencing inhibits cell proliferation and G2/M phase transition in breast cancer.
He, Breast cancer (Tokyo, Japan) 2018 - GeneRIF: High UBAP2L expression is associated with breast cancer.
- Knockdown of Ubiquitin Associated Protein 2-Like (UBAP2L) Inhibits Growth and Metastasis of Hepatocellular Carcinoma.
Li, Medical science monitor : international medical journal of experimental and clinical research 2018 - GeneRIF: UBAP2L plays an oncogenic role in HCC, and knockdown of its expression significantly inhibits HCC growth and metastasis, which may be related to the regulation of PI3K/AKT and P53 signaling pathways by UBAP2L.
- More
UBP2L_HUMAN / Q14157 Ubiquitin-associated protein 2-like; Protein NICE-4; RNA polymerase II degradation factor UBAP2L from Homo sapiens (Human) (see 4 papers)
Aligns to 495:526 / 1087 (2.9%), covers 94.3% of PF12478, 56.3 bits
- function: Recruits the ubiquitination machinery to RNA polymerase II for polyubiquitination, removal and degradation, when the transcription-coupled nucleotide excision repair (TC-NER) machinery fails to resolve DNA damage (PubMed:35633597). Plays an important role in the activity of long-term repopulating hematopoietic stem cells (LT- HSCs) (By similarity). Required for efficient formation of stress granules (PubMed:29395067).
subunit: Interacts with BMI1 (PubMed:25185265). Part of a complex consisting of UBAP2L, BMI1 and RNF2(PubMed:25185265). - Epstein-Barr Virus BGLF2 commandeers RISC to interfere with cellular miRNA function.
Campbell, PLoS pathogens 2022 - “...95|51 10.1 0.02521 SG [ 47 , 49 ] Q8N6T3 ARFGAP1 0 74|86 6.4 0.19704 Q14157 UBAP2L 0 71|81 10.4 0.06992 SG [ 47 , 49 ] O60573 EIF4E2 0 71|59 8.6 0.26531 SG and PB [ 47 ] Q14674 ESPL1 0 60|44 1 0.02453 Q9Y697...”
- Understanding the activating mechanism of the immune system against COVID-19 by Traditional Indian Medicine: Network pharmacology approach.
Thirumal, Advances in protein chemistry and structural biology 2022 - “...NA Q5T6F2 TYSND1 TYSND1 ENSG00000156521 28531 219743 611017 Q2T9J0 UBAP2L UBAP2L ENSG00000143569 29877 9898 616472 Q14157 UPF1 UPF1 ENSG00000005007 9962 5976 601430 Q92900 ITGB1 ITGB1 ENSG00000150093 6153 3688 135630 P05556 PUSL1 PUSL1 ENSG00000169972 26914 126789 NA Q8N0Z8 PVR PVR ENSG00000073008 9705 5817 173850 P15151 RAB2A RAB2A...”
- Protein and Signaling Pathway Responses to rhIL-6 Intervention Before Lobaplatin Treatment in Osteosarcoma Cells
Wang, Frontiers in oncology 2021 - “...fosB FOSB P01100 Proto-oncogene c-Fos FOS Fragile X mental retardation syndrome-related protein 1 (two connected) Q14157 Ubiquitin-associated protein 2-like UBAP2L P51114 Fragile X mental retardation syndroame-related protein 1 FXR1 STRING Ras GTPase-activating protein-binding protein 1 (five connected) P51114 Fragile X mental retardation syndrome-related protein 1 FXR1...”
- “...retardation syndrome-related protein 1 FXR1 Q13283 Ras GTPase-activating protein-binding protein 1 G3BP1 Q14444 Caprin-1 CAPRIN1 Q14157 Ubiquitin-associated protein 2-like UBAP2L Fragile X mental retardation syndromerelated protein 1 (three connected) Q13283 Ras GTPase-activating protein-binding protein 1 G3BP1 Q9UN86 Ras GTPase-activating protein-binding protein 2 G3BP2 Q14444 Caprin-1 CAPRIN1...”
- Quantification of FAM20A in human milk and identification of calcium metabolism proteins
Patel, Physiological reports 2021 - “...protein 4 [T22D4_HUMAN] MFGM CID TTC1 Q99614 Tetratricopeptide repeat protein 1 [TTC1_HUMAN] MFGM CID UBAP2L Q14157 Ubiquitinassociated protein 2like [UBP2L_HUMAN] MFGM CID UBTD2 Q8WUN7 Ubiquitin domaincontaining protein 2 [UBTD2_HUMAN] MFGM CID UQCRB P14927 Cytochrome bc1 complex subunit 7 [QCR7_HUMAN] MFGM CID UQCRFS1 P47985 Cytochrome bc1 complex...”
- Quantitative phosphoproteomic analysis reveals chemoresistance-related proteins and signaling pathways induced by rhIL-6 in human osteosarcoma cells
Zhang, Cancer cell international 2021 - “...kinase 13 MAPK13 Q15759 Mitogen-activated protein kinase 11 MAPK11 P53778 Mitogen-activated protein kinase 12 MAPK12 Q14157 Mitogen-activated protein kinase 14 MAPK14 P78527 DNA-dependent protein kinase catalytic subunit PRKDC P68400 Casein kinase II subunit alpha CSNK2A1 P49840 Glycogen synthase kinase-3 alpha GSK3A P49841 Glycogen synthase kinase-3 beta...”
- The human olfactory cleft mucus proteome and its age-related changes.
Yoshikawa, Scientific reports 2018 - “...1 P13693 19697 Translationally-controlled tumor protein 0.54 0.0061 4.9 0.3 2.8 0.1 3.8 0.1 2 Q14157 114579 Ubiquitin-associated protein 2-like 0.53 0.0082 0.2 0.0 0.0 0.0 0.1 0.0 3 Q8TD33 10578 Secretoglobin family 1C member 1 0.52 0.0085 5.0 0.2 0.0 0.0 2.5 0.1 4 P08185...”
- Aging-related tau astrogliopathy (ARTAG): not only tau phosphorylation in astrocytes.
Ferrer, Brain pathology (Zurich, Switzerland) 2018 - Methionine residues around phosphorylation sites are preferentially oxidized in vivo under stress conditions.
Veredas, Scientific reports 2017 - “...than 3 phosphosites was only 10%. Nevertheless, there exist proteins such as ubiquitin-associated protein 2-like (Q14157) and kinesin light chain 2 (Q9H0B6) which possess sulfoxidable methionines (M466 and M612, respectively) that are surrounded by up to 8 different phosphosites. To further strengthen the conclusion that the...”
- More
NP_001019969 ubiquitin-associated protein 2-like from Rattus norvegicus
Aligns to 515:546 / 1105 (2.9%), covers 94.3% of PF12478, 56.3 bits
NP_705693 ubiquitin-associated protein 2-like isoform 2 from Mus musculus
Aligns to 495:526 / 1067 (3.0%), covers 94.3% of PF12478, 56.3 bits
F8W726 Ubiquitin-associated protein 2-like from Homo sapiens
Aligns to 506:537 / 1079 (3.0%), covers 94.3% of PF12478, 56.3 bits
UBP2L_MOUSE / Q80X50 Ubiquitin-associated protein 2-like; RNA polymerase II degradation factor Ubap2l from Mus musculus (Mouse) (see paper)
Aligns to 515:546 / 1107 (2.9%), covers 94.3% of PF12478, 56.3 bits
- function: Recruits the ubiquitination machinery to RNA polymerase II for polyubiquitination, removal and degradation, when the transcription-coupled nucleotide excision repair (TC-NER) machinery fails to resolve DNA damage (By similarity). Plays an important role in the activity of long-term repopulating hematopoietic stem cells (LT- HSCs) (PubMed:25185265). Required for efficient formation of stress granules (By similarity).
subunit: Interacts with BMI1. Part of a complex consisting of UBAP2L, BMI1 and RNF2. - The amyloid peptide β disrupts intercellular junctions and increases endothelial permeability in a NADPH oxidase 1-dependent manner.
Tarafdar, Redox biology 2022 - “...cobalamin transport escort protein LMBD1 Lmbrd1 0.038995409 Q9R0P9 Ubiquitin carboxyl-terminal hydrolase isozyme L1 Uchl1 0.044148581 Q80X50 Ubiquitin-associated protein 2-like Ubap2l 0.044849063 Cytoskeleton and transport O35098 Dihydropyrimidinase-related protein 4 Dpysl4 9.41366E-05 Q3UVL4 Vacuolar protein sorting-associated protein 51 homolog Vps51 0.000644658 Q9D898 Actin-related protein 2/3 complex subunit 5-like...”
- “...Q8K0B2 Lysosomal cobalamin transport escort protein LMBD1 Lmbrd1 0.0095729 Q8BGQ7 Alanine--tRNA ligase, cytoplasmic Aars1 0.0102687 Q80X50 Ubiquitin-associated protein 2-like Ubap2l 0.0116174 Q8BJW6 Eukaryotic translation initiation factor 2A Eif2a 0.0116343 Q69ZR2 E3 ubiquitin-protein ligase HECTD1 Hectd1 0.0119589 Q9JK81 MYG1 exonuclease Myg1 0.0143308 Q9CQJ6 Density-regulated protein Denr 0.0216944...”
- Integrated analysis of proteome and transcriptome changes in the mucopolysaccharidosis type VII mouse hippocampus
Parente, Molecular genetics and metabolism 2016 - “...Ctnna2 0.048 -3.44 catenin (cadherin associated protein), alpha 2 Q9D7X8 Ggct 0.046 -3.46 gamma-glutamyl cyclotransferase Q80X50 Ubap2l 0.049 -3.49 ubiquitin associated protein 2-like P28740 Kif2a 0.011 -3.52 kinesin family member 2A P21619 Lmnb2 0.042 -3.60 lamin B2 P28271 Aco1 0.020 -3.61 aconitase 1 P60469 Ppfia3 0.021...”
- Identification of O-linked N-acetylglucosamine (O-GlcNAc)-modified osteoblast proteins by electron transfer dissociation tandem mass spectrometry reveals proteins critical for bone formation
Nagel, Molecular & cellular proteomics : MCP 2013 - “...kinase WNK1 Q8BT14 Q61191 P48678 Q8BFW7 Q811L6 Q80X50 P83741 Q99K90 Q02614 Q689Z5 Q8CF89 Q02780 Q6PIJ4 Q02819 P81117 Q80U93 Q6ZPK0 Q9DBG5 Q6NXI6...”
- The nonpolymorphic MHC Qa-1b mediates CD8+ T cell surveillance of antigen-processing defects.
Oliveira, The Journal of experimental medicine 2010 - “...22 FQVTHTVAL 113-121 361 Q9QYA2 Mitochondrial import receptor subunit TOM40 homologue 23 GGPINPATA 1036-1044 1107 Q80X50 Ubiquitin-associated protein 2-like 24 GLGVLLAF 5-12 113 Q8QZT4 Crumbs protein homologue 3 25 HSIQNSQDM 61-69 210 Q91YN9 BAG family molecular chaperone regulator 2 26 IQKTPQIQVY 21-30 119 P01887 Beta-2-microglobulin 27...”
NP_001076535 ubiquitin-associated protein 2-like from Danio rerio
Aligns to 534:565 / 1144 (2.8%), covers 94.3% of PF12478, 54.4 bits
- Deep RNA sequencing of the skeletal muscle transcriptome in swimming fish
Palstra, PloS one 2013 - “...(herpes virus-associated) [X. laevis] 537 NP_001121282 6.28E58 RefSeq W ubiquitin-associated protein 2-like [D. rerio] 520 NP_001076535 1.37E50 Drerio W ubiquitin-conjugating enzyme E2 E3 [D. rerio] 598 NP_957215 1.21E14 Drerio R, W ubiquitin-like modifier-activating enzyme 1 [D. rerio] 815 NP_998227 1.34E127 Drerio W ubiquitin-protein ligase E3A [D....”
K1RJ91 Ubiquitin-associated protein 2 from Crassostrea gigas
Aligns to 527:556 / 1396 (2.1%), covers 80.0% of PF12478, 44.7 bits
Or search for genetic data about PF12478 in the Fitness Browser
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory