Family Search for PF20521 (DUF6736)

PF20521 hits 5 sequences in PaperBLAST's database above the trusted cutoff. Showing all hits. Or show only hits to curated sequences or try another family.

FGSG_10549 hypothetical protein from Fusarium graminearum PH-1
Aligns to 29:159 / 178 (73.6%), covers 99.2% of PF20521, 160.2 bits

• The Fusarium graminearum genome reveals more secondary metabolite gene clusters and hints of horizontal gene transfer
  Sieber, PloS one 2014
  • “...7 FGSG_10547 related to multidrug resistance protein 8 FGSG_17387 probable type I polyketide synthase +1 FGSG_10549 conserved hypothetical protein C62 2 FGSG_10606 probable cytochrome-c peroxidase precursor 1 FGSG_10607 hypothetical protein 1 FGSG_10608 conserved hypothetical protein 2 FGSG_10609 related to 6-hydroxy-d-nicotine oxidase 3 FGSG_17400 related to cytochrome...”

FPRO_07048 uncharacterized protein from Fusarium proliferatum ET1
Aligns to 59:191 / 196 (67.9%), covers 89.1% of PF20521, 110.2 bits

• Secretome Profiling Reveals Virulence-Associated Proteins of Fusarium proliferatum during Interaction with Banana Fruit
  Li, Biomolecules 2019
  • “...FPRO_02717 2 26.4 S LFRTIASVAFLACASNVAAEPQPYKLVKAP CZR37404.1 uncharacterized protein FPRO_02336 1 19.7 S CZR37761.1 uncharacterized protein FPRO_07048 5 20.8 S CZR37893.1 uncharacterized protein FPRO_06916 3 9.5 S RSILHHCGKHASWDHAKSECVCHDSGKVYTKKHH CZR37952.1 uncharacterized protein FPRO_06857 2 25.8 T CZR38705.1 CAP20-virulence factor 6 20.3 P CZR39121.1 uncharacterized protein FPRO_05687 1 26....”

SNOG_04779 hypothetical protein from Parastagonospora nodorum SN15
Aligns to 38:146 / 163 (66.9%), covers 65.1% of PF20521, 79.3 bits

• Chromosome-level genome assembly and manually-curated proteome of model necrotroph Parastagonospora nodorum Sn15 reveals a genome-wide trove of candidate effector homologs, and redundancy of virulence-related functions within an accessory chromosome
  Bertazzoni, BMC genomics 2021
  • “...which may be involved in host surface penetration [ 76 ]. SNOG_02399, SNOG_03334, SNOG_40970, SNOG_08150, SNOG_04779 all encode for proteins with lipid interacting domains. SNOG_11842 encodes a Hce2 effector homolog - which is named after H omologs of C . fulvum E CP2, a necrosis inducing...”

CSS2_YEAST / P43600 Secreted protein CSS2; Condition specific secretion protein 2 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
Aligns to 104:213 / 232 (47.4%), covers 61.2% of PF20521, 35.1 bits

• ECOD domain classification of 48 whole proteomes from AlphaFold Structure Database using DPAM2.
  Schaeffer, PLoS computational biology 2024
  • “...we would generally convert these putative domains into ECOD representatives. The yeast-secreted protein CSS2 (UNP: P43600) belongs to Duf3676, which is limited to proteins from fungi and lacks an experimental structure representative. The CSS2 AF model adopts a circularly permuted - plait-like fold with an additional...”

YER076C Putative protein of unknown function; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies; analysis of HA-tagged protein suggests a membrane localization from Saccharomyces cerevisiae
Aligns to 147:277 / 302 (43.4%), covers 81.4% of PF20521, 31.7 bits

• Developmentally regulated internal transcription initiation during meiosis in budding yeast
  Zhou, PloS one 2017
  • “...No Plasma membrane ATP binding cassette transporter YDR490c PKH1 +1256112 No Yes Serine/threonine protein kinase YER076c +52692 Yes No Protein of unknown function YFR005c SAD1 +67145 Yes Yes Conserved zinc-finger domain protein involved in pre-mRNA splicing; essential YGL075c MPS2 +28626 Yes Ambiguous Essential membrane protein YHR082c...”
• Conservation of nucleosome positions in duplicated and orthologous gene pairs
  Nishida, TheScientificWorldJournal 2012
  • “...0.951565922 116167 + chr05 YER004W 0.956348638 0.987671859 159579 + chr05 YER026C 0.964952897 0.993875293 208473 chr05 YER076C 0.965398244 0.971982059 313494 chr05 YER083C 0.953185048 0.981521771 327027 chr05 YER094C 0.976027049 0.982595427 349342 chr05 YER095W 0.963423619 0.988752501 349976 + chr05 YER107C 0.982024941 0.98488468 374541 chr05 YER109C 0.969371754 0.986034001 377610 chr05...”
• Heterologous expression implicates a GATA factor in regulation of nitrogen metabolic genes and ion homeostasis in the halotolerant yeast Debaryomyces hansenii
  García-Salcedo, Eukaryotic cell 2006
  • “...SAS10, SPL2, UTP20 Unknown YOL036w, YKR075c, YER067w, YER076c, YJR115w, FMP48, FMP43, YGR269w, YJL084C, PRM10 GATA TRANSCRIPTION FACTOR FROM D. HANSENII VOL....”
• Yeast Upf proteins required for RNA surveillance affect global expression of the yeast transcriptome
  Lelivelt, Molecular and cellular biology 1999
  • “...YCR096c YFL057C YNL270C YKL071W YIR031C YER180C YFL020C YER076c YER187w YER188w YFL061W YLL060c YLL064c YCR039c YCL067c YKR061W YLR461W YDR210W YBL113C YLL025w...”

Or search for genetic data about PF20521 in the Fitness Browser