Family Search for PF15831 (SMIM5_18_22)
April 2024: See Interactive Tools for Functional Annotation of Bacterial Genomes for advice on using these tools.
PF15831 hits 4 sequences in PaperBLAST's database above the trusted cutoff. Showing all hits. Or show only hits to curated sequences or try another family.
V9GXA9 Small integral membrane protein 22 from Mus musculus
Aligns to 10:65 / 86 (65.1%), covers 100.0% of PF15831, 93.9 bits
- Microproteins: Overlooked regulators of physiology and disease.
Hassel, iScience 2023 - “...Q8BTC1 CASIMO1 Regulator of cytoskeletal organization, cell migration and proliferation SMIM22 83 K7EJ46 Smim22 86 V9GXA9 CIP2A-BP Negative regulator of PI3K/AKT/NFkB pathway through interaction with CIP2A LINC00665 52 NR NR NR NR CYREN-1/MRI-1 Regulator of non-homologous end-joining CYREN 157 Q9BWK5-1 Cyren 157 Q8BHZ5 CYREN-2/MRI-2 Regulator of...”
SIM22_HUMAN / K7EJ46 Small integral membrane protein 22; Cancer-associated small integral membrane open reading frame 1 from Homo sapiens (Human) (see paper)
Aligns to 6:60 / 83 (66.3%), covers 94.6% of PF15831, 93.3 bits
- function: May modulate lipid droplet formation throught interaction with SQLE.
subunit: Interacts with CANX and DDOST (PubMed:29765154). Interacts with SQLE; this interaction modulates lipid droplet formation (PubMed:29765154). - Microproteins: Overlooked regulators of physiology and disease.
Hassel, iScience 2023 - “...Q69YU5 Uqcc6 67 Q8BTC1 CASIMO1 Regulator of cytoskeletal organization, cell migration and proliferation SMIM22 83 K7EJ46 Smim22 86 V9GXA9 CIP2A-BP Negative regulator of PI3K/AKT/NFkB pathway through interaction with CIP2A LINC00665 52 NR NR NR NR CYREN-1/MRI-1 Regulator of non-homologous end-joining CYREN 157 Q9BWK5-1 Cyren 157 Q8BHZ5...”
- Microproteins: a 3D protein structure prediction analysis
Thambu, Journal of biomolecular structure & dynamics 2022 - “...DCLGWFKSCDPKNDKCCKNYTCSRRDRWCKYDL Bmelanoma4 B melanoma antigen 4 Q86Y28 39 MAAGAVFLALSAQLLQARLMKEESPVVSWWLEPEDGTAL CAS1MOI Small integral membrane protein 22 K7EJ46 83 MAVSTEELEATVQEVLGRLKSHQFFQSTWDTVAFIVFLTFMGTVLLLLLLVVAHCCCCSSPGPRRESPRKERPKGVDNLALEP Conotoxin Conotoxin PIVE P0C2C5 24 DCCGVKLEMCHPCLCDNSCKNYGK DDIT3upstream DDIT3 upstream open reding frame P0DPQ6 34 MLKMSGWQRQSQNQSWNLRRECSRRKCIFIHHHT Dolichyl-diphoshool Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 P0C6T2 37 MITDVQLAIFANMLGVSLFLLVVLYHYVAVNNPKKQE DWORF Sarcoplasmic/endoplasmic reticulum calcium ATPase...”
E1BAR0 Small integral membrane protein 5 from Bos taurus
Aligns to 8:62 / 78 (70.5%), covers 100.0% of PF15831, 85.8 bits
Q71RC9 Small integral membrane protein 5 from Homo sapiens
Aligns to 8:62 / 77 (71.4%), covers 100.0% of PF15831, 84.8 bits
- Urinary proteome profiling for children with autism using data-independent acquisition proteomics.
Meng, Translational pediatrics 2021 - “...Guanine nucleotide-binding protein G(i) subunit alpha 0.4034 0.0018 Q9BRG1 Vacuolar protein-sorting-associated protein 25 0.4010 0.0080 Q71RC9 Small integral membrane protein 5 0.3969 0.0015 Q9UEF7 Klotho 0.3958 0.0094 P02649 Apolipoprotein E 0.3952 0.0094 ( 25 ) P05413 Fatty acid-binding protein, heart 0.3935 0.0037 ( 26 , 27...”
- Massive peptide sharing between viral and human proteomes
Kanduc, Peptides 2008 - “...Q5QPV6; Q9UHS2; Q9H6W3; Q8N930; Q6NSH2; Q2M2H8; Q5SR59; LY6E_HUMAN 27 Q8IY34; Q6XYE6; Q8IVW8; GCC1_HUMAN; LBH2_HUMAN; NEUU_HUMAN; Q71RC9; Q6P3S1; SC5A4_HUMAN; Q8WVS4; M3K2_HUMAN; Q4G186; Q572P5; CPNE8_HUMAN; ITM2B_HUMAN; Q6ZR04; Q6ZT02; TCP10_HUMAN; Q2HIZ2; Q86UC7; LRC24_HUMAN; Q3SX69; Q5JXA9; Q96CG5; Q5JZG9; MYO3B_HUMAN; Q15156; Q86TU2; Q9Y5L9; CG010_HUMAN; Q86VM9; Q5T932; Q8N7D3; SPG11_HUMAN; UB2V1_HUMAN; Q9Y2A3; BR44_HUMAN;...”
Or search for genetic data about PF15831 in the Fitness Browser
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory