Family Search for PF12478 (DUF3697)
PF12478.8 hits 16 sequences in PaperBLAST's database above the trusted cutoff. Showing all hits. Or show only hits to curated sequences or try another family.
LIG_AEDAE / Q16VD3 Protein lingerer from Aedes aegypti (Yellowfever mosquito) (Culex aegypti) (see paper)
Aligns to 538:572 / 1250 (2.8%), covers 100.0% of PF12478, 75.4 bits
- function: Acts in the nervous system to mediate the control of copulatory organs during courtship.
LIG_DROME / Q86S05 Protein lingerer from Drosophila melanogaster (Fruit fly) (see 3 papers)
Aligns to 575:610 / 1375 (2.6%), covers 100.0% of PF12478, 72.9 bits
- function: Acts in the nervous system to mediate the control of copulatory organs during courtship.
disruption phenotype: Male flies exhibit abnormal copulation. They fail to successfully withdraw their genitalia upon termination of copulation so end up 'stuck' to the female, tugging to separate. There is also a 'non-copulating' behavioral phenotype. There are no morphological defects in the male genitalia. Females can mate successfully but have reduced fertility. Complete loss of lig function results in lethality during early pupal stages. - Rasputin functions as a positive regulator of orb in Drosophila oogenesis
Costa, PloS one 2013 - “...ct % Cov Seq ct Spec ct % Cov Lingerer (CNS; behavior; Grk signaling) (CG8715) Q86S05 74 329 41.3% 25 55 23.7% Drosophila Fragile X Mental Retardation (dFMR1) (CNS: translation factor; Orb regultor) (CG6203) Q9NFU0 31 65 41.2% 5 9 11.1% CG5726 (RNAi) Q7JRH5 30 62...”
NP_995778 lingerer, isoform C from Drosophila melanogaster
Aligns to 575:610 / 1343 (2.7%), covers 100.0% of PF12478, 72.9 bits
Q5T6F2 Ubiquitin-associated protein 2 from Homo sapiens
Aligns to 512:544 / 1119 (2.9%), covers 100.0% of PF12478, 61.9 bits
- A proteomic approach to understanding the pathogenesis of idiopathic macular hole formation.
Zhang, Clinical proteomics 2017 - “...Neuronal cell surface protein involved in cell recognition and cell adhesion Ubiquitin-associated protein 2 UBAP2 Q5T6F2 Cadherin binding involved in cellcell adhesion Spondin-1 SPON1 Q9HCB6 Cell adhesion protein; found in ECM Apolipoprotein B-100 APOB P04114 Phospholipid/cholesterol transporter activity Metallothionein-1A MT1A P04731 Zinc ion binding; negative regulation...”
- Identification of Glycopeptides as Posttranslationally Modified Neoantigens in Leukemia.
Malaker, Cancer immunology research 2017 - “...Q06413 AML, ALL, CLL1, JY, S, To Myocyte-specific enhancer factor 2C 15 f KPP(ts)QSSVL 411420 Q5T6F2 ALL Ubiquitin associated protein 2 16 g KPPVsFFSL 95103 Q6PKC3 ALL Thioredoxin domain containing protein 11 17 h KPTLLYnVSL 373381 P04220 CLL1, CLL2 Ig Mu heavy chain disease protein 18...”
- Intrinsically disordered linkers determine the interplay between phase separation and gelation in multivalent proteins.
Harmon, eLife 2017 - “...Q9BQG0 EAYRLSLEADRAKREAHEREMAEQFRLEQIRKEQEEEREA 0.55 0.10 0.88 Q9UNN5 RRQRRWEDIFNQHEEELRQVDKDKEDESSDNDEVFHSIQA 0.50 0.15 0.73 Q7Z2Y5 NNRKGRGGNRGREFRGEENGIDCNQVDKPSDRGKRARGRG 0.45 0.15 0.76 Q5T6F2 QKQKLRLLSSVKPKTGEKSRDDALEAIKGNLDGFSRDAKM 0.40 0.10 0.75 Q9UMZ2 AEMKVLESPENKSGTFKAQEAEAGVLGNEKGKEAEGSLTE 0.35 0.10 0.78 Q8N3D4 MAAAESDKDSGFSDGSSECLSSAEQMESEDMLSALGWSRE 0.30 0.20 0.78 Q9C0C6 DHFMKSGFASGRNFGNRDAGECNKRDNTSTMGGFGVGKSF 0.25 0.05 0.68 Q9NQI0 TAVSTSGPEDICSSSSSHERGGEATWSGSEFEVSFLDSPG 0.20 0.15 0.80 Q9BQQ3 FSTLGRLRNGIGGAAGIPRANASRTNFSSHTNQSGGSELR 0.15 0.10 0.73 Q9Y252...”
- Identification of CTCF as a master regulator of the clustered protocadherin genes.
Golan-Mashiach, Nucleic acids research 2012 - “...Q99417 C-Myc-binding protein MYCBP Stimulates the activation of E box-dependent transcription by MYC 5 16 Q5T6F2 Ubiquitin-associated protein 2 UBAP2 The function of this protein has not been determined 5 17 Q6PJG2 Uncharacterized protein C14orf43 CN043 unknown 6 To test which of the proteins identified by...”
- Combining high-energy C-trap dissociation and electron transfer dissociation for protein O-GlcNAc modification site assignment.
Zhao, Journal of proteome research 2011 - “...of Ubiquitin-associated protein 2-like S445 Q2KHR3-1 Isoform 1 of Glutamine and serine-rich protein 1 T1271 Q5T6F2 Ubiquitin-associated protein 2 T487; S494 Q5T8P6-3 Isoform 3 of RNA-binding protein 26 S657; S667 Q6MZP7-1 Isoform 1 of Protein lin-54 homolog T109 Q7Z589 Isoform 1 of Protein EMSY S228; T264;...”
- Studies of phosphoproteomic changes induced by nucleophosmin-anaplastic lymphoma kinase (ALK) highlight deregulation of tumor necrosis factor (TNF)/Fas/TNF-related apoptosis-induced ligand signaling pathway in ALK-positive anaplastic large cell lymphoma
Wu, Molecular & cellular proteomics : MCP 2010 - “...Heat shock protein 60 (CH60) Q15648 Q16543 Q5SRE5 Q5T6F2 Q86YZ3 Q99961 Nucleoprotein TPR (TPR) SHC-transforming protein 1 (SHC)a Ran GTPase-activating protein 1...”
- Massive peptide sharing between viral and human proteomes
Kanduc, Peptides 2008 - “...Q86VK9; Q8IV74; HXA9_HUMAN; Q68CS5; Q8TEH7; Q6ZNW8; TRPV1_HUMAN; Q8N3Q9; Q6P995; Q6EF02; FA47B_HUMAN; CI055_HUMAN; BAD_HUMAN; Q5T7E5; Q6LET9; Q5T6F2; Q5VWV2; PCD16_HUMAN; 3BHS7_HUMAN; CB013_HUMAN; Q59FA6; Q9H901; Q8N1Y8; Q9BVY2; Q6ZSI0; MYOTI_HUMAN; Q6P0L0; Q8IYC2; Q5SWJ3; SPDYA_HUMAN; Q9Y569; Q2QD09; Q6NXR2; Q5T3L7; Q8N2D3; Q5JR95; Q5TYV8 Sequence similarity analyses of each of the 30 viral...”
NP_060919 ubiquitin-associated protein 2 isoform 1 from Homo sapiens
Aligns to 512:544 / 1119 (2.9%), covers 100.0% of PF12478, 61.9 bits
- Upregulation of circ-UBAP2 predicts poor prognosis and promotes triple-negative breast cancer progression through the miR-661/MTA1 pathway.
Wang, Biochemical and biophysical research communications 2018 (PubMed)- GeneRIF: The circ-UBAP2 plays a vital regulatory role in triple-negative breast cancer (TNBC) via the miR-661/MTA1 axis and may serve as a promising therapeutic target for TNBC patients.
- [Effect of Circular RNA UBAP2 Silencing on Proliferation and Invasion of Human Lung Cancer A549 Cells and Its Mechanism].
Yin, Zhongguo fei ai za zhi = Chinese journal of lung cancer 2017 - GeneRIF: Effect of Circular RNA UBAP2 Silencing on Proliferation and Invasion of Human Lung Cancer A549 Cells
- Amplification of the 9p13.3 chromosomal region in prostate cancer.
Latonen, Genes, chromosomes & cancer 2016 (PubMed)- GeneRIF: We found that the 9p13.3 amplification harbors several genes that are able to affect the growth of PC cells when downregulated using siRNA. Of these, UBAP2 was the most prominently upregulated gene in the clinical prostate tumor samples
- UBAP2 negatively regulates the invasion of hepatocellular carcinoma cell by ubiquitinating and degradating Annexin A2.
Bai, Oncotarget 2016 - GeneRIF: UBAP2 formed a complex with Annexin A2 and promoted the degradation of Annexin A2 protein by ubiquitination, and then inhibited HCC progression.
- Exome-wide association study of replicable nonsynonymous variants conferring risk for alcohol dependence.
Zuo, Journal of studies on alcohol and drugs 2013 - GeneRIF: By incorporating the information from bioinformatics and RNA expression analyses, we identified at least two of the most promising risk genes for alcohol dependence: APOER2 and UBAP2
- Is KIF24 a genetic risk factor for Frontotemporal Lobar Degeneration?
Venturelli, Neuroscience letters 2010 (PubMed)- GeneRIF: Observational study of gene-disease association. (HuGE Navigator)
- Eukaryotic snoRNAs: a paradigm for gene expression flexibility.
Dieci, Genomics 2009 (PubMed)- GeneRIF: UBAP2 serves as a host gene for snoRNAs
F1SEA5 Ubiquitin associated protein 2 from Sus scrofa
Aligns to 436:468 / 1053 (3.1%), covers 100.0% of PF12478, 60.4 bits
Q91VX2 Ubiquitin-associated protein 2 from Mus musculus
Aligns to 512:544 / 1132 (2.9%), covers 100.0% of PF12478, 58.2 bits
Q4V8A7 Atp8b2 protein from Rattus norvegicus
Aligns to 520:551 / 580 (5.5%), covers 94.3% of PF12478, 57.3 bits
NP_001120792 ubiquitin-associated protein 2-like isoform b from Homo sapiens
Aligns to 495:526 / 983 (3.3%), covers 94.3% of PF12478, 56.4 bits
- UBAP2L silencing inhibits cell proliferation and G2/M phase transition in breast cancer.
He, Breast cancer (Tokyo, Japan) 2018 - GeneRIF: High UBAP2L expression is associated with breast cancer.
- Knockdown of Ubiquitin Associated Protein 2-Like (UBAP2L) Inhibits Growth and Metastasis of Hepatocellular Carcinoma.
Li, Medical science monitor : international medical journal of experimental and clinical research 2018 - GeneRIF: UBAP2L plays an oncogenic role in HCC, and knockdown of its expression significantly inhibits HCC growth and metastasis, which may be related to the regulation of PI3K/AKT and P53 signaling pathways by UBAP2L.
- Downregulation of UBAP2L Inhibits the Epithelial-Mesenchymal Transition via SNAIL1 Regulation in Hepatocellular Carcinoma Cells.
Ye, Cellular physiology and biochemistry : international journal of experimental cellular physiology, biochemistry, and pharmacology 2017 (PubMed)- GeneRIF: UBAP2L plays a critical role in maintenance of the metastatic ability of Hepatocellular Carcinoma Cells cells via SNAIL1 Regulation and is predictive of a poor clinical outcome.
- UBAP2L is amplified in a large subset of human lung adenocarcinoma and is critical for epithelial lung cell identity and tumor metastasis.
Aucagne, FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2017 (PubMed)- GeneRIF: UBAP2L is amplified in 15% of human primary lung adenocarcinoma specimens. Such patients express higher levels of UBAP2L and show a reduction in survival when compared with those who do not have this gene amplification.
- Ubiquitin Associated Protein 2-Like (UBAP2L) Overexpression in Patients with Hepatocellular Carcinoma and its Clinical Significance.
Wang, Medical science monitor : international medical journal of experimental and clinical research 2017 - GeneRIF: UBAP2L was overexpressed in HCC, and patients with high UBAP2L expression had unfavorable prognosis.
- Arginine methylation of ubiquitin-associated protein 2-like is required for the accurate distribution of chromosomes.
Maeda, FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2016 (PubMed)- GeneRIF: arginine residues in the RGG/RG motif of UBAP2L were directly methylated by PRMT1. RGG/RG motif of UBAP2L is essential for the proper alignment of chromosomes.
- Downregulation of ubiquitin-associated protein 2-like with a short hairpin RNA inhibits human glioma cell growth in vitro.
Zhao, International journal of molecular medicine 2015 - GeneRIF: These results suggest that UBAP2L has a key role in glioma cell growth, and may act as an oncogene to promote malignant glioma development.
- Knockdown of ubiquitin associated protein 2-like inhibits the growth and migration of prostate cancer cells.
Li, Oncology reports 2014 (PubMed)- GeneRIF: Knockdown of UBAP2L in prostate carcinoma inhibited cell proliferation, migration, and colony formation ability, and blocked cell cycle progression.
- More
NP_001019969 ubiquitin-associated protein 2-like from Rattus norvegicus
Aligns to 515:546 / 1105 (2.9%), covers 94.3% of PF12478, 56.3 bits
NP_705693 ubiquitin-associated protein 2-like isoform 2 from Mus musculus
Aligns to 495:526 / 1067 (3.0%), covers 94.3% of PF12478, 56.3 bits
F8W726 Ubiquitin-associated protein 2-like from Homo sapiens
Aligns to 506:537 / 1079 (3.0%), covers 94.3% of PF12478, 56.3 bits
UBP2L_HUMAN / Q14157 Ubiquitin-associated protein 2-like; Protein NICE-4 from Homo sapiens (Human) (see 3 papers)
Aligns to 495:526 / 1087 (2.9%), covers 94.3% of PF12478, 56.3 bits
- function: Plays an important role in the activity of long-term repopulating hematopoietic stem cells (LT-HSCs). Required for efficient formation of stress granules (PubMed:29395067).
subunit: Interacts with BMI1 (PubMed:25185265). Part of a complex consisting of UBAP2L, BMI1 and RNF2(PubMed:25185265). - The human olfactory cleft mucus proteome and its age-related changes.
Yoshikawa, Scientific reports 2018 - “...1 P13693 19697 Translationally-controlled tumor protein 0.54 0.0061 4.9 0.3 2.8 0.1 3.8 0.1 2 Q14157 114579 Ubiquitin-associated protein 2-like 0.53 0.0082 0.2 0.0 0.0 0.0 0.1 0.0 3 Q8TD33 10578 Secretoglobin family 1C member 1 0.52 0.0085 5.0 0.2 0.0 0.0 2.5 0.1 4 P08185...”
- Methionine residues around phosphorylation sites are preferentially oxidized in vivo under stress conditions.
Veredas, Scientific reports 2017 - “...than 3 phosphosites was only 10%. Nevertheless, there exist proteins such as ubiquitin-associated protein 2-like (Q14157) and kinesin light chain 2 (Q9H0B6) which possess sulfoxidable methionines (M466 and M612, respectively) that are surrounded by up to 8 different phosphosites. To further strengthen the conclusion that the...”
- Generation of metastatic melanoma specific antibodies by affinity purification.
Schütz, Scientific reports 2016 - “...1.22% P11388 DNA topoisomerase 2-alpha TOP2A 2.42% P20930 Filaggrin FLG 1.60% Q8WZ42 Titin TTN 0.24% Q14157 Ubiquitin-associated protein 2-like UBAP2L 6.26% Q9UPU9 Protein Smaug homolog 1 SAMD4A 8.91% Q7Z333 Probable helicase senataxin SETX 2.05% Q5SYE7 NHS-like protein 1 NHSL1 3.54% Q9P212 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 PLCE1...”
- The role of O-GlcNAc signaling in the pathogenesis of diabetic retinopathy.
Semba, Proteomics. Clinical applications 2014 - “...nuclear mitotic apparatus protein 1 P12270 nucleoprotein TPR Q9P2N6 KAT8 regulatory NSL complex subunit 3 Q14157 ubiquitin-associated protein 2-like Q09666 neuroblast differentation-associated protein AHNAK Q96HC4 PDZ and LIM domain protein 5 P49792 E3 SUMO-protein ligase RanBP2 Q9Y520 protein PRRC2C P02545 prelamin-A/C Q8WWI1 LIM domain only protein...”
- Abacavir induces loading of novel self-peptides into HLA-B*57: 01: an autoimmune model for HLA-associated drug hypersensitivity.
Norcross, AIDS (London, England) 2012 - “...1097.547 2.2 P55209 Nucleosome assembly protein 1-like 1 ISQPASGNTF 50 13.24 511.2522 (2) 1021.495 2.2 Q14157 Ubiquitin-associated protein2-like ITAGAHRLW 60 21.68 342.1937 (3) 1024.569 2.1 O00767 Acyl-CoA desaturase VAKVGQYTF 60 18.65 506.7774 (2) 1012.546 1.3 Q86Y39 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 VTYKNVPNW 60...”
- Alternative 3'-end processing of long noncoding RNA initiates construction of nuclear paraspeckles.
Naganuma, The EMBO journal 2012 - SH3 domain-based phototrapping in living cells reveals Rho family GAP signaling complexes
Okada, Science signaling 2011 - “...WNK1 Q9H4A3 NATALELPGLPLSLPQPS 52 Controls junctional ion transport by inhibiting WNK4 Ubiquitin-associated protein 2like UBAP2L Q14157 YSIPFPTPTTPLTGRDGS 45 Phosphoribosylformylglycinamidine synthase PFAS O15067 FPKASVPREPGGPSPRVA 24 ARHGAP4 Diaphanous homolog 1 DIAPH1 O60610 LPGGTAIPPPPPLPGSAR 100 Formin. Actin nucleation and elongation Splicing factor 3B subunit 2 SF3B2 Q13435 LQPPPPPPPPPPGLGLGF 68...”
- Global analysis of TDP-43 interacting proteins reveals strong association with RNA splicing and translation machinery
Freibaum, Journal of proteome research 2010 - “...SNRPD2 14 P62316 3 2 16 2 1 8 1.5 Ubiquitin-associated protein 2-like UBAP2L 115 Q14157 3 2 2 2 1 1 1.5 26S proteasome non-ATPase regulatory subunit 2 PSMD2 100 Q13200 3 3 4 2 2 3 1.5 40S ribosomal protein S13 RPS13 17 P62277...”
- More
UBP2L_MOUSE / Q80X50 Ubiquitin-associated protein 2-like from Mus musculus (Mouse) (see paper)
Aligns to 515:546 / 1107 (2.9%), covers 94.3% of PF12478, 56.3 bits
NP_001076535 ubiquitin-associated protein 2-like from Danio rerio
Aligns to 534:565 / 1144 (2.8%), covers 94.3% of PF12478, 54.4 bits
- Deep RNA sequencing of the skeletal muscle transcriptome in swimming fish
Palstra, PloS one 2013 - “...(herpes virus-associated) [X. laevis] 537 NP_001121282 6.28E58 RefSeq W ubiquitin-associated protein 2-like [D. rerio] 520 NP_001076535 1.37E50 Drerio W ubiquitin-conjugating enzyme E2 E3 [D. rerio] 598 NP_957215 1.21E14 Drerio R, W ubiquitin-like modifier-activating enzyme 1 [D. rerio] 815 NP_998227 1.34E127 Drerio W ubiquitin-protein ligase E3A [D....”
K1RJ91 Ubiquitin-associated protein 2 from Crassostrea gigas
Aligns to 527:556 / 1396 (2.1%), covers 80.0% of PF12478, 44.7 bits
Or search for genetic data about PF12478 in the Fitness Browser
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory