Family Search for PF15054 (DUF4535)
PF15054 hits 8 sequences in PaperBLAST's database above the trusted cutoff. Showing all hits. Or show only hits to curated sequences or try another family.
AT2G35736 hypothetical protein from Arabidopsis thaliana
Aligns to 6:50 / 56 (80.4%), covers 100.0% of PF15054, 86.5 bits
- Genome-wide (ChIP-seq) identification of target genes regulated by WRKY33 during submergence stress in Arabidopsis
Zhang, BMC genomic data 2021 - “...showed the expression levels of these four genes were all regulated by WRKY33 transcription factor. At2G35736 gene was downregulated by WRKY33 while the other three genes At1G66810 , At2G47090 , and At3g12120 were upregulated by WRKY33 (Fig. 5 ). These results support that these four genes...”
- “...of genes containing the TC box in Col and WRKY33OE plants after submergence treatment. a AT2G35736 gene is downregulated by WRKY33 upon submergence treatment for 24h. b-d AT1G66810 , AT2G47090 and AT3G12120 genes are upregulated by WRKY33 upon submergence treatment for 24h. Three independent biological replicates...”
LOC4344693 uncharacterized protein LOC4344693 from Oryza sativa Japonica Group
Aligns to 7:51 / 77 (58.4%), covers 97.8% of PF15054, 72.4 bits
STMP1_DANRE / B3DFW5 Short transmembrane mitochondrial protein 1 from Danio rerio (Zebrafish) (Brachydanio rerio) (see paper)
NP_001289563 uncharacterized protein C7orf73 homolog from Danio rerio
Aligns to 4:44 / 46 (89.1%), covers 93.3% of PF15054, 42.1 bits
- function: Microprotein involved in mitochondrial respiratory chain complex III (ubiquinol-cytochrome c oxidoreductase) and complex IV (mitochondrial cytochrome c oxidase complex) assembly (By similarity). Required for the formation of mitochondrial supercomplexes (SCs) (By similarity). Also required for the activation of the NLRP3 inflammasome (By similarity).
disruption phenotype: Morpholino knockdown of the protein leads to various development defects, including smaller eye, abnormal head shape, malformations of the jaw, cardiac edema and a delayed yolk sac resorption (PubMed:23073385). Most animals die by 1 week of age (PubMed:23073385). - Functional prediction and physiological characterization of a novel short trans-membrane protein 1 as a subunit of mitochondrial respiratory complexes.
Zhang, Physiological genomics 2012 (PubMed)- GeneRIF: Data indicate that Stmp1 may have evolved to confer a new or complementary regulation of respiratory activities: [Stmp1]
LOC105615270 uncharacterized LOC131768270 homolog from Ovis aries
Aligns to 64:100 / 103 (35.9%), covers 75.6% of PF15054, 40.7 bits
- Genome Divergence and Dynamics in the Thin-Tailed Desert Sheep From Sudan
Abied, Frontiers in genetics 2021 - “...ROH XP-EHH _ CN_G2 9 LOC101121602 , 5S_rRNA , U6 , SRA1 , APBB3 , LOC105615270 , AO21 , AO45 , SLC35A4 , ENSOARG00000018230 22 49139142 49171418 0.032 ROH XP-EHH _ CN_G2 5 ENSOARG00000018230 , CD14 , TMCO6 , NDUFA2 , IK 23 49589412 49704569 0.115...”
STMP1_MOUSE / P0DP99 Short transmembrane mitochondrial protein 1; Mitochondrial micropeptide-47; Mm47; Protein mitolamban from Mus musculus (Mouse) (see 2 papers)
NP_001371164 short transmembrane mitochondrial protein 1 from Mus musculus
Aligns to 4:44 / 47 (87.2%), covers 97.8% of PF15054, 39.6 bits
- function: Microprotein involved in mitochondrial respiratory chain complex III (ubiquinol-cytochrome c oxidoreductase) and complex IV (mitochondrial cytochrome c oxidase complex) assembly (PubMed:35101990). Required for the formation of mitochondrial supercomplexes (SCs) (PubMed:35101990). Also required for the activation of the NLRP3 inflammasome (PubMed:31836654).
subunit: Interacts with components of the ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), such as UQCRC1/QCR1, UQCRC2/QCR2 and UQCR10/QCR9 (PubMed:35101990). Interacts with components of the cytochrome c oxidase (mitochondrial respiratory chain complex IV) complex, such as MT-CO2 (By similarity).
disruption phenotype: Mice were born at expected Mendelian ratios and do not show any visible phenotype, displaying normal heart function and cardiac dimensions (PubMed:35101990). Cells however display defects in complex III activity and metabolic perturbations in the heart, as well as altered complex III assembly into respiratory supercomplexes (PubMed:35101990). - Microproteins: Overlooked regulators of physiology and disease.
Hassel, iScience 2023 - “...Regulator of electron transport chain complex III assembly and function STMP1/C7orf73 47 E0CX11 Stmp1/1810058I24Rik 47 P0DP99 Mtln Regulator of fatty acid oxidation, lipid metabolism and respiratory chain activity MTLN 56 Q8NCU8 Mtln 56 Q8BT35 Myomerger/Myomixer Regulator of myoblast fusion MYMX 84 A0A1B0GTQ4 Mymx 84 Q2Q5T5 NEMEP...”
- The cardiac-enriched microprotein mitolamban regulates mitochondrial respiratory complex assembly and function in mice.
Makarewich, Proceedings of the National Academy of Sciences of the United States of America 2022 - GeneRIF: The cardiac-enriched microprotein mitolamban regulates mitochondrial respiratory complex assembly and function in mice.
- The mitochondrial micropeptide Stmp1 promotes retinal cell differentiation.
Zheng, Biochemical and biophysical research communications 2022 (PubMed)- GeneRIF: The mitochondrial micropeptide Stmp1 promotes retinal cell differentiation.
STMP1_HUMAN / E0CX11 Short transmembrane mitochondrial protein 1 from Homo sapiens (Human) (see 2 papers)
NP_001124401 short transmembrane mitochondrial protein 1 precursor from Homo sapiens
Aligns to 4:44 / 47 (87.2%), covers 97.8% of PF15054, 39.6 bits
- function: Microprotein involved in mitochondrial respiratory chain complex III (ubiquinol-cytochrome c oxidoreductase) and complex IV (mitochondrial cytochrome c oxidase complex) assembly (PubMed:35450818). Required for the formation of mitochondrial supercomplexes (SCs) (PubMed:35450818). Also required for the activation of the NLRP3 inflammasome (By similarity).
subunit: Interacts with components of the ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), such as UQCRC1/QCR1, UQCRC2/QCR2 and UQCR10/QCR9 (By similarity). Interacts with components of the cytochrome c oxidase (mitochondrial respiratory chain complex IV) complex, such as MT-CO2 (PubMed:35450818). - Coxiella burnetii Sterol-Modifying Protein Stmp1 Regulates Cholesterol in the Intracellular Niche.
Clemente, mBio 2022 - GeneRIF: Coxiella burnetii Sterol-Modifying Protein Stmp1 Regulates Cholesterol in the Intracellular Niche.
- Mitochondrial Micropeptide STMP1 Enhances Mitochondrial Fission to Promote Tumor Metastasis.
Xie, Cancer research 2022 (PubMed)- GeneRIF: Mitochondrial Micropeptide STMP1 Enhances Mitochondrial Fission to Promote Tumor Metastasis.
- Genetic regulatory mechanisms in human osteoclasts suggest a role for the STMP1 and DCSTAMP genes in Paget's disease of bone.
Mullin, Scientific reports 2019 - GeneRIF: Genetic regulatory mechanisms in human osteoclasts suggest a role for the STMP1 and DCSTAMP genes in Paget's disease of bone.
- Identification of membrane proteins by tandem mass spectrometry of protein ions.
Carroll, Proceedings of the National Academy of Sciences of the United States of America 2007 - GeneRIF: reports the identification by tandem mass spec of a novel protein, proteolipid with a mass of 5,283 Da, (PL-5283).
- Microproteins: Overlooked regulators of physiology and disease.
Hassel, iScience 2023 - “...35 C0HLV9 Mtlbn Regulator of electron transport chain complex III assembly and function STMP1/C7orf73 47 E0CX11 Stmp1/1810058I24Rik 47 P0DP99 Mtln Regulator of fatty acid oxidation, lipid metabolism and respiratory chain activity MTLN 56 Q8NCU8 Mtln 56 Q8BT35 Myomerger/Myomixer Regulator of myoblast fusion MYMX 84 A0A1B0GTQ4 Mymx...”
- Microproteins: a 3D protein structure prediction analysis
Thambu, Journal of biomolecular structure & dynamics 2022 - “...NA88-A P0C5K6 33 MSPPSSMCSPVPLLAAASGQNRMTQGQHFLQKV Sarcolipin Sarcolipin O00631 31 MGINTRELFLNFTIVLITVILMWLLVRSYQY Shorttransmem1 Short transmembrane mitochondrial protein 1 E0CX11 47 MLQFLLGFTLGNVVGMYLAQNYDIPNLAKKLEEIKKDLDAKKKPPSA Smallcyseine Small cysteine and glycine repeat-containing protein 10 A0A286YEX9 47 MGCCGCGGCGGRCSGGCGGGCGGGCGGGCGGGCGGCGGGCGSYTTCR smallintergal1 small integral membrane protein 38 A0A286YFK9 51 MTSWPGGSFGPDPLLALLVVILLARLILWSCLGTYIDYRLAQRRPQKPKQD Spermatidnuclear Spermatid nuclear transition protein 1 P09430 55...”
S35U4_HUMAN / L0R6Q1 SLC35A4 upstream open reading frame protein from Homo sapiens (Human) (see paper)
Aligns to 64:100 / 103 (35.9%), covers 68.9% of PF15054, 37.1 bits
NP_001182432 short transmembrane mitochondrial protein 1 isoform 1 precursor from Rattus norvegicus
Aligns to 4:55 / 58 (89.7%), covers 95.6% of PF15054, 30.9 bits
Or search for genetic data about PF15054 in the Fitness Browser
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory