PaperBLAST
PaperBLAST Hits for tr|A0A1X9Z948|A0A1X9Z948_9SPHI MFS transporter OS=Sphingobacteriaceae bacterium GW460-11-11-14-LB5 OX=1986952 GN=CA265_19855 PE=4 SV=1 (479 a.a., MNQPKTSKYR...)
Show query sequence
>tr|A0A1X9Z948|A0A1X9Z948_9SPHI MFS transporter OS=Sphingobacteriaceae bacterium GW460-11-11-14-LB5 OX=1986952 GN=CA265_19855 PE=4 SV=1
MNQPKTSKYRWTICLLLFLATTINYLDRQVLSLTWTDFIKPEFHWDNNDYGNITALFSIF
YAISMLFAGRFVDKMDTKKGFLWAIGVWSVGACLHAFCGIATAGIINGNWFVGFEGAKDV
IARVNDTGLIVSVSVTLFIFARFVLAVGEAGNFPAAIKATAEYFPKKDRAFATSIFNAGA
TVGALAAPITIPFIAKAYGWEMAFIIIGALGFVWMGLWIFVYNKPELHKRVSPEELAYIQ
QDVINDRKLADYVEETKEKVSFIDCFKYKQTWAFAFGKFMTDGVWWFFLFWTPAYLKSVY
GMDSTQSALPLFVLYMITLLSIIGGWLPTYFVDKKGMNPYEGRMKAMLIFAFFPLLALAA
QPLGHITYWIPVIIIGIAGAAHQAWSANIFSTVGDMFPKKAIATITGIGGMAGGLGSFII
NKGSGLLFDYTGKNEIVFMGFKGEEAGYFIIFSICAVCYLIGWTVMKTLVPKYKVIELK
Running BLASTp...
Found 242 similar proteins in the literature:
CA265_RS19855 D-galacturonate transporter ExuT from Pedobacter sp. GW460-11-11-14-LB5
100% identity, 100% coverage
- mutant phenotype: Specifically important for D-galacturonate utilization.
BT4105 D-galacturonate transporter ExuT from Bacteroides thetaiotaomicron VPI-5482
62% identity, 95% coverage
- mutant phenotype: Specifically important for D-galacturonate utilization. Also important for utilization of galacturonate-containing polysaccharides polygalacturonate and rhamnogalacturonan from potato, and probably important for pectin utilization as well
Pf1N1B4_5129 D-galacturonate transporter ExuT from Pseudomonas fluorescens FW300-N1B4
53% identity, 99% coverage
- mutant phenotype: Specifically important for D-galacturonate utilization.
XCV4361 tRNA-Leu from Xanthomonas campestris pv. vesicatoria str. 85-10
37% identity, 99% coverage
- Modularization of the type II secretion gene cluster from Xanthomonas euvesicatoria facilitates the identification of a structurally conserved XpsCLM assembly platform complex
Goll, PLoS pathogens 2025 - “...and ligase in acut/ligation reaction. The resulting modules were assembled with the promoter of gene XCV4361 in vector pBRM-P by Golden Gate cloning, thus generating construct pB-PxpsD ( S1 Table ). Generation of the modular xps- T2S gene cluster by Golden Gate cloning The xps- T2S...”
- “...( xpsD ) with or without an expression construct encoding XpsD-c-Myc under control of the XCV4361 promoter were inoculated into leaves of susceptible ECW (Early Cal Wonder) pepper plants. Disease symptoms were photographed 7 dpi. Dashed lines indicate the infiltrated areas. For the analysis of extracellular...”
- Functional characterization of VirB/VirD4 and Icm/Dot type IV secretion systems from the plant-pathogenic bacterium Xanthomonas euvesicatoria
Drehkopf, Frontiers in cellular and infection microbiology 2023 - “...an N-terminal 3 c-Myc epitope-encoding sequence. To generate the traI expression construct, the promoter of XCV4361 , the 3 c-Myc epitope-encoding sequence and traI were amplified by PCR. Primer sequences introduced Bsa I restriction sites with matching overhangs. When compared with the lac promoter, the promoter...”
- Xanthomonas campestris pv. vesicatoria Secretes Proteases and Xylanases via the Xps Type II Secretion System and Outer Membrane Vesicles
Solé, Journal of bacteriology 2015 - “...494-bp fragment spanning the predicted promoter of XCV4361 into pBRM-P in a single restriction/ligation reaction. Alternatively, XCV3671, XCV4358, and XCV4360...”
- “...vector pLAND-P downstream of the predicted promoter of XCV4361 by using BsaI and ligase. To obtain an expression construct encoding XCV05362-29- cMyc, the...”
XAC4255 hexuranate transporter from Xanthomonas axonopodis pv. citri str. 306
37% identity, 96% coverage
PFL_5388 major facilitator family transporter from Pseudomonas fluorescens Pf-5
33% identity, 97% coverage
PP2604 major facilitator family transporter from Pseudomonas putida KT2440
34% identity, 97% coverage
- Benzoxazinoids in root exudates of maize attract Pseudomonas putida to the rhizosphere
Neal, PloS one 2012 - “...genes that have been associated with bacterial chemotaxis (PP4340 and PP4888), and a third gene (PP2604) with a putative function in DIMBOA transport ( Table S1 ). The DIMBOA-responsive gene cheY (PP4340) is a chemotactic response regulator in bacteria [45] . Furthermore, benzoate chemotaxis in P....”
- “...[46] . Our transcriptome analysis identified the M-ACT homologue PP4888, and two genes, PP2241 and PP2604, belonging to the Major Facilitator Superfamily (MFS) of AAHS transporters [47] . Of the two latter genes, only PP2604 shares common features with pcaK (STRING v.9 database) [48] . On...”
Q9I6P7 Probable major facilitator superfamily (MFS) transporter from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
PA0241 probable major facilitator superfamily (MFS) transporter from Pseudomonas aeruginosa PAO1
33% identity, 98% coverage
- Proteome-wide identification of druggable targets and inhibitors for multidrug-resistant <i>Pseudomonas aeruginosa</i> using an integrative subtractive proteomics and virtual screening approach
Vemula, Heliyon 2025 - “...2849 Q9HVU8 3931 Q9I0Z7 5013 Q9I6P5 686 Q9HWG0 1768 Q9I032 2850 Q9HVU9 3932 Q9I0Z8 5014 Q9I6P7 687 Q9HWG3 1769 Q9I033 2851 Q9HVV0 3933 Q9I0Z9 5015 Q9I6P8 688 Q9HWH8 1770 Q9I034 2852 Q9HVV1 3934 Q9I100 5016 Q9I6P9 689 Q9HWI0 1771 Q9I035 2853 Q9HVW1 3935 Q9I103 5017 Q9I6Q0...”
- Genomic variations in polymyxin-resistant Pseudomonas aeruginosa clinical isolates and their effects on polymyxin resistance
Liang, Brazilian journal of microbiology : [publication of the Brazilian Society for Microbiology] 2023 - “...all drug-resistant isolates, while the indels in genes PA0241, PA1297, and PA2065 were shared by three isolates. In particular, a highimpact variant was...”
- High-throughput detection of RNA processing in bacteria
Gill, BMC genomics 2018 - “...pant487 Not identified None 1 5 5,986,1865,986,427 PA5316.2 242 pant488 PA14sr_154 PA1302, PA2933, gcp , PA0241, PA0364, pilJ , hsiC2 , PA2325, PA3037, rnhB , pchF , recD , algP 7 2 1 RsmY and PrrF12, included as controls, were previously known to be up-regulated during...”
GFO_1159 major facilitator superfamily permease-possibl y hexuronate/hexarate transporter from Gramella forsetii KT0803
30% identity, 87% coverage
SEN2977 hexuronate transporter from Salmonella enterica subsp. enterica serovar Enteritidis str. P125109
STM3134 putative permease from Salmonella typhimurium LT2
27% identity, 89% coverage
- Genomic organization and role of SPI-13 in nutritional fitness of Salmonella
Elder, International journal of medical microbiology : IJMM 2018 (PubMed)- “...3.0 ( Yu et al., 2010 ) analysis showed that SEN2977 is a cytoplasmic membrane protein that shares 46% similarity with ExuT from E. coli str. K-12 substr....”
- “...to DGA ( Law et al., 2008 ), suggesting that SEN2977 likely contributes to the transport of DGA from the periplasm to the cytoplasm of S . Enteritidis....”
- Differential roles for pathogenicity islands SPI-13 and SPI-8 in the interaction of Salmonella Enteritidis and Salmonella Typhi with murine and human macrophages
Espinoza, Biological research 2017 - “...do not agree with a recent study showing that deletion of SPI-13 (genes SEN2960 to SEN2977 ) resulted in increased uptake and impaired survival of S . Enteritidis in RAW264.7 macrophages [ 20 ]. The discrepancies between results from both studies may be due to differences...”
- “...Regarding this last point, the function of S . Enteritidis genes in the SEN2967 - SEN2977 region (not included in our analysis) has been recently predicted and some of them may be required for intracellular survival in macrophages. For instance, SEN2973 encodes the antiadaptor protein IraD,...”
- The Salmonella pathogenicity island 13 contributes to pathogenesis in streptomycin pre-treated mice but not in day-old chickens
Elder, Gut pathogens 2016 - “...in which insertion mutations in seven SPI-13 genes ( SEN2961 SEN2964 , SEN2972 , SEN2976 SEN2977 ) resulted in negative selection in intra-peritoneally inoculated mice [ 11 ]. It is important to note that the negative selection of a mutant during such large-scale in vivo screening...”
- “...metabolism of aromatic monoamines or related molecules such as itaconate and the last gene ( SEN2977 ) is a putative hexuronate transporter which is likely involved in uptake or hexuronate, suggesting that SPI-13 is likely involved in metabolism of multiple metabolic substrates. Although intriguing, it is...”
- The Salmonella enterica serovar Typhimurium virulence factor STM3169 is a hexuronic acid binding protein component of a TRAP transporter
Herman, Microbiology (Reading, England) 2020 - “...MFS transporter ExuT [ 21 ]. The presence of homologues of UxuABC (STM3135STM3137) with ExuT (STM3134) in S . Typhimurium (Fig. S1b) suggests its ability to catabolize this sugar. Additionally, this pattern of co-occurrence is found in other genomes represented in MicrobesOnline [ 22 ], suggesting...”
- “...forms part of a functioning TRAP transporter that functions alongside the putative UhpC/ExuT hexuronate transporter (STM3134) that is divergently transcribed from the uxuABC genes ( stm3135stm3137 ). After transport, the bacterium would use the UxuABC proteins and the enzymes of the EntnerDoudoroff pathway to convert d...”
K5CN36 Major facilitator superfamily (MFS) profile domain-containing protein from Bacteroides finegoldii CL09T03C10
27% identity, 89% coverage
HSERO_RS23010 D-galacturonate transporter ExuT from Herbaspirillum seropedicae SmR1
27% identity, 87% coverage
- mutant phenotype: Specifically important for D-galacturonate utilization.
KPN_03521 hexuronate transport protein (MFS family) from Klebsiella pneumoniae subsp. pneumoniae MGH 78578
28% identity, 97% coverage
TC 2.A.1.14.2 / P0AA78 Hexuronate (glucuronate; galacturonate) porter, ExuT (Nemoz et al. 1976). It also transports D-glucose (HJ Kim et al., Front. Microbiol., 23 January 2020) from Escherichia coli (see 3 papers)
b3093 hexuronate transporter from Escherichia coli str. K-12 substr. MG1655
28% identity, 99% coverage
- substrates: Galacturonate, glucuronate
- A Novel Quality Measure and Correction Procedure for the Annotation of Microbial Translation Initiation Sites
Overmars, PloS one 2015 - “...been adjusted (b0259, b0552, b0656, b1994, b2030, b2192, b3218, b3505, b4543, b2803, b1331, b2982 and b3093). The adaptations were compared to the PCA-based and Prodigal-based predictions. Annotation consistency a Total Verified set Ecogene Adjusted Ecogene adjustment RefSeq = PCA = Prodigal 83% (3418) 88.4% (811) 1...”
- DNA microarray analyses of the long-term adaptive response of Escherichia coli to acetate and propionate
Polen, Applied and environmental microbiology 2003 - “...subunit Evolved -D-galactosidase, beta subunit 0.39* 0.55 0.52 b3093 exuT 2 Transport of hexuronates 0.32* 0.48* 0.58 b3112 b3113 b3114 b3115 b3116 b3117 b3118...”
ExuT / b3093 hexuronate transporter from Escherichia coli K-12 substr. MG1655 (see 5 papers)
exuT / P0AA78 hexuronate transporter from Escherichia coli (strain K12) (see 3 papers)
EXUT_ECOLI / P0AA78 Hexuronate transporter; Aldohexuronate transport system from Escherichia coli (strain K12) (see 5 papers)
28% identity, 99% coverage
- function: Transport of aldohexuronates such as D-glucuronate and D- galacturonate (PubMed:6343797, PubMed:783117). Under anaerobic conditions, can play a critical role as a D-glucose transporter in the absence of sugar-PTS system (PubMed:32038601).
catalytic activity: aldehydo-D-glucuronate(in) + H(+)(in) = aldehydo-D- glucuronate(out) + H(+)(out) (RHEA:28955)
catalytic activity: aldehydo-D-galacturonate(out) + H(+)(out) = aldehydo-D- galacturonate(in) + H(+)(in) (RHEA:29295)
catalytic activity: D-glucose(out) + H(+)(out) = D-glucose(in) + H(+)(in) (RHEA:69556)
disruption phenotype: Mutant is unable to grow on either glucuronate or galacturonate, but is able to grow on fructuronate or tagaturonate. - Regulation of alginate catabolism involves a GntR family repressor in the marine flavobacterium Zobellia galactanivorans DsijT
Dudek, Nucleic acids research 2020 - “...ExuT2 from Z. galactanivorans is the hexuronate transporter ExuT from E. coli K-12 (Uniprot accession P0AA78, 31% sequence identity), which imports glucuronate, galacturonate and glucose into the cytoplasm ( 80 , 81 ). The apparent in vitro interaction of trisaccharides MM and MG with AusR might...”
VK055_0865 MFS transporter from Klebsiella pneumoniae subsp. pneumoniae
28% identity, 87% coverage
- A systematic analysis of hypermucoviscosity and capsule reveals distinct and overlapping genes that impact Klebsiella pneumoniae fitness
Mike, PLoS pathogens 2021 - “...2 , 3B and 3C ). The ten transporters identified include five sugar transporters ( VK055_0865 , VK055_2628 , VK055_3270 , xylH , VK055_1895 ), a C4-dicarboxylate transporter ( dctA ), two amino acid transporters ( VK055_1956 and VK055_2661 ), a nucleoside transporter ( VK055_4768 ),...”
BCAM1289 Major Facilitator Superfamily protein from Burkholderia cenocepacia J2315
27% identity, 97% coverage
YPO0577 ExuT transport protein from Yersinia pestis CO92
YPTB3479 ExuT transport protein, MFS Superfamily. from Yersinia pseudotuberculosis IP 32953
26% identity, 97% coverage
RSc1080 PUTATIVE HEXURONATE TRANSPORTER TRANSMEMBRANE PROTEIN from Ralstonia solanacearum GMI1000
29% identity, 88% coverage
c5298 Hexuronate transporter from Escherichia coli CFT073
25% identity, 87% coverage
ECA1967 putative hexuronate transporter from Erwinia carotovora subsp. atroseptica SCRI1043
28% identity, 90% coverage
UM146_RS22065 MFS transporter from Escherichia coli UM146
25% identity, 86% coverage
YP3544 putative sugar transporter from Yersinia pestis biovar Medievalis str. 91001
27% identity, 94% coverage
YPK_0978 major facilitator transporter from Yersinia pseudotuberculosis YPIII
YPTB3092 putative MFS superfamily hexuronate transporter from Yersinia pseudotuberculosis IP 32953
27% identity, 94% coverage
- Genome-Scale Mapping Reveals Complex Regulatory Activities of RpoN in Yersinia pseudotuberculosis
Mahmud, mSystems 2020 - “...+ 10.1 54,24,38 YPK_0933 168, 172 IrGAs6 1099750 2.8 NA NA CCGGCATGCATCATGCAC + 9.39 24,54,38 YPK_0978 YPK_0979 8, 159 IrGAs7 1204307 2.5 NA NA TTGGTACAGTTTTTTCCA 9.45 54,32,28 YPK_1066 YPK_1065 109, 112 IrGAs8 1265403 12.0 7.4 8.0 TTGGCATGCATATTGCGC 10.9 38,54,24,32,70 YPK_1125 YPK_1126 27, 4, 8, 21 IrGAs9...”
- A selC-associated genomic island of the extraintestinal avian pathogenic Escherichia coli strain BEN2908 is involved in carbohydrate uptake and virulence
Chouikha, Journal of bacteriology 2006 - “...Not present C4494 (100) SSO_0801 (94) ECA1967 (89) YPTB3092 (85) YP00847 (85) Y3232 (85) YP3544 (85) Bcepa03004976 (62) RSc1080 (62) C4496 and C4495 (99)...”
P37489 Uncharacterized transporter YybO from Bacillus subtilis (strain 168)
26% identity, 96% coverage
- Major facilitator superfamily
Pao, Microbiology and molecular biology reviews : MMBR 1998 - “...435 P42609 P42237 P42205 Z37980 U29581 Q05181 U25634 U32375 P42613 P31457 P37489 SP SP SP GB GB SP GB GB SP SP SP C11D3.18c Spo Dal5 Sce L0578 Sce Yal0670 Sce...”
EXUT_DICCH / P94774 Galacturonate transporter from Dickeya chrysanthemi (Pectobacterium chrysanthemi) (Erwinia chrysanthemi) (see 3 papers)
TC 2.A.1.14.41 / P94774 The Aldohexuronate (glucuronate, galacturonate) uptake porter from Dickeya chrysanthemi
exuT / AAB70881.1 exuT from Dickeya chrysanthemi (see paper)
27% identity, 68% coverage
- function: Transport of D-galacturonate (PubMed:8320243, Ref.1). Cannot transport the dimer digalacturonic acid (PubMed:8320243). Uptake is an active process (PubMed:8320243).
catalytic activity: aldehydo-D-galacturonate(out) + H(+)(out) = aldehydo-D- galacturonate(in) + H(+)(in) (RHEA:29295)
disruption phenotype: Mutation of the gene causes a reduction in growth on D-galacturonate and maceration of potato tuber tissue. - substrates: Galacturonate, glucuronate
TC 2.A.1.14.14 / Q8FDB7 Probable D-galactarate (glucarate?):H+ symporter, GarP or YhaU from Escherichia coli O6 (see paper)
28% identity, 71% coverage
- substrates: D-galactarate, Galactarate, Glycerate, H+
tcdb comment: May also function as a glucarate:glycerate antiporter (Moraes and Reithmeier 2012) and a glucose transporter. This sequence is incomplete
B1LFM8 Galactarate permease GarP from Escherichia coli (strain SMS-3-5 / SECEC)
28% identity, 71% coverage
GarP / b3127 galactarate/D-glucarate transporter GarP from Escherichia coli K-12 substr. MG1655 (see 6 papers)
garP / P0AA80 galactarate/D-glucarate transporter GarP from Escherichia coli (strain K12) (see 5 papers)
GARP_ECOLI / P0AA80 Probable galactarate/D-glucarate transporter GarP from Escherichia coli (strain K12) (see 2 papers)
ETEC_3393 galactarate/glucarate/glycerate transporter GarP from Escherichia coli ETEC H10407
b3127 predicted (D)-galactarate transporter from Escherichia coli str. K-12 substr. MG1655
28% identity, 71% coverage
- function: Probably involved in the uptake of galactarate and/or D- glucarate (Probable). May also transport D-glycerate (Probable).
catalytic activity: galactarate(in) + H(+)(in) = galactarate(out) + H(+)(out) (RHEA:28478)
catalytic activity: D-glucarate(in) + H(+)(in) = D-glucarate(out) + H(+)(out) (RHEA:28474)
catalytic activity: (R)-glycerate(in) + H(+)(in) = (R)-glycerate(out) + H(+)(out) (RHEA:70927) - The molecular basis for control of ETEC enterotoxin expression in response to environment and host
Haycocks, PLoS pathogens 2015 - “...G ETEC_3362 uxaC 3642302 CT TGA AGTGGG TCACA (ETEC_3372) (yqjG) 3665634 TGTGA TCAATG TCA AT ETEC_3393 / ETEC_3394 garP / garD TGTG CTTTAGCG C G CA 3721308 G GTGA TTGATG TCAC C ( ETEC_3446 ) ( greA ) 3785700 CG TG GGTCGCA TCACA (ETEC_3510) (mreC) 3878729...”
- Genome-Wide Screens Identify Genes Responsible for Intrinsic Boric Acid Resistance in Escherichia coli
Çöl, Biological trace element research 2024 - “...]. Biologically, it is classified within the scope of anion and transmembrane transport. GarP (UniProt P0AA80) is located in the inner membrane of the cell and contains 12 transmembrane domains. A study investigated the genes required for the intrinsic multidrug resistance of E. coli and identified...”
- Characterization and potential mechanisms of highly antibiotic tolerant VBNC Escherichia coli induced by low level chlorination
Ye, Scientific reports 2020 - “...and silver-binding protein efflux 48 b0572 cusC copper/silver efflux system, outer membrane component efflux 49 b3127 garP putative (D)-galactarate transporter efflux 30 Conclusion From the morphology and based on transcriptomic analysis, we investigated the regulation of gene expression of VBNC cells induced by a low chlorine...”
- Genome-scale analysis of escherichia coli FNR reveals complex features of transcription factor binding
Myers, PLoS genetics 2013 - “...b1658 Hypoxanthine Transcriptional Repressor [159] , [160] 3150150 exbB b3006 Iron-Siderophore Transport [152] 3273150 garP b3127 Galactarate/Glucarate/Glycerate Transporter [152] , [160] 3538050 feoA b3408 Ferrous Iron Transport [59] a Genomic location within each FNR ChIP-seq peak with the highest read count (the summit of the peak)....”
- Human body temperature (37degrees C) increases the expression of iron, carbohydrate, and amino acid utilization genes in Escherichia coli K-12
White-Ziegler, Journal of bacteriology 2007 - “...(D)-galactarate dehydrogenase b3126 Alpha-dehydro-beta-deoxy-D-glucarate aldolase b3127 Putative transport protein b4036 Maltoporin, high-affinity receptor for...”
- Genome-wide analyses of Escherichia coli gene expression responsive to the BaeSR two-component regulatory system
Nishino, Journal of bacteriology 2005 - “...heat shock protein Small heat shock protein garP (yhaU) gsp b3127 b2988 malM lamB yfjB yieI mdtC (yegO) tsr baeS tolC yieJ phoB elaA yghU cheM (tar) fliC garD...”
- Differential gene expression for investigation of Escherichia coli biofilm inhibition by plant extract ursolic acid
Ren, Applied and environmental microbiology 2005 - “...hdeB b3509 yeeD b2012 yeeE b2013 yjeB b4178 ybhG b0795 yhaU b3127 1.7 1.5 1.8 1.5 5.6 1.5 1.7 1.8 2.3 12.6 1.4 1.4 1.9 0.0420 0.0435 0.0092 0.0315 0.0029 0.0114...”
SEN1434 putative hexonate sugar transport protein from Salmonella enterica subsp. enterica serovar Enteritidis str. P125109
26% identity, 87% coverage
MAKP3_04830 MFS transporter from Klebsiella pneumoniae subsp. pneumoniae
29% identity, 81% coverage
PP1710 MFS transporter, phthalate permease family from Pseudomonas putida KT2440
24% identity, 91% coverage
KPN_04094 D-galactonate transport from Klebsiella pneumoniae subsp. pneumoniae MGH 78578
24% identity, 87% coverage
SAUU_CUPNH / Q0K843 Probable sulfoacetate transporter SauU from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see paper)
H16_A2749 MFS transporter, ACS family from Ralstonia eutropha H16
WP_011615811 MFS transporter from Cupriavidus necator
27% identity, 62% coverage
- function: May transport sulfoacetate into the cell.
disruption phenotype: Mutants do not grow with sulfoacetate, but can use acetate, taurine, isethionate and sulfoacetaldehyde. Mutants are also unable to induce expression of the sau cluster. - Sulfoacetate is degraded via a novel pathway involving sulfoacetyl-CoA and sulfoacetaldehyde in Cupriavidus necator H16
Weinitschke, The Journal of biological chemistry 2010 - “...involved a four-gene cluster (sauRSTU; H16_A2746 to H16_A2749). The sauR gene, divergently orientated to the other three genes, probably encodes the...”
- “...of the sauRSTU cluster are H16_A2746 (sauR) to H16_A2749 (sauU). CM, cytoplasmic membrane. was annotated as encoding an acyl-CoA ligase and a NAD(P)coupled...”
- Sulfoacetate is degraded via a novel pathway involving sulfoacetyl-CoA and sulfoacetaldehyde in Cupriavidus necator H16.
Weinitschke, The Journal of biological chemistry 2010 - GeneRIF: Data conformed that hypothesis that the inducible pathway, which initiates sau (sulfoacetate utilization), involved a four-gene cluster (sauRSTU; H16_A2746 to H16_A2749) in sulfoacetate degradatioin pathway.
SL1344_2943, STM14_3570 galactarate/glucarate/glycerate transporter GudP from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
STM2962 putative MFS superfamily, D-glucarate permease from Salmonella typhimurium LT2
28% identity, 69% coverage
GudP / b2789 galactarate/D-glucarate transporter GudP from Escherichia coli K-12 substr. MG1655 (see 5 papers)
gudP / Q46916 galactarate/D-glucarate transporter GudP from Escherichia coli (strain K12) (see 5 papers)
GUDP_ECOLI / Q46916 Probable galactarate/D-glucarate transporter GudP from Escherichia coli (strain K12) (see 2 papers)
TC 2.A.1.14.40 / C4ZZU4 Glucarate transporter, GudP. Encoded in an operon with GudD, a glucarate dehydratase from Escherichia coli (strain K12 / MC4100 / BW2952)
b2789 predicted D-glucarate transporter from Escherichia coli str. K-12 substr. MG1655
28% identity, 69% coverage
- function: Probably involved in the uptake of galactarate and/or D- glucarate (Probable). May also transport D-glycerate (Probable).
catalytic activity: galactarate(in) + H(+)(in) = galactarate(out) + H(+)(out) (RHEA:28478)
catalytic activity: D-glucarate(in) + H(+)(in) = D-glucarate(out) + H(+)(out) (RHEA:28474)
catalytic activity: (R)-glycerate(in) + H(+)(in) = (R)-glycerate(out) + H(+)(out) (RHEA:70927) - substrates: Glucarate
- Multiple routes for non-physiological l-threonine uptake in <i>Escherichia coli</i> K-12
Bubnov, Frontiers in microbiology 2025 (no snippet) - Differential gene expression for investigation of Escherichia coli biofilm inhibition by plant extract ursolic acid
Ren, Applied and environmental microbiology 2005 - “...acid Gene b no. 10 g/ml ER Genes with known functions arsC b2789 P 30 g/ml ER P 1.5 0.0446 1.4 0.0143 1.9 0.0557 2.5 0.0377 cspF cspG b1558 b0990 1.6 0.0033 1.1...”
- “...February 11, 2017 by University of California, Berkeley b3503 b2789 Furanone VOL. 71, 2005 E. COLI BIOFILM INHIBITION BY URSOLIC ACID 4031 not through the...”
- A common regulator for the operons encoding the enzymes involved in D-galactarate, D-glucarate, and D-glycerate utilization in Escherichia coli
Monterrubio, Journal of bacteriology 2000 - “...(proposed name, garD), yhaU (proposed name, garP), and b2789 (proposed name, gudP) (Fig. 1). A garP::Tn5 insertion mutant (strain JA175) was obtained from...”
- “...that encode a putative D-glucarate permease (b2789), a nonfunctional D-glucarate dehydratase-related protein (b2788), and the functional D-glucarate dehydratase...”
ECs5316 putative transport protein from Escherichia coli O157:H7 str. Sakai
24% identity, 82% coverage
Pden_1011 major facilitator superfamily MFS_1 from Paracoccus denitrificans PD1222
25% identity, 90% coverage
GUDP_BACSU / P42237 Probable galactarate/D-glucarate transporter GudP from Bacillus subtilis (strain 168) (see paper)
TC 2.A.1.14.1 / P42237 Glucarate porter from Bacillus subtilis (see 3 papers)
25% identity, 70% coverage
STM1543 putative transport protein from Salmonella typhimurium LT2
30% identity, 67% coverage
- Evolution of Variable Number Tandem Repeats and Its Relationship with Genomic Diversity in Salmonella Typhimurium
Fu, Frontiers in microbiology 2016 - “...one nsSNP in adrA among 4 isolates (L2175, L2178, L2180, and L2184), one nsSNP in STM1543 among 6 isolates (L2169, L2174, L2175, L2178, L2180, and L2184) and one nsSNP in iroC between 2 isolates (L2179 and L2182). One nsSNP in ccmH was present in all 2-15-8-10-212...”
- “...adrA encoding diguanylate cyclase plays a role in biofilm formation (Garca et al., 2004 ), STM1543 is involved in swarming motility and virulence (Bogomolnaya et al., 2014 ), while iroC is involved in iron acquisition (Crouch et al., 2008 ). Table 4 Non-synonymous SNPs in the...”
- Identification of novel factors involved in modulating motility of Salmonella enterica serotype typhimurium
Bogomolnaya, PloS one 2014 - “..., yibR, rfaP , STM3783, STM4216,STM4219, sRNA candidate C1023 STM0056, STM0362, STM1131, pagC, STM1254, STM1258, STM1543, srfC, STM1632, STM1856, STM1926, STM1958, STM2303, STM2508, ygaU, STM3125, lpfE , STM3944, STM4030.S, STM4197, STM4204, STM4529, STM4574, STM4599, invR *Based on COGs (Clusters of Orthologous Groups of protein). **Mutants with...”
- Salmonella serovar identification using PCR-based detection of gene presence and absence
Arrach, Journal of clinical microbiology 2008 - “...STM1380, STM1381, STM1525, STM1533, STM1537, STM1540, STM1543, STM1554, STM1557, STM1559, STM1561, STM1577, STM1582, STM1614, STM1615, STM1625, STM1630,...”
PS417_04205 D-galacturonate transporter (MFS superfamily) from Pseudomonas simiae WCS417
26% identity, 68% coverage
- mutant phenotype: Specific phenotype on galacturonate. This phenotype is conserved. There is also another putative hexuronate transporter that has a weaker phenotype on galacturonate (PS417_14775).
Z4105 putative transport protein from Escherichia coli O157:H7 EDL933
28% identity, 69% coverage
STM3827 MFS family, D-galactonate transport protein from Salmonella typhimurium LT2
SC3744 MFS family, D-galactonate transport protein from Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67
24% identity, 86% coverage
YidT / b3691 D-galactonate:H+ symporter from Escherichia coli K-12 substr. MG1655 (see 9 papers)
dgoT / P0AA76 D-galactonate:H+ symporter from Escherichia coli (strain K12) (see 11 papers)
DGOT_ECOLI / P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see 4 papers)
TC 2.A.1.14.7 / P0AA76 Galactonate transporter from Escherichia coli (see 4 papers)
b3691 D-galactonate transport from Escherichia coli str. K-12 substr. MG1655
23% identity, 88% coverage
- function: Involved in D-galactonate metabolism (PubMed:211976, PubMed:30455279). Catalyzes the proton-dependent uptake of galactonate into the cell (PubMed:31083648).
catalytic activity: D-galactonate(in) + H(+)(in) = D-galactonate(out) + H(+)(out) (RHEA:29835)
disruption phenotype: Deletion mutant cannot grow on D-galactonate. - substrates: Galactonate, Galactonates
- Analysis of promoter targets for Escherichia coli transcription elongation factor GreA in vivo and in vitro
Stepanova, Journal of bacteriology 2007 - “...b3661 1.8 1.6 Cytoplasmic membrane lipoprotein 28 c dgoT b3691 1.7 1.6 D-Galactonate tnaL tnaA tnaB b3707 b3708 b3709 3.4 2.2 1.7 4.2 1.5 2 Tryptophanase leader...”
- Utilization of AlphaFold2 to Predict MFS Protein Conformations after Selective Mutation
Xiao, International journal of molecular sciences 2022 - “...the Structures from Prediction and Experiment To date, several structures of MFS proteins (UniProt ID: P0AA76, P0AEY8, P0AGF4, P02920, Q6MLJ0, and Q9LT15) have been found in both the outward- and inward-opening conformations [ 9 , 10 , 11 , 12 , 30 , 31 , 32...”
- “...was 0.84 (inward conformation, PDB ID: 6E9N) and 0.77 (outward conformation, PDB ID: 6E9O) for P0AA76, 1.01 (inward, PDB ID: 4QIQ) and 0.42 (outward, PDB ID: 4GBY) for P0AGF4, 1.12 (inward, PDB ID: 1PV6) and 0.56 (outward, PDB ID: 5GXB) for P02920, 0.71 (inward, PDB ID:...”
LgoT / b4356 galactonate:H+ symporter from Escherichia coli K-12 substr. MG1655 (see 2 papers)
lgoT / P39398 galactonate:H+ symporter from Escherichia coli (strain K12) (see 2 papers)
LGOT_ECOLI / P39398 Probable L-galactonate transporter; Galactonate:H(+) symporter from Escherichia coli (strain K12) (see 2 papers)
yjjL / RF|NP_418776 inner membrane transport protein yjjL from Escherichia coli K12 (see 2 papers)
b4356 predicted transporter from Escherichia coli str. K-12 substr. MG1655
24% identity, 82% coverage
Avin_51310 D-galactonate transporter from Azotobacter vinelandii AvOP
25% identity, 62% coverage
- Precision control of ammonium release in Azotobacter vinelandii
Barney, Microbial biotechnology 2024 - “...add additional restriction sites pPCRGAL10 This study pPCRGAL20 Cloned flanking segments and promoter region of Avin_51310 into pBB284 pBB284 This study pPCRGAL21 Modified pPCRGAL20 to remove Avin_51310 and modify for insertion of alternative genes behind the Avin_51310 promoter pPCRGAL20 This study pPCRNH3108 pBB114 derivative carrying nifA...”
- “...of Avin_51340 promoter pPCRNH3108, pPCRGAL18 This study pPCRNH3112 Shuttled nifA gene between flanking segments of Avin_51310 promoter pPCRNH3108, pPCRGAL21 This study a All plasmid sequences are available upon request. TABLE 3 Primers used for the construction of Azotobacter vinelandii manipulated strains. Primer Sequence (all in 5...”
S3998 D-galactonate transport protein from Shigella flexneri 2a str. 2457T
23% identity, 88% coverage
Dred_0431 major facilitator superfamily MFS_1 from Desulfotomaculum reducens MI-1
26% identity, 87% coverage
DV527_RS02165 MFS transporter from Staphylococcus saprophyticus
23% identity, 90% coverage
BA3267 major facilitator family transporter from Bacillus anthracis str. Ames
BAS3034 major facilitator family transporter from Bacillus anthracis str. Sterne
29% identity, 61% coverage
E2348C_4274 MFS transporter from Escherichia coli O127:H6 str. E2348/69
24% identity, 85% coverage
BCAM2500 putative glucarate transporter from Burkholderia cenocepacia J2315
27% identity, 61% coverage
PP_2651 major facilitator family transporter from Pseudomonas putida KT2440
25% identity, 71% coverage
6e9nA / J7QAK3 E. Coli d-galactonate:proton symporter in the inward open form (see paper)
23% identity, 86% coverage
- Ligand: d-gluconic acid (6e9nA)
SERP_RS10290 MFS transporter from Staphylococcus epidermidis RP62A
SERP2069 major facilitator superfamily protein from Staphylococcus epidermidis RP62A
24% identity, 90% coverage
UH47_01940 MFS transporter from Staphylococcus pseudintermedius
27% identity, 67% coverage
APA386B_203 MFS transporter from Acetobacter pasteurianus 386B
27% identity, 67% coverage
SACOL2521 transporter, putative from Staphylococcus aureus subsp. aureus COL
SAOUHSC_02815 hypothetical protein from Staphylococcus aureus subsp. aureus NCTC 8325
SAUSA300_2449 putative transporter from Staphylococcus aureus subsp. aureus USA300_FPR3757
NWMN_2408 hypothetical protein from Staphylococcus aureus subsp. aureus str. Newman
SAR2589 putative transporter protein from Staphylococcus aureus subsp. aureus MRSA252
23% identity, 90% coverage
- Importance of bacillithiol in the oxidative stress response of Staphylococcus aureus
Posada, Infection and immunity 2014 - “...feoA feoB fhuA fhuB ribU SACOL0665 SACOL1367 SACOL2521 sirA uhpT Branched-chain amino acid transport system II carrier Cobalt transporter ATP-binding subunit...”
- Changes in the Staphylococcus aureus transcriptome during early adaptation to the lung
Chaffin, PloS one 2012 - “...were the phosphate transporter ptsS , sodium:solute symporter family gene SACOL0311 and putative transport gene SACOL2521. Like the genes involved in energy metabolism above, points to relief of carbon-catabolite repression of operons encoding alternative carbohydrate uptake systems. Genes down regulated at 6 hours were also confined...”
- Lysogenization of Staphylococcus aureus RN450 by phages ϕ11 and ϕ80α leads to the activation of the SigB regulon
Fernández, Scientific reports 2018 - “...2.20 3.14 Up SAOUHSC_02771 2.96 5.46 Up SAOUHSC_02772 2.32 6.49 Up SAOUHSC_02812 3.00 7.98 Up SAOUHSC_02815 2.63 4.38 Up SAOUHSC_02822 fbp 2.31 3.17 Up SAOUHSC_02848 glcB 2.07 2.90 SAOUHSC_02862 clpL 5.24 16.79 Up SAOUHSC_02877 crtN 2.14 5.93 Up SAOUHSC_02879 crtM 3.46 10.17 Up SAOUHSC_02880 crtQ 3.88...”
- Assessment of Bona Fide sRNAs in Staphylococcus aureus
Liu, Frontiers in microbiology 2018 - “...CcpA function (Schumacher et al., 2007 ). Interestingly, in addition to sugar transporters (i.e., SAOUHSC_02520, SAOUHSC_02815), the fructose-1,6-bisphosphate aldolase (SAOUHSC_02926) is a putative RsaOG target (Data Sheet 2 ), which in turn may contribute to CcpA regulation. In S. aureus , CodY is a pleiotropic regulator...”
- Investigation of the Staphylococcus aureus GraSR regulon reveals novel links to virulence, stress response and cell wall signal transduction pathways
Falord, PloS one 2011 - “...group corresponds to transport proteins: the oligopeptide ATP-binding transporter OppF, a putative glucaric acid transporter (SAOUHSC_02815) and two genes located directly downstream from the vraFG operon, encoding a putative inorganic phosphate transporter (SAOUHSC_00669 and SAOUHSC_00670) known as PitAB in E. coli [40] . In the third...”
- Differential gene expression in Staphylococcus aureus exposed to Orange II and Sudan III azo dyes
Pan, Journal of industrial microbiology & biotechnology 2015 - “...SAUSA300_2329 gltT C 0.0412 Cytoplasmic membrane 1.67 SAUSA300_2449 SAUSA300_1454 zwf G G 0.0347 Cytoplasmic membrane 0.0309 Cytoplasmic 1.53 1.52 SAUSA300_2105...”
- “...membrane transporter proteins, such as SAUSA300_2449 (encoding a putative transporter), mtlF (SAUSA300_2105, encoding mannitol-specificphosphotransferase...”
- Sulfide Homeostasis and Nitroxyl Intersect via Formation of Reactive Sulfur Species in Staphylococcus aureus
Peng, mSphere 2017 - “...NWMN_2402 SA2294 gntK 6.1 Gluconate kinase + NWMN_2403 SA2295 gntR 5.4 Gluconate operon repressor + NWMN_2408 SA2300 12.0 Hypothetical; putative transporter protein (glucaronic acid) NWMN_2510 SA2406 6.2 Glycine betaine aldehyde dehydrogenase GbsA NWMN_2513 SA2408 3.7 Putative choline transporter a See Table1 . b At least 2-fold...”
- Phenanthrene Antibiotic Targets Bacterial Membranes and Kills Staphylococcus aureus With a Low Propensity for Resistance Development
Chen, Frontiers in microbiology 2018 - “...5 CA A30S SAR2480 Transcriptional regulator ( Msadek et al., 1990 ) 6 AT V301V SAR2589 MFS transporter The Sa02 and Sa03 strains harbored the substitution Arg48Ser in a locus tag, SAR2257, which is annotated as a putative transport protein involved in multidrug resistance ( Holden...”
- Transcriptional profiling of XdrA, a new regulator of spa transcription in Staphylococcus aureus
McCallum, Journal of bacteriology 2010 - “...P 0.05. b c regulated ORF SAR0995, and SAR2589, encoding a protein of unknown function with similarity to small-molecule transporters. SAR2589 was strongly...”
- “...SAR0996 SAR0995 SAR1741 SAR1740 SAR1741 SAR2413 SAR2413 SAR2593 SAR2589 SAR2589 FIG. 1. Northern blotting of ORFs up- or downregulated from microarrays of...”
FTT_1291 major facilitator transporter from Francisella tularensis subsp. tularensis SCHU S4
22% identity, 88% coverage
SA2300 hypothetical protein from Staphylococcus aureus subsp. aureus N315
23% identity, 90% coverage
ACIAD0127 D-glucarate/D-galactarate permease (MFS superfamily) from Acinetobacter sp. ADP1
26% identity, 61% coverage
- New insights into the alternative D-glucarate degradation pathway
Aghaie, The Journal of biological chemistry 2008 - “...growth on D-glucarate Gene ID ACIAD0127 ACIAD0128 ACIAD0130 ACIAD0131 ACIAD0244 ACIAD2275 ACIAD2417 ACIAD2876 Function D-Glucarate/D-Galactarate D-Glucarate...”
- “...of them are co-located on the genome (ACIAD0127, ACIAD0128, ACIAD0130, and ACIAD0131) and are respectively annotated as D-glucarate/D-galactarate permease,...”
Q9RPH4 Putative transporter protein (Fragment) from Mycolicibacterium smegmatis
27% identity, 70% coverage
BSU12360 hexuronate transporter from Bacillus subtilis subsp. subtilis str. 168
28% identity, 69% coverage
- rocF affects the production of tetramethylpyrazine in fermented soybeans with Bacillus subtilis BJ3-2
Liu, BMC biotechnology 2022 - “...Up BSU10710 12.019 81.937 2.76 7.47E-04 2.78E-02 Up BSU36960 49.193 320.369 2.7 1.70E-06 1.94E-04 Up BSU12360 7.415 48.837 2.7 4.64E-06 4.23E-04 Up BSU06850 9.309 60.185 2.68 9.66E-05 5.78E-03 Up BSU12350 14.441 90.526 2.64 4.64E-06 4.23E-04 Up BSU37620 100.13 605.721 2.6 1.28E-06 1.51E-04 Up BSU19670 3.952 23.716...”
- The program of gene transcription for a single differentiating cell type during sporulation in Bacillus subtilis
Eichenberger, PLoS biology 2004 - “...cysC (BSU15600), cysH (BSU15570), cysK (BSU00730), cysP (BSU15580), dctP (BSU04470), dctR (BSU04460), exuR (BSU12370), exuT (BSU12360), gerE (BSU28410), gerM (BSU28380), gerPA (BSU10720), gltR (BSU26670), goxB (BSU11670), kapD (BSU31470), lip (BSU31470), mpr (BSU02240), phoB (BSU05740), proH (BSU18480), proJ (BSU18470), racA/ywkC (BSU37030), safA (BSU27840), sat (BSU15590), spoIID (BSU36750),...”
AEX15_02625 MFS transporter from Salmonella enterica subsp. enterica serovar Kentucky
25% identity, 69% coverage
SeKA_A3321 MFS transporter from Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188
25% identity, 69% coverage
STM3832 putative permease from Salmonella typhimurium LT2
25% identity, 87% coverage
BP1026B_II0372 MFS transporter from Burkholderia pseudomallei 1026b
26% identity, 61% coverage
- TetR-like regulator BP1026B_II1561 controls aromatic amino acid biosynthesis and intracellular pathogenesis in Burkholderia pseudomallei
McMillan, Frontiers in microbiology 2024 - “...BP1026B_II0370-II0372 encode shikimate 5-dehydrogenase, 3-dehydroquinate dehydratase, and a phthalate permease, respectively ( Figure 6E ). BP1026B_II0372 is a major facilitator superfamily phthalate permease that, to our knowledge has not been characterized functionally for its role in pathogenesis. BP1026B_II0370 and BP1026B_II0371 are in the shikimate pathway catalyzing...”
- “...RAW264.7 cells and intracellular bacterial burdens determined at 24h post infection. A transposon mutant of BP1026B_II0372 replicated at wild type levels suggesting this gene is dispensable for intracellular infection ( Figures 6D , E ). Transposon mutants of BP1026B_II0370 and BP1026B_II0371 were able to replicate at...”
Q7UTN9 Probable glucarate transporter from Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
23% identity, 91% coverage
P42205 Probable galactarate/D-glucarate transporter GudP from Pseudomonas putida
25% identity, 63% coverage
- Major facilitator superfamily
Pao, Microbiology and molecular biology reviews : MMBR 1998 - “...455 456 458 450 451 433 449 444 445 435 P42609 P42237 P42205 Z37980 U29581 Q05181 U25634 U32375 P42613 P31457 P37489 SP SP SP GB GB SP GB GB SP SP SP C11D3.18c...”
LOC100792104 sodium-dependent phosphate transport protein 1, chloroplastic from Glycine max
21% identity, 91% coverage
Q9I1Q7 Probable major facilitator superfamily (MFS) transporter from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
PA2210 probable major facilitator superfamily (MFS) transporter from Pseudomonas aeruginosa PAO1
24% identity, 69% coverage
- Proteome-wide identification of druggable targets and inhibitors for multidrug-resistant <i>Pseudomonas aeruginosa</i> using an integrative subtractive proteomics and virtual screening approach
Vemula, Heliyon 2025 - “...873 Q9I315 1955 Q9I389 3037 Q9HWS8 4119 Q9I1Q6 874 Q9I321 1956 Q9I3A9 3038 Q9HWS9 4120 Q9I1Q7 875 Q9I340 1957 Q9I3B1 3039 Q9HWT0 4121 Q9I1Q8 876 Q9I342 1958 Q9I3C1 3040 Q9HWT1 4122 Q9I1Q9 877 Q9I344 1959 Q9I3D3 3041 Q9HWT2 4123 Q9I1R0 878 Q9I382 1960 Q9I3D7 3042 Q9HWT3...”
- Comparative genome analysis of multidrug-resistant Pseudomonas aeruginosa JNQH-PA57, a clinically isolated mucoid strain with comprehensive carbapenem resistance mechanisms
Hao, BMC microbiology 2021 - “...62 open reading frames (ORFs). Additionally, JNQH-PA57 lacks a 4150bp fragment containing PA2218, PA2219, and PA2210 genes and has a 52,757bp insertion downstream of PA2221, which is the second insertion identified in JNQH-PA57 genome. The third insertion between PA1965 and PA1964 (located between the 3,577,938bp and...”
- The biofilm-specific antibiotic resistance gene ndvB is important for expression of ethanol oxidation genes in Pseudomonas aeruginosa biofilms
Beaudoin, Journal of bacteriology 2012 - “...PA14_71250 PA0299 PA4222 PA4072 PA3044 PA2715 PA2700 PA2210 PA1989 PA1987 PA1986 PA1983 PA1982 PA1980 PA1978 PA1976 PA1975 PA1015 PA0931 PA4407 PA4540...”
BAB1_1964 Tetracycline resistance protein:NADH-ubiquinone oxidoreductase, chain 4:General substrate transporter:Major facilitator super... from Brucella melitensis biovar Abortus 2308
24% identity, 62% coverage
- ClpP protease modulates bacterial growth, stress response, and bacterial virulence in Brucella abortus
Sun, Veterinary research 2023 - “...while the top 10 down-regulated genes BAB2_0277, BAB1_1215, BAB1_0041, BAB2_0276, BAB2_0278, BAB1_1214, BAB1_0040, rplI , BAB1_1964, and rpsN . Figure 6 Transcriptomic analysis for differentially expressed genes. A Heat map of the two-way hierarchical clustering. B COG analysis of the DEGs between WT and clpP ....”
- “...analysis, the top 10 upregulated proteins were BAB2_0880, RibH2, BAB1_0239, BAB1_1744, UreG2, UbiG, BAB1_0241, SucC, BAB1_1964, and Bpt, while the top 10 down-regulated proteins were ClpS, BAB1_0115, BAB1_0018, BAB1_0296, BAB1_0875, BAB1_1435, BAB1_1357, BAB2_0019, BAB1_1214, and BAB2_0547. Integrated analysis revealed the global roles of ClpP in B....”
BCAL0184 putative glucarate transporter from Burkholderia cenocepacia J2315
20% identity, 64% coverage
PA14_36120 putative MFS transporter from Pseudomonas aeruginosa UCBPP-PA14
24% identity, 69% coverage
LOC105173161 ascorbate transporter, chloroplastic from Sesamum indicum
22% identity, 69% coverage
- Discovering favorable genes, QTLs, and genotypes as a genetic resource for sesame (Sesamum indicum L.) improvement
Kefale, Frontiers in genetics 2022 - “...LOC105173253 Probable polygalacturonate protein 39-like LOC105173155 Ferric reduction oxidase 2 LOC105173156 Ferric reduction oxidase 2-like LOC105173161 Ascorbate transporter LG11 55660035767772 NN, IL, SB, PH, CDI, Fe, Zn LOC105173373 Protein phosphate starvation response 1-like LOC105173380 Citrate synthase LG11 1420592714426041 NN, SB, PH, CL, CW, SL, P LOC105174482...”
- Genetic Architecture Underpinning Yield Components and Seed Mineral-Nutrients in Sesame
Teboul, Genes 2020 - “...isocitrate dehydrogenase (LOC105167815), ferric reduction oxidases 2 and 2-like (LOC105173155 and LOC105173156, respectively), ascorbate transporter (LOC105173161), citrate synthase (LOC105173380), nicotianamine aminotransferase A (LOC105178476), isocitrate lyase (LOC105178507) and aconitate hydratase (LOC105178516). An important, yet poorly investigated aspect is the impact of high seed nutrient concentration on the...”
- “...protein 39-like LOC105173253 Probable polygalacturonase LOC105173155 Ferric reduction oxidase 2 LOC105173156 Ferric reduction oxidase 2-like LOC105173161 Ascorbate transporter LG11 55660035767772 NN, IL, SB, PH, CDI, Fe, Zn LOC105173373 Protein PHOSPHATE STARVATION RESPONSE 1-like LOC105173380 Citrate synthase LG11 1420592714426041 NN, SB, PH, CL, CW, SL, P LOC105174482...”
CtCNB1_1308 major facilitator superfamily MFS_1 from Comamonas testosteroni CNB-2
23% identity, 73% coverage
- Delineation of Steroid-Degrading Microorganisms through Comparative Genomic Analysis
Bergstrand, mBio 2016 - “...), a conclusion which is further supported by our analysis. We further predict that genes CtCNB1_1308 , CtCNB1_1309 , CtCNB1_1310 , ORF6 , ORF7 , CtCNB1_1347 , and CtCNB1_1348 in strain CNB-2 are involved in cholate degradation but not in testosterone degradation, as they are conserved...”
- “...57 ), because these genes are conserved only in organisms predicted to degrade cholate. Furthermore, CtCNB1_1308 encodes a putative MFS transporter, which could be involved in uptake of cholate or one of its degradation intermediates. Among the cluster of genes in strain CNB-2 predicted to encode...”
AO356_28540 D-mannose transporter from Pseudomonas fluorescens FW300-N2C3
26% identity, 61% coverage
- mutant phenotype: Specific phenotype on D-mannose as the carbon source. No other transporter was apparent in the fitness data.
LOC100793618 ascorbate transporter, chloroplastic from Glycine max
22% identity, 70% coverage
VGL2B_DANRE / Q5W8I7 Vesicular glutamate transporter 2.2; Solute carrier family 17 member 6-A; Vesicular glutamate transporter 2-B from Danio rerio (Zebrafish) (Brachydanio rerio) (see 2 papers)
25% identity, 40% coverage
- function: Multifunctional transporter that transports L-glutamate as well as multiple ions such as chloride, proton, potassium, sodium and phosphate. At the synaptic vesicle membrane, mainly functions as a uniporter which transports preferentially L-glutamate but also, phosphate from the cytoplasm into synaptic vesicles at presynaptic nerve terminals of excitatory neural cells. The L-glutamate or phosphate uniporter activity is electrogenic and is driven by the proton electrochemical gradient, mainly by the electrical gradient established by the vacuolar H(+)-ATPase across the synaptic vesicle membrane. In addition, functions as a chloride channel that allows a chloride permeation through the synaptic vesicle membrane therefore affects the proton electrochemical gradient and promotes synaptic vesicles acidification. Moreover, functions as a vesicular K(+)/H(+) antiport allowing to maintain the electrical gradient and to decrease chemical gradient and therefore sustain vesicular L-glutamate uptake. The vesicular H(+)/H(+) antiport activity is electroneutral. At the plasma membrane, following exocytosis, functions as a symporter of Na(+) and phosphate from the extracellular space to the cytoplasm allowing synaptic phosphate homeostasis regulation. The symporter activity is driven by an inside negative membrane potential and is electrogenic (By similarity). Also involved in the regulation of retinal hyaloid vessel regression during postnatal development (By similarity). May also play a role in the endocrine L-glutamatergic system of other tissues such as pineal gland and pancreas (By similarity).
catalytic activity: L-glutamate(out) = L-glutamate(in) (RHEA:66336)
catalytic activity: 3 Na(+)(out) + phosphate(out) = 3 Na(+)(in) + phosphate(in) (RHEA:71255)
catalytic activity: phosphate(in) = phosphate(out) (RHEA:32823)
catalytic activity: K(+)(in) + H(+)(out) = K(+)(out) + H(+)(in) (RHEA:29467)
catalytic activity: chloride(in) = chloride(out) (RHEA:29823)
BCAM0103 Major Facilitator Superfamily protein from Burkholderia cenocepacia J2315
22% identity, 74% coverage
LOC100782221 ascorbate transporter, chloroplastic from Glycine max
21% identity, 70% coverage
LOC101263257 ascorbate transporter, chloroplastic from Solanum lycopersicum
21% identity, 77% coverage
LOC410920 putative inorganic phosphate cotransporter from Apis mellifera
24% identity, 44% coverage
Sb03g040080 No description from Sorghum bicolor
LOC8058919 probable anion transporter 3, chloroplastic from Sorghum bicolor
23% identity, 80% coverage
CCNA_02570 transporter from Caulobacter crescentus NA1000
CC2485, CC_2485 major facilitator family transporter from Caulobacter crescentus CB15
25% identity, 70% coverage
- Regulation of potassium uptake in Caulobacter crescentus
Quintero-Yanes, Journal of bacteriology 2024 (secret) - Genomic Adaptations to the Loss of a Conserved Bacterial DNA Methyltransferase
Gonzalez, mBio 2015 - “...(in the CCNA_00451 , CCNA_03524 or CCNA_01257 coding sequences or in the intergenic region between CCNA_02570 and CCNA_02571 ). Some of these mutations might modulate adverse effects that PTS mutations have on growth rate and thus enhance the fitness of the strains rather than having a...”
- Global transcriptional response of Caulobacter crescentus to iron availability
da, BMC genomics 2013 - “...CC_0991 CCNA_01042 TonB-dependent receptor 2.47 2.27 CC_1099 CCNA_01155 TonB-dependent outer membrane receptor 2.22 2.06 CC_2485 CCNA_02570 Transporter (Major Facilitator Superfamily) 2.49 3.24 CC_2486 CCNA_02571 Transporter (Major Facilitator Superfamily) 2.16 2.24 CC_2804 CCNA_02895 TonB-dependent receptor 2.41 2.22 CC_3161 CCNA_03263 TonB-dependent receptor 2.89 2.68 CC_3335 reannotated Hypothetical protein...”
- Global transcriptional response of Caulobacter crescentus to iron availability
da, BMC genomics 2013 - “...many TonB-dependent receptors. At least six of these genes (CC3336, CC3161, CC3461, CC0991, CC2804 and CC2485) are also highly induced by carbon limitation [ 29 ] and are positively regulated by CfrA, a sRNA that regulates adaptation to carbon starvation in C. crescentus [ 30 ]....”
- “...2.74 CC_0991 CCNA_01042 TonB-dependent receptor 2.47 2.27 CC_1099 CCNA_01155 TonB-dependent outer membrane receptor 2.22 2.06 CC_2485 CCNA_02570 Transporter (Major Facilitator Superfamily) 2.49 3.24 CC_2486 CCNA_02571 Transporter (Major Facilitator Superfamily) 2.16 2.24 CC_2804 CCNA_02895 TonB-dependent receptor 2.41 2.22 CC_3161 CCNA_03263 TonB-dependent receptor 2.89 2.68 CC_3335 reannotated Hypothetical...”
- Global regulation of gene expression and cell differentiation in Caulobacter crescentus in response to nutrient availability
England, Journal of bacteriology 2010 - “...Berkeley Transport CC3336 CC3161 CC3461 CC0991 CC1666 CC2485 CC1136 CC2804 CC2287 CC0446 CC0999 CC1750 We hypothesize that nitrogen limitation extends the...”
LOC103422687 sodium-dependent phosphate transport protein 1, chloroplastic from Malus domestica
20% identity, 82% coverage
ANTR2_ARATH / Q8GX78 Ascorbate transporter, chloroplastic; Phosphate transporter PHT4;4; AtPHT4;4; Probable anion transporter 2 from Arabidopsis thaliana (Mouse-ear cress) (see 5 papers)
NP_567175 Major facilitator superfamily protein from Arabidopsis thaliana
AT4G00370 ANTR2; inorganic phosphate transmembrane transporter/ organic anion transmembrane transporter from Arabidopsis thaliana
22% identity, 87% coverage
- function: Inorganic phosphate and probable anion transporter (PubMed:18086223). Ascorbate transporter bridging the chloroplast envelope. Transports ascorbate from the cytosol into the chloroplast. Requires chloride ions and the presence of an electrochemical potential across the membrane for activity (PubMed:25557369).
disruption phenotype: No visible phenotype, but decreased reduced ascorbate content in leaves and decreased xanthophyll cycle for heat dissipation of excessive energy in photosynthesis. - Microsome-associated proteome modifications of Arabidopsis seedlings grown on board the International Space Station reveal the possible effect on plants of space stresses other than microgravity
Mazars, Plant signaling & behavior 2014 - “...putative Na + dependent ileal bile acid transporter Q8L9P5 2.142 putative peroxisomal membrane carrier protein Q8GX78 AT4G00370 2.089 putative anion transporter 2 Q39232 AT1G71880 2.051 sucrose transport protein SUC1 Q9LHG9 AT3G12390 1.953 Nascent polypeptide-associated complex subunit -like protein 1 Q9FNC9 AT5G43970 1.923 mitochondrial import receptor subunit...”
- AtPHT4;4 is a chloroplast-localized ascorbate transporter in Arabidopsis.
Miyaji, Nature communications 2015 - GeneRIF: AtPHT4;4 protein is an ascorbate transporter at the chloroplast envelope membrane, which may be required for tolerance to strong light stress.
- Chloroplastic ascorbate modifies plant metabolism and may act as a metabolite signal regardless of oxidative stress
Tóth, Plant physiology 2024 - “...in the GenBank/EMBL data libraries under accession numbers: VTC2 ( At4g26850 ) and PHT4;4 ( At4g00370 ). Supplementary Material kiae409_Supplementary_Data Acknowledgments The authors are grateful to Fredrik Edfors (KTH, Solna, Sweden) for assistance with LC/MS for the PISA assay, Csilla Sajben (HUN-REN BRC, Szeged) for the...”
- Chloroplast phosphate transporter CrPHT4-7 regulates phosphate homeostasis and photosynthesis in Chlamydomonas
Tóth, Plant physiology 2024 - “..., PHT4;2 , PHT4;3 , PHT4;4 , PHT4;5 , and PHT4;6 are At2g29650, At2g38060, At3g46980, At4g00370, At5g20380, and At5g44370, respectively. Supplementary Material kiad607_Supplementary_Data Acknowledgments The authors thank Drs. Pter Horvth and Balzs Papp (BRC Szeged, Hungary) for laboratory equipment support and Dr. Cornelia Spetea (University of...”
- Identification of QTLs and allelic effect controlling lignan content in sesame (Sesamum indicum L.) using QTL-seq approach
Kim, Frontiers in genetics 2023 - “...0 AT1G01610 glycerol-3-phosphate acyltransferase 4 (GPAT4) K13508 SIN_1009957 4 0 0 0 0 3 3 AT4G00370 Major facilitator superfamily protein SIN_1009958 2 0 1 0 0 1 1 AT2G46020 transcription regulatory protein SNF2, putative SIN_1009959 1 1 0 0 0 8 1 AT1G63800 ubiquitin-conjugating enzyme 5...”
- The genomics and physiology of abiotic stressors associated with global elevation gradients inArabidopsis thaliana
Gamba, 2022 - Roles of plastid-located phosphate transporters in carotenoid accumulation
Hao, Frontiers in plant science 2022 - “...etal., 2008b ; Pavon etal., 2008 ; Wang etal., 2014 ; Karlsson etal., 2015 AtPHT4;4 At4g00370 Arabidopsis chloroplast in photosynthetic tissues Pi import 720 M Knockout of AtPHT4;4 has no significant effect on the carotenoid accumulation in photosynthetic tissues under low light but causes reduced carotenoid...”
- Interdependent iron and phosphorus availability controls photosynthesis through retrograde signaling
Nam, Nature communications 2021 - “...accumulation on chromosome 4 (associated with SNP171674) showed that genetic inactivation of only one gene, AT4G00370 ( PHT4;4 ), failed to stay green under FeP conditions, and exhibited a remarkable decrease in chlorophyll content by comparison to wild-type plants (Fig. 3b, c and Supplementary Fig. 8...”
- “...SALK_087271 (AT1G13605), SALK_130208 (AT1G13607), SALK_023173 (AT1G13608), SAIL_1243_E04 (AT1G13609), SAIL_897_D11 (AT1G13610), N469134 (At4g00355), SALK_128714 (AT4G00360), N469134 (AT4G00370), SAIL_842_E09 (AT4G00380), N866595 (At4g00390), SAIL_633_E10 (At4g00400), SALK_077222 (AT3G02870) SALK_053900 (AT3G46980), SALK_114708 (AT5G20380), SAIL_809_B01 (AT5G44370), SALK_067629 (AT4G28610), and SALK_039445 (AT5G20150) were obtained from the Nottingham Arabidopsis Stock Centre (NASC). Homozygous mutant...”
- Genome-Wide Analysis of Major Facilitator Superfamily and Its Expression in Response of Poplar to Fusarium oxysporum
Diao, Frontiers in genetics 2021 - “...and Cs + influx when heterologously expressed in yeast ( Estelle et al., 2015 ). AT4G00370 (homologous to PtrMFS34 ) encodes ascorbate transporters on chloroplast envelope membranes, which are necessary for plants to tolerate strong light ( Miyaji et al., 2015 ). Pathogens may activate signal...”
- Spaceflight induces novel regulatory responses in Arabidopsis seedling as revealed by combined proteomic and transcriptomic analyses
Kruse, BMC plant biology 2020 - “...RNA =0.96), monodehydroascorbate reductase (AT1G63940, L 2 FC RNA =0.98), as well as ascorbate transporters (AT4G00370, L 2 FC RNA =0.84; AT2G27810, L 2 FC RNA =0.68; AT2G34190, L 2 FC RNA =0.82) were all up-regulated in the spaceflight samples. In addition to ascorbate related genes,...”
- More
G8E09_08605 spinster family MFS transporter from Acinetobacter pittii
24% identity, 70% coverage
- Phenotypic Variation and Carbapenem Resistance Potential in OXA-499-Producing Acinetobacter pittii
Zhang, Frontiers in microbiology 2020 - “...0.0000 0.0003 G8E09_08150 SOS response-associated peptidase 2.66 0.0000 0.0000 G8E09_12315 Hypothetical protein 2.63 0.0000 0.0011 G8E09_08605 MFS transporter 2.60 0.0000 0.0016 G8E09_07245 DNA breaking-rejoining protein 2.58 0.0000 0.0004 G8E09_12905 Ring-hydroxylating dioxygenase ferredoxin reductase family protein 2.49 0.0000 0.0000 G8E09_10205 Hypothetical protein 2.45 0.0022 0.0488 G8E09_08615 Amidase...”
ACX60_RS08490 spinster family MFS transporter from Acinetobacter baumannii
24% identity, 70% coverage
T634_RS14800 spinster family MFS transporter from Acinetobacter baumannii MRSN 7339
24% identity, 70% coverage
ANTR4_ARATH / Q66GI9 Probable anion transporter 4, chloroplastic; Phosphate transporter PHT4;3 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
AT3G46980, NP_190282 transporter-related from Arabidopsis thaliana
24% identity, 53% coverage
- function: Inorganic phosphate and probable anion transporter.
- Chloroplast phosphate transporter CrPHT4-7 regulates phosphate homeostasis and photosynthesis in Chlamydomonas
Tóth, Plant physiology 2024 - “...PHT4;1 , PHT4;2 , PHT4;3 , PHT4;4 , PHT4;5 , and PHT4;6 are At2g29650, At2g38060, At3g46980, At4g00370, At5g20380, and At5g44370, respectively. Supplementary Material kiad607_Supplementary_Data Acknowledgments The authors thank Drs. Pter Horvth and Balzs Papp (BRC Szeged, Hungary) for laboratory equipment support and Dr. Cornelia Spetea (University...”
- “...paper: PHT3 Gramene: Cre03.g172300 PHT3 Araport: Cre03.g172300 PHT4;2 Gramene: AT2G38060 PHT4;2 Araport: AT2G38060 PHT4;3 Gramene: AT3G46980 PHT4;3 Araport: AT3G46980 PHT4;5 Gramene: AT5G20380 PHT4;5 Araport: AT5G20380 PHT4;6 Gramene: AT5G44370 PHT4;6 Araport: AT5G44370 PHT2;1 Gramene: AT3G26570 PHT2;1 Araport: AT3G26570 ATP CHEBI: CHEBI:15422 PHT4;4 Gramene: At5g20380 PHT4;4 Araport: At5g20380...”
- An amiRNA screen uncovers redundant CBF and ERF34/35 transcription factors that differentially regulate arsenite and cadmium responses
Xie, Plant, cell & environment 2021 - “...AT2G17270 PHT3;3 phosphate transporter 3;3 AT2G38060 PHT4;2 phosphate transporter 4;2 AT3G26570 PHT2;1 phosphate transporter 2;1 AT3G46980 PHT4;3 phosphate transporter 4;3 CBF2 AT1G76430 PHT1;9 phosphate transporter 1;9 AT2G38060 PHT4;2 phosphate transporter 4;2 AT3G26570 PHT2;1 phosphate transporter 2;1 AT3G46980 PHT4;3 phosphate transporter 4;3 AT5G43360 PHT1;3 Phosphate Transporter 1;3...”
- “...AT1G76430 PHT1;9 phosphate transporter 1;9 AT2G38060 PHT4;2 phosphate transporter 4;2 AT3G26570 PHT2;1 phosphate transporter 2;1 AT3G46980 PHT4;3 phosphate transporter 4;3 AT3G54700 PHT1;7 phosphate transporter 1;7 AT5G43350 PHT1;1 phosphate transporter 1;1 AT5G43360 PHT1;3 Phosphate Transporter 1;3 Table 3. Genes significantly (p<0.05) induced >2 folds after 2 hours...”
- Interdependent iron and phosphorus availability controls photosynthesis through retrograde signaling
Nam, Nature communications 2021 - “...N469134 (At4g00355), SALK_128714 (AT4G00360), N469134 (AT4G00370), SAIL_842_E09 (AT4G00380), N866595 (At4g00390), SAIL_633_E10 (At4g00400), SALK_077222 (AT3G02870) SALK_053900 (AT3G46980), SALK_114708 (AT5G20380), SAIL_809_B01 (AT5G44370), SALK_067629 (AT4G28610), and SALK_039445 (AT5G20150) were obtained from the Nottingham Arabidopsis Stock Centre (NASC). Homozygous mutant lines were confirmed by PCR using the primers listed in...”
- The AAP gene family for amino acid permeases contributes to development of the cyst nematode Heterodera schachtii in roots of Arabidopsis
Elashry, Plant physiology and biochemistry : PPB 2013 - “...a 0.09 At5g44370 AtBNP1hom1 5.2 5 0.2 0.38 At2g29650 AtBNP1hom2 3.6 6.3 2.7 a 0.00 At3g46980 AtBNP1hom3 4.3 4.1 0.2 0.52 At2g38060 AtBNP1hom4 4.8 4.6 0.2 0.45 At4g00370 AtBNP1hom5 5.4 7.6 2.2 a 0.00 a Indicates significant up- or downregulation (false discovery rate <5%)....”
- Iron-dependent modifications of the flower transcriptome, proteome, metabolome, and hormonal content in an Arabidopsis ferritin mutant
Sudre, Journal of experimental botany 2013 - “...ATCP1, Ca 2+ -binding protein Ca At1g12110 Transport 1.8 1.9 1.9 NRT1.1, nitrate transmembrane transporter At3g46980 2.1 2.1 2.0 PHT4;3, phosphate transporter-related At1g59590 Unknown function 1.7 1.5 1.5 ZCF37, molecular function unknown At2g17740 1.8 1.8 1.9 DC1 domain-containing protein/molecular function unknown At4g38080 1.7 1.7 1.9 Hydroxyproline-rich...”
- yrGATE: a web-based gene-structure annotation tool for the identification and dissemination of eukaryotic genes
Wilkerson, Genome biology 2006 - “...high similarity over most of its length to rice protein NP_915525 and to Arabidopsis protein NP_190282. These proteins provided a putative functional assignment of 'sugar transporter' for the annotation. The annotator was satisfied with the annotation and submitted it for review. Administrators reviewed the annotation and...”
VGLU1_MOUSE / Q3TXX4 Vesicular glutamate transporter 1; VGluT1; Brain-specific Na(+)-dependent inorganic phosphate cotransporter; Solute carrier family 17 member 7 from Mus musculus (Mouse) (see 11 papers)
NP_892038 vesicular glutamate transporter 1 from Mus musculus
27% identity, 36% coverage
- function: Multifunctional transporter that transports L-glutamate as well as multiple ions such as chloride, proton, potassium, sodium and phosphate (PubMed:25433636, PubMed:29273736, PubMed:29642010, PubMed:33440152). At the synaptic vesicle membrane, mainly functions as an uniporter which transports preferentially L-glutamate but also phosphate from the cytoplasm into synaptic vesicles at presynaptic nerve terminals of excitatory neural cells (PubMed:15103023, PubMed:15118123, PubMed:25433636, PubMed:29642010). The L-glutamate or phosphate uniporter activity is electrogenic and is driven by the proton electrochemical gradient, mainly by the electrical gradient established by the vacuolar H(+)-ATPase across the synaptic vesicle membrane (PubMed:29642010). In addition, functions as a chloride channel that allows a chloride permeation through the synaptic vesicle membrane that affects the proton electrochemical gradient and promotes synaptic vesicles acidification (PubMed:25433636, PubMed:29273736, PubMed:29642010). Moreover, may function as a K(+)/H(+) antiport allowing to maintain the electrical gradient and to decrease chemical gradient and therefore sustain vesicular glutamate uptake (By similarity). The vesicular K(+)/H(+) antiport activity is electroneutral (By similarity). At the plasma membrane, following exocytosis, functions as a symporter of Na(+) and phosphate from the extracellular space to the cytoplasm allowing synaptic phosphate homeostasis regulation (PubMed:29642010, PubMed:33440152). The symporter activity is driven by an inside negative membrane potential and is electrogenic (PubMed:29642010). Is necessary for synaptic signaling of visual-evoked responses from photoreceptors (PubMed:17611277).
catalytic activity: chloride(in) = chloride(out) (RHEA:29823)
catalytic activity: 3 Na(+)(out) + phosphate(out) = 3 Na(+)(in) + phosphate(in) (RHEA:71255)
catalytic activity: L-glutamate(out) = L-glutamate(in) (RHEA:66336)
catalytic activity: phosphate(in) = phosphate(out) (RHEA:32823)
catalytic activity: K(+)(in) + H(+)(out) = K(+)(out) + H(+)(in) (RHEA:29467)
subunit: Interacts with SHANK3.
disruption phenotype: Mice begin to die 3 weeks after birth. They exhibit a progressive neurological phenotype including blindness, loss of coordination and enhanced startle response. Glutamatergic neurotransmission is drastically reduced due to a decrease in the reserve pool of synaptic vesicles and reduced quantal size. Visual signaling from photoreceptors to retinal output neurons is impaired while photoentrainment and pupillary light responses remain intact. - The impact of abstinence from chronic alcohol consumption on the mouse striatal proteome: sex and subregion-specific differences
Duffus, Frontiers in pharmacology 2024 - “...Description p -value Top 10 Upregulated in Acute Female Top 10 upregulated in acute male Q3TXX4 Vesicular glutamate transporter 1 0.0415 Q91Z49 UAP56-interacting factor 0.0461 Q3UHL1 CaM kinase-like vesicle-associated protein 0.0362 Q80TN5 Palmitoyltransferase ZDHHC17 0.0086 Q5DQR4 Syntaxin-binding protein 5-like 0.0188 Q8R0W0 Epiplakin 0.0315 Q9CQW2 ADP-ribosylation factor-like...”
- Tuning of Glutamate, But Not GABA, Release by an Intrasynaptic Vesicle APP Domain Whose Function Can Be Modulated by β- or α-Secretase Cleavage.
Yao, The Journal of neuroscience : the official journal of the Society for Neuroscience 2019 - Pyridazine-derivatives Enhance Structural and Functional Plasticity of Tripartite Synapse Via Activation of Local Translation in Astrocytic Processes.
Foster, Neuroscience 2018 - “...complex subunit alpha-1 1.80 2.53 2.116 Q9WV55 Vesicle-associated membrane protein-associated protein A 1.63 1.51 2.716 Q3TXX4 Vesicular glutamate transporter 1 2.06 11.18 4.170 Endoplasmic Reticulum Transporter Q5DTI2 ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 1.66 2.43 5.158 Energy Metabolism Q9CQJ8 NADH dehydrogenase [ubiquinone] 1 beta...”
- System-based proteomic and metabonomic analysis of the Df(16)A+/- mouse identifies potential miR-185 targets and molecular pathway alterations.
Wesseling, Molecular psychiatry 2017 - “...Nrd1 Figure 1d NS NS 1.02 0.60 0.73 NS NS NS 0.99 0.89 0.90 VGLU1 Q3TXX4 Vesicular glutamate transporter 1 (VGluT1) Slc17a7 Transcriptomics 5 NS 1.16 1.6E-06 1.4E-05 NS 1.19 1.5E-04 4.8E-04 Implicated pathways mTORautism spectrum disorders and mental retardation MTOR Q9JLN9 Serine/threonine-protein kinase mTOR Mtor...”
- Amyloid Precursor Protein (APP) May Act as a Substrate and a Recognition Unit for CRL4CRBN and Stub1 E3 Ligases Facilitating Ubiquitination of Proteins Involved in Presynaptic Functions and Neurodegeneration
Del, The Journal of biological chemistry 2016 - “...r299, m311, m593 Q8K021 Q9JIS5 Q8BG39 P63044 Q9Z1G4 Q3TXX4 P46096 P46097 Q91V41 P63011 P60879 Q64332 O88935 Notable targets ApoE Tau m105 m*455, m*613 P08226...”
- Ion mobility-enhanced MS(E)-based label-free analysis reveals effects of low-dose radiation post contextual fear conditioning training on the mouse hippocampal proteome.
Huang, Journal of proteomics 2016 - “...Napb 94 14 1.12 * P63044 Vesicle-associated membrane protein 2 Vamp2 475 4 1.19 * Q3TXX4 Vesicular glutamate transporter 1 Slc17a7 232 6 1.77 *** D3Z7R4 Synaptotagmin-1 Syt1 71 7 1.14 ** O88935 Synapsin-1 Syn1 580 23 1.15 * P63011 Ras-related protein Rab-3A Rab3a 400 7...”
- “...Others Q9CQZ5 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 Ndufa6 149 4 1.17 *** Q3TXX4 Vesicular glutamate transporter 1 Slc17a7 232 6 1.77 *** Q9D0K2 Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial Oxct1 96 8 1.15 *** Q3TWV4 AP 2 complex subunit mu Ap2m1 92 7...”
- Integrative proteomic analysis of the NMDA NR1 knockdown mouse model reveals effects on central and peripheral pathways associated with schizophrenia and autism spectrum disorders.
Wesseling, Molecular autism 2014 - “...P48320 Gad2 2 3|4 1.25 0.0004 0.0015 3|4 not significant Vesicular glutamate transporter 1 (VGluT1) Q3TXX4 Slc17a7 3 5 1.14 0.0031 0.0192 5 not significant 1 6 1.20 <10 -16 <10 -16 4|6 not significant 4-aminobutyrate aminotransferase, mito P61922 Abat 2 4|6 1.14 0.0006 0.0024 4|5...”
- Fast antidepressant action of ketamine in mouse models requires normal VGLUT1 levels from prefrontal cortex neurons.
Belloch, Progress in neuro-psychopharmacology & biological psychiatry 2023 (PubMed)- GeneRIF: Fast antidepressant action of ketamine in mouse models requires normal VGLUT1 levels from prefrontal cortex neurons.
- VGluT1 Deficiency Impairs Visual Attention and Reduces the Dynamic Range of Short-Term Plasticity at Corticothalamic Synapses.
Lindström, Cerebral cortex (New York, N.Y. : 1991) 2020 - GeneRIF: VGluT1 Deficiency Impairs Visual Attention and Reduces the Dynamic Range of Short-Term Plasticity at Corticothalamic Synapses.
- Gene Expression of Disease-related Genes in Alzheimer's Disease is Impaired by Tau Aggregation.
Siano, Journal of molecular biology 2020 (PubMed)- GeneRIF: Gene Expression of Disease-related Genes in Alzheimer's Disease is Impaired by Tau Aggregation.
- The autism/neuroprotection-linked ADNP/NAP regulate the excitatory glutamatergic synapse.
Sragovich, Translational psychiatry 2019 - GeneRIF: Significant effects on hippocampal and cerebral cortical expression of the presynaptic Slc17a7 gene encoding vesicular excitatory glutamate transporter 1 were observed at the RNA and immunohistochemical levels, explaining the diffusion tensor imaging results.
- Diverse glutamatergic inputs target spines expressing M1 muscarinic receptors in the basolateral amygdala: An ultrastructural analysis.
McDonald, Brain research 2019 - GeneRIF: Diverse glutamatergic inputs target spines expressing M1 muscarinic receptors in the basolateral amygdala: An ultrastructural analysis.
- VGLUT1 Binding to Endophilin or Intersectin1 and Dynamin Phosphorylation in a Diurnal Context.
Richter, Neuroscience 2018 (PubMed)- GeneRIF: SH3 fusion protein pull downs using ITSN1SH3 A reveal diurnally varying binding of VGLUT1 with slightly reduced VGLUT1/dynamin ratios at the beginning of the light (ZT 0) or the dark (ZT 12) period. Phosphorylation increases binding of VGLUT1 but not of dynamin to EnphSH3. In contrast binding of dynamin to ITSN1SH3 A decreases under phosphorylating conditions with no changes in VGLUT1 binding.
- Sociability and synapse subtype-specific defects in mice lacking SRPX2, a language-associated gene.
Soteros, PloS one 2018 - GeneRIF: Specifically, we show that mice lacking SRPX2 show a specific reduction in excitatory VGlut2 synapses in the cerebral cortex, while VGlut1 and inhibitory synapses were largely unaffected. SRPX2 KO mice also exhibit an abnormal ultrasonic vocalization ontogenetic profile in neonatal pups, and reduced preference for social novelty.
- A slow excitatory postsynaptic current mediated by a novel metabotropic glutamate receptor in CA1 pyramidal neurons.
Sheng, Neuropharmacology 2017 (PubMed)- GeneRIF: In CA1 pyramidal neurons, a slow excitatory postsynaptic current is absent in the VGLUT1 knockout mouse.
- More
CG9254 uncharacterized protein from Drosophila melanogaster
21% identity, 79% coverage
- Roles of major facilitator superfamily transporters in phosphate response in Drosophila
Bergwitz, PloS one 2012 - “...D.melanogaster FBgn0024315 FBtr0087115 FBpp0086261 MFS8 Picot D.melanogaster FBgn0033048 FBtr0086033 FBpp0085369 CG7881 D.melanogaster FBgn0028513 FBtr0080512 FBpp0080090 CG9254 D.melanogaster FBgn0029727 FBtr0070715 FBpp0070683 CG6978 D.melanogaster FBgn0031424 FBtr0077769 FBpp0077449 MFS11 VGlut D.melanogaster FBgn0034490 FBtr0086320 FBpp0085628 CG9864 D.melanogaster FBgn0034782 FBtr0071892 FBpp0071803 CG12490 D.melanogaster FBgn0034783 FBtr0071893 FBpp0071804 CG9825 D.melanogaster FBgn0034784 FBtr0071895 FBpp0071806...”
- l(2)01810 is a novel type of glutamate transporter that is responsible for megamitochondrial formation
Shim, The Biochemical journal 2011 - “...FlyBase and has a high homology with the insect proteins annotated as sodium:phosphate symporters, especially CG9254 of Dmel (85% similarity; Supplementary Figure S1 ). However, l(2)01810 did not show any phosphate transport activity, but showed glutamate-transport activity. Therefore there is a possibility that CG9254 also has...”
VGLU1_RAT / Q62634 Vesicular glutamate transporter 1; VGluT1; Brain-specific Na(+)-dependent inorganic phosphate cotransporter; Solute carrier family 17 member 7 from Rattus norvegicus (Rat) (see 13 papers)
TC 2.A.1.14.13 / Q62634 Broad specificity brain synaptic vesicle anion:Na+ symporter (transports glutamate, phosphate, chloride, etc.)(BNPI, EAT-4, VGLUT1) Chloride and ketone bodies regulate VGLUT activities from Rattus norvegicus (Rat) (see 10 papers)
NP_446311 vesicular glutamate transporter 1 from Rattus norvegicus
27% identity, 36% coverage
- function: Multifunctional transporter that transports L-glutamate as well as multiple ions such as chloride, proton, potassium, sodium and phosphate (PubMed:10938000, PubMed:11001057, PubMed:11698619, PubMed:18080752, PubMed:19169251, PubMed:25433636, PubMed:27133463, PubMed:29642010, PubMed:33440152, PubMed:8202535). At the synaptic vesicle membrane, mainly functions as an uniporter which transports preferentially L-glutamate but also phosphate from the cytoplasm into synaptic vesicles at presynaptic nerve terminals of excitatory neural cells (PubMed:10938000, PubMed:11001057, PubMed:11698619, PubMed:18080752, PubMed:29642010). The L-glutamate or phosphate uniporter activity is electrogenic and is driven by the proton electrochemical gradient, mainly by the electrical gradient established by the vacuolar H(+)-ATPase across the synaptic vesicle membrane (PubMed:29642010). In addition, functions as a chloride channel that allows a chloride permeation through the synaptic vesicle membrane that affects the proton electrochemical gradient and promotes synaptic vesicles acidification (PubMed:10938000, PubMed:19169251, PubMed:25433636, PubMed:27133463, PubMed:29642010). Moreover, may function as a K(+)/H(+) antiport allowing to maintain the electrical gradient and to decrease chemical gradient and therefore sustain vesicular glutamate uptake (PubMed:25433636). The vesicular K(+)/H(+) antiport activity is electroneutral (PubMed:25433636). At the plasma membrane, following exocytosis, functions as a symporter of Na(+) and phosphate from the extracellular space to the cytoplasm allowing synaptic phosphate homeostasis regulation (PubMed:29642010, PubMed:33440152, PubMed:8202535). The symporter activity is driven by an inside negative membrane potential and is electrogenic (PubMed:29642010). Is necessary for synaptic signaling of visual-evoked responses from photoreceptors (By similarity).
catalytic activity: L-glutamate(out) = L-glutamate(in) (RHEA:66336)
catalytic activity: chloride(in) = chloride(out) (RHEA:29823)
catalytic activity: 3 Na(+)(out) + phosphate(out) = 3 Na(+)(in) + phosphate(in) (RHEA:71255)
catalytic activity: phosphate(in) = phosphate(out) (RHEA:32823)
catalytic activity: K(+)(in) + H(+)(out) = K(+)(out) + H(+)(in) (RHEA:29467)
subunit: Interacts with SHANK3. - substrates: Cl-, glutamate, phosphate
- DNA methylation of Vesicular Glutamate Transporters in the mesocorticolimbic brain following early-life stress and adult ethanol exposure-an explorative study.
Vrettou, Scientific reports 2021 - GeneRIF: DNA methylation of Vesicular Glutamate Transporters in the mesocorticolimbic brain following early-life stress and adult ethanol exposure-an explorative study.
- Coexpression of VGLUT1 and VGLUT2 in precerebellar neurons in the lateral reticular nucleus of the rat.
Li, Brain research bulletin 2020 (PubMed)- GeneRIF: Coexpression of VGLUT1 and VGLUT2 in precerebellar neurons in the lateral reticular nucleus of the rat.
- Prolactin prevents the kainic acid-induced neuronal loss in the rat hippocampus by inducing prolactin receptor and putatively increasing the VGLUT1 overexpression.
Ortiz-Pérez, Neuroscience letters 2019 (PubMed)- GeneRIF: Study indicates that chronic prolactin administration before kainic acid induced damage induces hippocampal neuroprotection associated with prolactin receptor and VGLUT1 overexpression.
- Quantitative Comparison Of Vesicular Glutamate Transporters in rat Deep Cerebellar Nuclei.
Mao, Neuroscience 2018 (PubMed)- GeneRIF: Study calculated the number and sizes of the labeled boutons and compared them between lateral/dentate nucleus (LN/DN), posterior interposed nucleus (PIN), anterior interposed nucleus (AIN), and medial nucleus (MN). The density of vGluT1+ boutons differs significantly within these nuclei. In contrast, the vGluT2+ bouton density is more similar between different nuclei.
- VGLUT1 or VGLUT2 mRNA-positive neurons in spinal trigeminal nucleus provide collateral projections to both the thalamus and the parabrachial nucleus in rats.
Zhang, Molecular brain 2018 - GeneRIF: dual retrograde tract tracing was used in combination with fluorescence in situ hybridization (FISH) for VGLUT1 or VGLUT2 mRNA to identify the existence of VGLUT1 or VGLUT2 mRNA neurons that send collateral projections to both the thalamus and the parabrachial nucleus.
- Function and expression of a splicing variant of vesicular glutamate transporter 1.
Moriyama, Biochimica et biophysica acta. Biomembranes 2017 (PubMed)- GeneRIF: results indicated that VGLUT1v exists in a functional state in rat photosensitive cells and is involved in glutamatergic chemical transmission
- The effects of unilateral cochlear ablation on the expression of vesicular glutamate transporter 1 in the lower auditory pathway of neonatal rats.
Hasegawa, Auris, nasus, larynx 2017 (PubMed)- GeneRIF: findings indicate that unilateral cochlear ablation suppresses VGLUT1 expression in the central auditory pathways not only ipsilateral but also contralateral to the ablated side.
- Vesicular Glutamate Transporter 1 Knockdown in Infralimbic Prefrontal Cortex Augments Neuroendocrine Responses to Chronic Stress in Male Rats.
Myers, Endocrinology 2017 - GeneRIF: In previously unstressed rats, vGluT1 siRNA significantly enhanced ACTH and corticosterone secretion. Compared with chronic variable stress (CVS) animals receiving the green fluorescent protein control vector, the vGluT1 siRNA further increased basal and stress-induced corticosterone release. Further analysis revealed enhanced adrenal responsiveness in CVS rats treated with vGluT1 siRNA.
- More
- Allosteric Inhibition of a Vesicular Glutamate Transporter by an Isoform-Specific Antibody.
Eriksen, Biochemistry 2021 - “...encoding a plasma membrane-targeted version of rat VGLUT (pmVGLUT) 1, 2, or 3 (Uniprot entries: Q62634, Q9JI12, and Q7TSF2) with 6 L of FugeneHD according to the manufacturers protocol. The next day, the cells were seeded onto 12 mm glass coverslips coated with poly-L-lysine (1 mg/mL)...”
- “...sequence alignment of ECL4-6 from VGLUT1-3 ( PDF ) Accession Codes VGLUT1 (rat): Uniprot entry Q62634. VGLUT2 (rat): Uniprot entry Q9JI12. VGLUT3 (rat): Uniprot entry Q7TSF2. The authors declare no competing financial interest. Complete contact information is available at: https://pubs.acs.org/10.1021/acs.biochem.1c00375 REFERENCES (1) Anne C , and...”
- Identification and characterization of the BRI2 interactome in the brain
Martins, Scientific reports 2018 - “...Q4QRB4 Tubb3 Tubulin beta-3 chain CC, HP, CB Q9QUL6 Nsf Vesicle-fusing ATPase CC, HP, CB Q62634 Slc17a7 Vesicular glutamate transporter 1 CC, HP Q9JI12 Slc17a6 Vesicular glutamate transporter 2 CC O35458 Slc32a1 Vesicular inhibitory amino acid transporter CC, HP P62762 Vsnl1 Visinin-like protein 1 CB Q71RJ2...”
- Environmental enrichment alters protein expression as well as the proteomic response to cocaine in rat nucleus accumbens.
Lichti, Frontiers in behavioral neuroscience 2014 - “...1.90 0.048 S1 Q6PEC4 SKP1 0.91 1.88 0.032 S1 Q9JI12 SLC17A6 4.58 23.87 0.033 S1 Q62634 SLC17A7 4.55 23.43 0.031 S1 Q8BRU6 SLC18A2 0.93 1.91 0.044 S1 Q80ZA5 SLC4A10 3.02 8.10 0.021 3.63 12.37 0.018 3.99 15.90 0.024 S1 P07895 SOD2 0.91 1.88 0.049 S1 Q9CQN6...”
- A combined metabonomic and proteomic approach identifies frontal cortex changes in a chronic phencyclidine rat model in relation to human schizophrenia brain pathology
Wesseling, Neuropsychopharmacology : official publication of the American College of Neuropsychopharmacology 2013 - “...a isoform ST ST Ppp3cc P48455 ST Slc17a7 Q62634 Calmodulin-dependent calcineurin A subunit g isoform Vesicular glutamate transporter 1 T m 1.05 Atp6v1c2 Q6AYE4...”
XP_003465566 vesicular glutamate transporter 1 from Cavia porcellus
25% identity, 36% coverage
VGLU1_HUMAN / Q9P2U7 Vesicular glutamate transporter 1; VGluT1; Brain-specific Na(+)-dependent inorganic phosphate cotransporter; Solute carrier family 17 member 7 from Homo sapiens (Human) (see paper)
TC 2.A.1.14.30 / Q9P2U7 Vesicular glutamate transporter 1, VGluT1 or PNP1 of 560 aas and 12 TMSs. Brain-specific Na+-dependent inorganic phosphate cotransporter; Solute carrier family 17 member 7). Several proteins must be retrieved to the synaptic vesicle before it can export neurotransmitters, and cargo retrieval is a collective cargo-driven process, dependent on VGluT1 from Homo sapiens (see 2 papers)
NP_064705 vesicular glutamate transporter 1 from Homo sapiens
25% identity, 36% coverage
- function: Multifunctional transporter that transports L-glutamate as well as multiple ions such as chloride, proton, potassium, sodium and phosphate (PubMed:10820226). At the synaptic vesicle membrane, mainly functions as an uniporter which transports preferentially L-glutamate but also phosphate from the cytoplasm into synaptic vesicles at presynaptic nerve terminals of excitatory neural cells (By similarity). The L-glutamate or phosphate uniporter activity is electrogenic and is driven by the proton electrochemical gradient, mainly by the electrical gradient established by the vacuolar H(+)-ATPase across the synaptic vesicle membrane (By similarity). In addition, functions as a chloride channel that allows a chloride permeation through the synaptic vesicle membrane that affects the proton electrochemical gradient and promotes synaptic vesicles acidification (By similarity). Moreover, may function as a K(+)/H(+) antiport allowing to maintain the electrical gradient and to decrease chemical gradient and therefore sustain vesicular glutamate uptake (By similarity). The vesicular K(+)/H(+) antiport activity is electroneutral (By similarity). At the plasma membrane, following exocytosis, functions as a symporter of Na(+) and phosphate from the extracellular space to the cytoplasm allowing synaptic phosphate homeostasis regulation (PubMed:10820226). The symporter activity is driven by an inside negative membrane potential and is electrogenic (By similarity). Is necessary for synaptic signaling of visual-evoked responses from photoreceptors (By similarity).
catalytic activity: L-glutamate(out) = L-glutamate(in) (RHEA:66336)
catalytic activity: chloride(in) = chloride(out) (RHEA:29823)
catalytic activity: 3 Na(+)(out) + phosphate(out) = 3 Na(+)(in) + phosphate(in) (RHEA:71255)
catalytic activity: phosphate(in) = phosphate(out) (RHEA:32823)
catalytic activity: K(+)(in) + H(+)(out) = K(+)(out) + H(+)(in) (RHEA:29467)
subunit: Interacts with SHANK3. - substrates: Na+, glutamate, phosphate
tcdb comment: The amino-terminal and carboxyl-terminal regions of VGLUT2 in membranes face the cytoplasm (Jung et al. 2006). It is involved in nervous system diseases (Du et al. 2020). VGLUT1 and VGLUT2, selectively label and define functionally distinct neuronal subpopulations at each relay level of the neural hierarchies comprising spinal and trigeminal sensory systems (Zhang et al. 2018) - Structural bioinformatics studies of glutamate transporters and their AlphaFold2 predicted water-soluble QTY variants and uncovering the natural mutations of L->Q, I->T, F->Y and Q->L, T->I and Y->F.
Karagöl, PloS one 2024 - “...accession numbers for the EAATs 14, VGLUTs 13, and YLAT2 are P43003, P43004, P43005, P48664, Q9P2U7, Q9P2U8, Q8NDX2, and Q92536, respectively. The sequences were available from UniProt [ 24 ]. The QTY code was applied to transmembrane alpha-helices of each protein sequence, using the topological information...”
- Proteomic Characterization of the Olfactory Molecular Imbalance in Dementia with Lewy Bodies
Lachén-Montes, International journal of molecular sciences 2020 - “...amino acid transporter SLC32A1 Q9H598 6 0.6816 2.3798 10 10 Vesicular glutamate transporter 1 SLC17A7 Q9P2U7 2 0.6818 2.7575 10 11 Plasma membrane calcium-transporting ATPase 3 ATP2B3 Q16720 2 0.686 4.3062 10 9 E3 ubiquitin-protein ligase MYCBP2 MYCBP2 O75592 2 0.6862 3.7771 10 10 Syntaxin-1A STX1A...”
- THE CONCISE GUIDE TO PHARMACOLOGY 2017/18: Transporters
Alexander, British journal of pharmacology 2017 - “...transporter 2 Vesicular glutamate transporter 3 Systematic nomenclature SLC17A7 SLC17A6 SLC17A8 HGNC, UniProt SLC17A7 , Q9P2U7 SLC17A6 , Q9P2U8 SLC17A8 , Q8NDX2 Common abreviation VGLUT1 VGLUT2 VGLUT3 Endogenous substrates Lglutamic acid > Dglutamic acid Lglutamic acid > Dglutamic acid Lglutamic acid > Dglutamic acid Stoichiometry Unknown...”
- The Concise Guide to PHARMACOLOGY 2015/16: Transporters
Alexander, British journal of pharmacology 2015 - “...3 Systematic nomenclature SLC17A7 SLC17A6 SLC17A8 Common abreviation VGLUT1 VGLUT2 VGLUT3 HGNC, UniProt SLC17A7 , Q9P2U7 SLC17A6 , Q9P2U8 SLC17A8 , Q8NDX2 Endogenous substrates Lglutamic acid > Dglutamic acid Lglutamic acid > Dglutamic acid Lglutamic acid > Dglutamic acid Stoichiometry Unknown Unknown Unknown Comments Endogenous ketoacids...”
- Amyloid beta a4 precursor protein-binding family B member 1 (FE65) interactomics revealed synaptic vesicle glycoprotein 2A (SV2A) and sarcoplasmic/endoplasmic reticulum calcium ATPase 2 (SERCA2) as new binding proteins in the human brain.
Nensa, Molecular & cellular proteomics : MCP 2014 - The Concise Guide to PHARMACOLOGY 2013/14: transporters
Alexander, British journal of pharmacology 2013 - “...transporter 3 Systematic nomenclature SLC17A7 SLC17A6 SLC17A8 Common abbreviation VGLUT1 VGLUT2 VGLUT3 HGNC, UniProt SLC17A7, Q9P2U7 SLC17A6, Q9P2U8 SLC17A8, Q8NDX2 Endogenous substrates L-glutamic acid > D-glutamic acid L-glutamic acid > D-glutamic acid L-glutamic acid > D-glutamic acid Stoichiometry Unknown Unknown Unknown Comments Endogenous ketoacids produced during...”
- Functionally important amino acids in the Arabidopsis thylakoid phosphate transporter: homology modeling and site-directed mutagenesis.
Ruiz-Pavón, Biochemistry 2010 - “...of Arabidopsis ANTR1 (UniProt O82390), sialin from human (Q9NRA2), vesicular glutamate transporters VGLUT13 from human (Q9P2U7, Q9P2U8, Q8NDX2), and Na + /P i cotransporters NPT1 and NPT3 from human (Q14916 and O00624) and NPT4 from rat (Q8CJH9) were aligned using MUSCLE. The five mutated residues are...”
- A proline-rich motif on VGLUT1 reduces synaptic vesicle super-pool and spontaneous release frequency.
Zhang, eLife 2019 - GeneRIF: In mammals, VGLUT1 gained a proline-rich sequence that recruits endophilinA1 and turns the transporter into a regulator of synaptic vesicles organization and spontaneous release.
- Network-based analysis of oligodendrogliomas predicts novel cancer gene candidates within the region of the 1p/19q co-deletion.
Gladitz, Acta neuropathologica communications 2018 - GeneRIF: The findings of this study indicate that Slc17A7 located on 1p/19q may simultaneously influence tumor development.
- JNK: A Putative Link Between Insulin Signaling and VGLUT1 in Alzheimer's Disease.
Rodriguez-Perdigon, Journal of Alzheimer's disease : JAD 2016 (PubMed)- GeneRIF: Results suggest that activation of JNK in Alzheimer's disease (AD) inhibits insulin signaling which could lead to a decreased expression of VGLUT1, therefore contributing to the glutamatergic deficit in AD
- Genetic variation in SLC17A7 promoter associated with response to sport-related concussions.
Madura, Brain injury 2016 (PubMed)- GeneRIF: This study was the first to demonstrate an association between genetic polymorphism at rs7417284 SNP in the promoter region of the SLC17A7 gene and concussion severity and duration. Based upon these findings, rs74174284 is a potential predictive genetic marker for identifying athletes who are more susceptible for altered recovery times and worse motor speed ImPACT scores after sport-related concussion.
- Down-regulation of glutamatergic terminals (VGLUT1) driven by Aβ in Alzheimer's disease.
Rodriguez-Perdigon, Hippocampus 2016 (PubMed)- GeneRIF: Study revealed susceptibility of glutamatergic nerve terminals to Abeta induced toxicity and underlined the importance of VGLUT1 in the progression of Alzheimer's disease, as the decrease of this protein levels could increase the susceptibility to subsequent deleterious inputs by exacerbating Abeta induced neuroinflammation and synaptic plasticity disruption.
- Global analysis of H3K4me3 and H3K27me3 profiles in glioblastoma stem cells and identification of SLC17A7 as a bivalent tumor suppressor gene.
Lin, Oncotarget 2015 - GeneRIF: Loss of SLC17A7 expression is associated with glioblastoma.
- Glutamatergic and GABAergic innervation of human gonadotropin-releasing hormone-I neurons.
Hrabovszky, Endocrinology 2012 (PubMed)- GeneRIF: Data indicate that GABAergic axons were labeled with vesicular inhibitory aa transporter (VIAAT) antibodies, whereas glutamatergic axons were detected with antisera against the major vesicular glutamate transporter (VGLUT) isoforms, VGLUT1 and VGLUT2.
- Alterations in the expression of PSA-NCAM and synaptic proteins in the dorsolateral prefrontal cortex of psychiatric disorder patients.
Gilabert-Juan, Neuroscience letters 2012 (PubMed)- GeneRIF: Depressed patients showed significant decreases in synaptophysin (SYN) and VGLUT1 expression, whereas in bipolar patients, decreases in VGLUT1 expression have also been found.
- More
NP_001076304 vesicular glutamate transporter 3 from Danio rerio
24% identity, 40% coverage
AWY96_RS05485 MFS transporter from Serratia plymuthica
24% identity, 63% coverage
VGL2A_DANRE / Q5W8I8 Vesicular glutamate transporter 2.1; Protein blumenkohl; Solute carrier family 17 member 6-B; Vesicular glutamate transporter 2-A from Danio rerio (Zebrafish) (Brachydanio rerio) (see 3 papers)
23% identity, 40% coverage
- function: Multifunctional transporter that transports L-glutamate as well as multiple ions such as chloride, proton, potassium, sodium and phosphate. At the synaptic vesicle membrane, mainly functions as a uniporter which transports preferentially L-glutamate but also, phosphate from the cytoplasm into synaptic vesicles at presynaptic nerve terminals of excitatory neural cells. The L-glutamate or phosphate uniporter activity is electrogenic and is driven by the proton electrochemical gradient, mainly by the electrical gradient established by the vacuolar H(+)-ATPase across the synaptic vesicle membrane. In addition, functions as a chloride channel that allows a chloride permeation through the synaptic vesicle membrane therefore affects the proton electrochemical gradient and promotes synaptic vesicles acidification. Moreover, functions as a vesicular K(+)/H(+) antiport allowing to maintain the electrical gradient and to decrease chemical gradient and therefore sustain vesicular L-glutamate uptake. The vesicular H(+)/H(+) antiport activity is electroneutral. At the plasma membrane, following exocytosis, functions as a symporter of Na(+) and phosphate from the extracellular space to the cytoplasm allowing synaptic phosphate homeostasis regulation. The symporter activity is driven by an inside negative membrane potential and is electrogenic (By similarity). Also involved in the regulation of retinal hyaloid vessel regression during postnatal development (By similarity). May also play a role in the endocrine L-glutamatergic system of other tissues such as pineal gland and pancreas (By similarity). Required for glutamate release by retinotectal synapses and visual acuity (PubMed:17196531).
catalytic activity: L-glutamate(out) = L-glutamate(in) (RHEA:66336)
catalytic activity: 3 Na(+)(out) + phosphate(out) = 3 Na(+)(in) + phosphate(in) (RHEA:71255)
catalytic activity: phosphate(in) = phosphate(out) (RHEA:32823)
catalytic activity: K(+)(in) + H(+)(out) = K(+)(out) + H(+)(in) (RHEA:29467)
catalytic activity: chloride(in) = chloride(out) (RHEA:29823)
NP_001092225 solute carrier family 17 member 7a from Danio rerio
26% identity, 33% coverage
- l(2)01810 is a novel type of glutamate transporter that is responsible for megamitochondrial formation
Shim, The Biochemical journal 2011 - “...(NP_036120), Hsap xCT (NP_055146), Dmel l(2)01810 (NP_620115), Dmel VGLUT (NP_608681), Cele eat-4 (NP_499023), Drer SLC17a7 (NP_001092225), Hsap VGLUT1 (NP_064705), Rnor VGLUT1 (NP_446311), Dmel arala1 (NP_733365), Cele Q21153 (NP_497274), Drer SLC25a12 (NP_997947), Mmus aralar1 (NP_766024) and Hsap aralar1 (NP_003696). All amino acid sequences in FASTA format were...”
- Vesicular glutamate transporter 3 is required for synaptic transmission in zebrafish hair cells.
Obholzer, The Journal of neuroscience : the official journal of the Society for Neuroscience 2008 - GeneRIF: Vesicular glutamate transporter 3 is expressed preferentially in hair cells of the ear, and is required for synaptic transmission in the hair cells in zebrafish.
LOC101266861 sodium-dependent phosphate transport protein 1, chloroplastic from Solanum lycopersicum
22% identity, 65% coverage
- Transcriptome Analysis to Explore the Cause of the Formation of Different Inflorescences in Tomato
Yang, International journal of molecular sciences 2022 - “...LOC101255274 8.92 8.65 Chloroplastic 101258716 LOC101258716 2.11 1.91 Chloroplastic 101261442 LOC101261442 1.12 1.16 Chloroplastic 101266861 LOC101266861 1.08 1.56 Chloroplastic 104649068 LOC104649068 1.26 1.3 F-box 112940016 LOC112940016 6.79 6.53 F-box 101250115 LOC101250115 12.31 12.13 F-box 101244792 LOC101244792 9.56 9.4 F-box family protein 101261682 LOC101261682 3.65 5.77 F-box...”
S17A5_HUMAN / Q9NRA2 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Membrane glycoprotein HP59; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Homo sapiens (Human) (see 10 papers)
TC 2.A.1.14.10 / Q9NRA2 Lysosomal sialate transporter (Salla disease and infantile sialate storage disease protein (Morin et al., 2004)). Also transports glucuronic acid and aspartate. Structure-function studies have identify crucial residues and substrate-induced conformational changes (Courville et al., 2010). Also called SLC17A5. The substrate binding pocket has been identified based on modeling studies (see 8 papers)
23% identity, 64% coverage
- function: Multifunctional anion transporter that operates via two distinct transport mechanisms, namely proton-coupled anion cotransport and membrane potential-dependent anion transport (PubMed:15510212, PubMed:21781115, PubMed:22778404, PubMed:23889254). Electroneutral proton-coupled acidic monosaccharide symporter, with a sugar to proton stoichiometry of 1:1. Exports glucuronic acid and free sialic acid derived from sialoglycoconjugate degradation out of lysosomes, driven by outwardly directed lysosomal pH gradient. May regulate lysosome function and metabolism of sialylated conjugates that impact oligodendrocyte lineage differentiation and myelinogenesis in the central nervous system (By similarity) (PubMed:15510212, PubMed:21781115, PubMed:22778404, PubMed:23889254). Electrogenic proton-coupled nitrate symporter that transports nitrate ions across the basolateral membrane of salivary gland acinar cells, with nitrate to proton stoichiometry of 2:1. May contribute to nitrate clearance from serum by salivary glands, where it is further concentrated and secreted in the saliva (PubMed:22778404). Uses membrane potential to drive the uptake of acidic amino acids and peptides into synaptic vesicles. Responsible for synaptic vesicular storage of L-aspartate and L-glutamate in pinealocytes as well as vesicular uptake of N-acetyl-L- aspartyl-L-glutamate neuropeptide, relevant to aspartegic-associated glutamatergic neurotransmission and activation of metabotropic receptors that inhibit subsequent transmitter release (By similarity) (PubMed:21781115, PubMed:22778404, PubMed:23889254).
function: Receptor for CM101, a polysaccharide produced by group B Streptococcus with antipathoangiogenic properties.
catalytic activity: N-acetylneuraminate(in) + H(+)(in) = N-acetylneuraminate(out) + H(+)(out) (RHEA:28987)
catalytic activity: D-glucuronate(out) + H(+)(out) = D-glucuronate(in) + H(+)(in) (RHEA:72591)
catalytic activity: 2 nitrate(out) + H(+)(out) = 2 nitrate(in) + H(+)(in) (RHEA:71539)
catalytic activity: L-aspartate(out) = L-aspartate(in) (RHEA:66332)
catalytic activity: L-glutamate(out) = L-glutamate(in) (RHEA:66336)
catalytic activity: N-acetyl-L-aspartyl-L-glutamate(out) = N-acetyl-L-aspartyl-L- glutamate(in) (RHEA:72599) - substrates: Sialic acid
tcdb comment: NAAG (N-acetylaspartylglutamate) an abundant neuropeptide in the vertebrate nervous system that is released from synaptic terminals in a calcium-dependent manner and acts as an agonist at the typeII metabotropic glutamate receptor mGluR3, is transported into synaptic vesicles before it is secreted.Lodder-Gadaczek et al. 2013 demonstrate that vesicular uptake of NAAG and the related peptide NAAG2 (N-acetylaspartylglutamylglutamate) is mediated by sialin (SLC17A5). Sialin is probably the only vesicular transporter for NAAG and NAAG2, because transport of both peptides was not detectable in vesicles isolated from sialin-deficient mice. Sialin also transports nitrate in the plasma membrane of salivary glands (Qin et al. 2012) - The molecular mechanism of sialic acid transport mediated by Sialin.
Hu, Science advances 2023 - “...answer these questions. MATERIALS AND METHODS Protein expression and purification The full-length human Sialin (UniProt: Q9NRA2) was cloned into a pFastBac vector (Thermo Fisher Scientific) with an N-terminal His-tag and a thrombin digestion site. Three predicted N-linked glycosylation sites were abolished by site-directed mutagenesis (N71A, N77A,...”
- Acute Intravenous NaCl and Volume Expansion Reduces Sodium-Chloride Cotransporter Abundance and Phosphorylation in Urinary Extracellular Vesicles.
Wu, Kidney360 2022 - RNA-Sequencing of Heterorhabditis nematodes to identify factors involved in symbiosis with Photorhabdus bacteria.
Bhat, BMC genomics 2022 - “...(O16850) 69. pgp-1 (P34712) 30. elt-2 (Q10655) 70. pgp-3 (P34713) 31. pnr (P52168) 71. SLC17A5 (Q9NRA2) 32. fos-1 (G5ECG2) 72. aqp-10 (Q09369) 33. TFEB (P19484) 73. AQP3 (Q08DE6) 34. PAX5 (Q02548) Mucosa associated protein Phospholipases (lipolytic) 74. MALT1 (Q9UDY8) 35. PLA2G1B (P00593) 75. Cad99C (Q9VAF5) 36....”
- TMT-based proteomic analysis reveals the effects of chloroquine on human podocytes.
Kang, American journal of translational research 2020 - Dietary Nitrate from Beetroot Juice for Hypertension: A Systematic Review.
Bonilla, Biomolecules 2018 - “...an electrogenic 2NO 3 /H + symporter called SLC17A5 (also known as sialin, UniProt ID: Q9NRA2) in the salivary gland acinar cells [ 14 ]. Both dietary and saliva NO 3 , and its reduced forms NO 2 and NO, enter directly to systemic circulation after...”
- THE CONCISE GUIDE TO PHARMACOLOGY 2017/18: Transporters
Alexander, British journal of pharmacology 2017 - “...further following export from the lysosome. Nomenclature Sialin Systematic nomenclature SLC17A5 HGNC, UniProt SLC17A5 , Q9NRA2 Common abreviation AST Endogenous substrates Llactic acid , gluconate (out), Lglutamic acid (in) [ 387 ], glucuronic acid , Laspartic acid [ 387 ], sialic acid Stoichiometry 1 H +...”
- The Concise Guide to PHARMACOLOGY 2015/16: Transporters
Alexander, British journal of pharmacology 2015 - “...from the lysosome. Nomenclature Sialin Systematic nomenclature SLC17A5 Common abreviation AST HGNC, UniProt SLC17A5 , Q9NRA2 Endogenous substrates Llactic acid , gluconate (out), Lglutamic acid (in) [ 349 ], glucuronic acid , Laspartic acid [ 349 ], sialic acid Stoichiometry 1 H + : 1 sialic...”
- The Concise Guide to PHARMACOLOGY 2013/14: transporters
Alexander, British journal of pharmacology 2013 - “...export from the lysosome. Nomenclature Sialin Systematic nomenclature SLC17A5 Common abbreviation AST HGNC, UniProt SLC17A5, Q9NRA2 Endogenous substrates L-glutamic acid (in) 277 , L-lactic acid, L-aspartic acid 277 , gluconate (out), sialic acid, glucuronic acid Stoichiometry 1 H + : 1 sialic acid (out) Comments Loss-of-function...”
- More
NP_001161855 vesicular glutamate transporter 2 from Gallus gallus
23% identity, 40% coverage
VK055_3555 MFS transporter from Klebsiella pneumoniae subsp. pneumoniae
21% identity, 92% coverage
XP_063112846 vesicular glutamate transporter 2 isoform X1 from Cavia porcellus
25% identity, 34% coverage
VGLU2_HUMAN / Q9P2U8 Vesicular glutamate transporter 2; VGluT2; Differentiation-associated BNPI; Differentiation-associated Na(+)-dependent inorganic phosphate cotransporter; Solute carrier family 17 member 6 from Homo sapiens (Human) (see 2 papers)
TC 2.A.1.14.31 / Q9P2U8 Vesicular glutamate transporter 2 (VGluT2) (Differentiation-associated BNPI) (Differentiation-associated Na(+)-dependent inorganic phosphate cotransporter) (Solute carrier family 17 member 6) from Homo sapiens (see 5 papers)
NP_065079 vesicular glutamate transporter 2 from Homo sapiens
25% identity, 34% coverage
- function: Multifunctional transporter that transports L-glutamate as well as multiple ions such as chloride, proton, potassium, sodium and phosphate (PubMed:11698620, PubMed:33440152). At the synaptic vesicle membrane, mainly functions as a uniporter which transports preferentially L-glutamate but also, phosphate from the cytoplasm into synaptic vesicles at presynaptic nerve terminals of excitatory neural cells (PubMed:11698620). The L-glutamate or phosphate uniporter activity is electrogenic and is driven by the proton electrochemical gradient, mainly by the electrical gradient established by the vacuolar H(+)-ATPase across the synaptic vesicle membrane (PubMed:11698620). In addition, functions as a chloride channel that allows the chloride permeation through the synaptic vesicle membrane therefore affects the proton electrochemical gradient and promotes synaptic vesicles acidification (By similarity). Moreover, functions as a vesicular K(+)/H(+) antiport allowing to maintain the electrical gradient and to decrease chemical gradient and therefore sustain vesicular glutamate uptake (By similarity). The vesicular H(+)/H(+) antiport activity is electroneutral (By similarity). At the plasma membrane, following exocytosis, functions as a symporter of Na(+) and phosphate from the extracellular space to the cytoplasm allowing synaptic phosphate homeostasis regulation (Probable) (PubMed:10820226). The symporter activity is driven by an inside negative membrane potential and is electrogenic (Probable). Also involved in the regulation of retinal hyaloid vessel regression during postnatal development (By similarity). May also play a role in the endocrine glutamatergic system of other tissues such as pineal gland and pancreas (By similarity).
catalytic activity: L-glutamate(out) = L-glutamate(in) (RHEA:66336)
catalytic activity: 3 Na(+)(out) + phosphate(out) = 3 Na(+)(in) + phosphate(in) (RHEA:71255)
catalytic activity: phosphate(in) = phosphate(out) (RHEA:32823)
catalytic activity: K(+)(in) + H(+)(out) = K(+)(out) + H(+)(in) (RHEA:29467)
catalytic activity: chloride(in) = chloride(out) (RHEA:29823) - substrates: Na+, glutamate, phosphate
- Brain Proteome Profiling Reveals Common and Divergent Signatures in Parkinson's Disease, Multiple System Atrophy, and Progressive Supranuclear Palsy
Dick, Molecular neurobiology 2025 - “...P35908 0.367 4.0910 03 3.0110 02 SYT2 Q8N9I0 0.359 8.2710 06 4.1410 0 4 SLC17A6 Q9P2U8 0.329 1.0910 09 5.0110 07 CDIP1 Q9H305 0.316 3.0910 06 2.1810 04 CHGA P10645 0.314 9.8210 13 1.3610 09 VGF O15240 0.31 7.0310 08 1.1210 05 CLDN11 O75508 0.307 4.8410...”
- Structural bioinformatics studies of glutamate transporters and their AlphaFold2 predicted water-soluble QTY variants and uncovering the natural mutations of L->Q, I->T, F->Y and Q->L, T->I and Y->F.
Karagöl, PloS one 2024 - “...numbers for the EAATs 14, VGLUTs 13, and YLAT2 are P43003, P43004, P43005, P48664, Q9P2U7, Q9P2U8, Q8NDX2, and Q92536, respectively. The sequences were available from UniProt [ 24 ]. The QTY code was applied to transmembrane alpha-helices of each protein sequence, using the topological information and...”
- THE CONCISE GUIDE TO PHARMACOLOGY 2017/18: Transporters
Alexander, British journal of pharmacology 2017 - “...glutamate transporter 3 Systematic nomenclature SLC17A7 SLC17A6 SLC17A8 HGNC, UniProt SLC17A7 , Q9P2U7 SLC17A6 , Q9P2U8 SLC17A8 , Q8NDX2 Common abreviation VGLUT1 VGLUT2 VGLUT3 Endogenous substrates Lglutamic acid > Dglutamic acid Lglutamic acid > Dglutamic acid Lglutamic acid > Dglutamic acid Stoichiometry Unknown Unknown Unknown Comments...”
- The Concise Guide to PHARMACOLOGY 2015/16: Transporters
Alexander, British journal of pharmacology 2015 - “...SLC17A7 SLC17A6 SLC17A8 Common abreviation VGLUT1 VGLUT2 VGLUT3 HGNC, UniProt SLC17A7 , Q9P2U7 SLC17A6 , Q9P2U8 SLC17A8 , Q8NDX2 Endogenous substrates Lglutamic acid > Dglutamic acid Lglutamic acid > Dglutamic acid Lglutamic acid > Dglutamic acid Stoichiometry Unknown Unknown Unknown Comments Endogenous ketoacids produced during fasting...”
- Genetically identified spinal interneurons integrating tactile afferents for motor control.
Bui, Journal of neurophysiology 2015 - The Concise Guide to PHARMACOLOGY 2013/14: transporters
Alexander, British journal of pharmacology 2013 - “...Systematic nomenclature SLC17A7 SLC17A6 SLC17A8 Common abbreviation VGLUT1 VGLUT2 VGLUT3 HGNC, UniProt SLC17A7, Q9P2U7 SLC17A6, Q9P2U8 SLC17A8, Q8NDX2 Endogenous substrates L-glutamic acid > D-glutamic acid L-glutamic acid > D-glutamic acid L-glutamic acid > D-glutamic acid Stoichiometry Unknown Unknown Unknown Comments Endogenous ketoacids produced during fasting have...”
- Functionally important amino acids in the Arabidopsis thylakoid phosphate transporter: homology modeling and site-directed mutagenesis.
Ruiz-Pavón, Biochemistry 2010 - “...Arabidopsis ANTR1 (UniProt O82390), sialin from human (Q9NRA2), vesicular glutamate transporters VGLUT13 from human (Q9P2U7, Q9P2U8, Q8NDX2), and Na + /P i cotransporters NPT1 and NPT3 from human (Q14916 and O00624) and NPT4 from rat (Q8CJH9) were aligned using MUSCLE. The five mutated residues are indicated...”
- Roles of VGLUT2 and Dopamine/Glutamate Co-Transmission in Selective Vulnerability to Dopamine Neurodegeneration.
Buck, ACS chemical neuroscience 2022 - GeneRIF: Roles of VGLUT2 and Dopamine/Glutamate Co-Transmission in Selective Vulnerability to Dopamine Neurodegeneration.
- Regulating nociceptive transmission by VGluT2-expressing spinal dorsal horn neurons.
Wang, Journal of neurochemistry 2018 - GeneRIF: These findings indicate that VGluT2-expressing excitatory neurons play a crucial role in mediating nociceptive transmission in the spinal dorsal horn
- Uncovering the role of the nucleus accumbens in schizophrenia: A postmortem analysis of tyrosine hydroxylase and vesicular glutamate transporters.
McCollum, Schizophrenia research 2015 - GeneRIF: This study demonstrated that Protein levels of vGLUT2 were significantly increased in schizophrenia subjects compared to controls.
- Neuronal activity regulates remyelination via glutamate signalling to oligodendrocyte progenitors.
Gautier, Nature communications 2015 - GeneRIF: Vglut2 and oligodendrocyte progenitor cells co-localize in multiple sclerosis lesions, supporting evidence that neuronal activity and release of glutamate instruct OPCs to differentiate into new myelinating oligodendrocytes that recover lost function.
- Role of glutamatergic projections from ventral tegmental area to lateral habenula in aversive conditioning.
Root, The Journal of neuroscience : the official journal of the Society for Neuroscience 2014 - GeneRIF: There is a glutamatergic signal from ventral tegmental area VGluT2-habenular neurons that plays a role in aversive conditioning.
- Multimodal use of calcitonin gene-related peptide and substance P in itch and acute pain uncovered by the elimination of vesicular glutamate transporter 2 from transient receptor potential cation channel subfamily V member 1 neurons.
Rogoz, The Journal of neuroscience : the official journal of the Society for Neuroscience 2014 - GeneRIF: Itch is regulated by VGLUT2-mediated transmission in neurons via Trpv1.
- Distribution of vesicular glutamate transporter 2 (VGluT2) in the primary visual cortex of the macaque and human.
Garcia-Marin, The Journal of comparative neurology 2013 - GeneRIF: This study demonistrated that Distribution of vesicular glutamate transporter 2 (VGluT2) in the primary visual cortex(V1 area)
- Glutamatergic and GABAergic innervation of human gonadotropin-releasing hormone-I neurons.
Hrabovszky, Endocrinology 2012 (PubMed)- GeneRIF: Data indicate that GABAergic axons were labeled with vesicular inhibitory aa transporter (VIAAT) antibodies, whereas glutamatergic axons were detected with antisera against the major vesicular glutamate transporter (VGLUT) isoforms, VGLUT1 and VGLUT2.
- More
VGLU2_MOUSE / Q8BLE7 Vesicular glutamate transporter 2; VGluT2; Differentiation-associated BNPI; Differentiation-associated Na(+)-dependent inorganic phosphate cotransporter; Solute carrier family 17 member 6 from Mus musculus (Mouse) (see 9 papers)
25% identity, 34% coverage
- function: Multifunctional transporter that transports L-glutamate as well as multiple ions such as chloride, proton, potassium, sodium and phosphate (PubMed:11432869, PubMed:17108179, PubMed:25433636, PubMed:33440152). At the synaptic vesicle membrane, mainly functions as a uniporter which transports preferentially L-glutamate but also, phosphate from the cytoplasm into synaptic vesicles at presynaptic nerve terminals of excitatory neural cells (PubMed:11432869, PubMed:17108179). The L-glutamate or phosphate uniporter activity is electrogenic and is driven by the proton electrochemical gradient, mainly by the electrical gradient established by the vacuolar H(+)- ATPase across the synaptic vesicle membrane (PubMed:11432869). In addition, functions as a chloride channel that allows a chloride permeation through the synaptic vesicle membrane therefore affects the proton electrochemical gradient and promotes synaptic vesicles acidification (By similarity). Moreover, functions as a vesicular K(+)/H(+) antiport allowing to maintain the electrical gradient and to decrease chemical gradient and therefore sustain vesicular glutamate uptake (PubMed:25433636). The vesicular H(+)/H(+) antiport activity is electroneutral (PubMed:25433636). At the plasma membrane, following exocytosis, functions as a symporter of Na(+) and phosphate from the extracellular space to the cytoplasm allowing synaptic phosphate homeostasis regulation (PubMed:33440152). The symporter activity is driven by an inside negative membrane potential and is electrogenic (PubMed:33440152). Also involved in the regulation of retinal hyaloid vessel regression during postnatal development (PubMed:30936473). May also play a role in the endocrine glutamatergic system of other tissues such as pineal gland and pancreas (By similarity).
catalytic activity: L-glutamate(out) = L-glutamate(in) (RHEA:66336)
catalytic activity: K(+)(in) + H(+)(out) = K(+)(out) + H(+)(in) (RHEA:29467)
catalytic activity: 3 Na(+)(out) + phosphate(out) = 3 Na(+)(in) + phosphate(in) (RHEA:71255)
catalytic activity: phosphate(in) = phosphate(out) (RHEA:32823)
catalytic activity: chloride(in) = chloride(out) (RHEA:29823)
disruption phenotype: Mice exhibit an elevated rate of perinatal lethality (PubMed:17108179). Surviving animals display a strong reduction in evoked glutamergic responses in thalamic neurons (PubMed:17108179). Reduction of protein level in homozygous and heterozygous knockouts leads to a graded reduction in the amplitude of the postsynaptic response to single vesicle fusion in thalamic neurons, consistent with a role for this protein in determining quantal size (PubMed:17108179). Decrease in the number of retinal hyaloid vessels at postnatal day 8 as a result of precocious regression (PubMed:30936473). - The amyloid peptide β disrupts intercellular junctions and increases endothelial permeability in a NADPH oxidase 1-dependent manner.
Tarafdar, Redox biology 2022 - “...protein 1 Stxbp1 0.0008032 P61264 Syntaxin-1B Stx1b 0.0035973 Q62442 Vesicle-associated membrane protein 1 Vamp1 0.0043429 Q8BLE7 Vesicular glutamate transporter 2 Slc17a6 0.0049574 Q63959 Potassium voltage-gated channel subfamily C member 3 Kcnc3 0.0168435 P12961 Neuroendocrine protein 7B2 Scg5 0.0087150 Q9JIS5 Synaptic vesicle glycoprotein 2A Sv2a 0.0192159 O35633...”
- Tuning of Glutamate, But Not GABA, Release by an Intrasynaptic Vesicle APP Domain Whose Function Can Be Modulated by β- or α-Secretase Cleavage.
Yao, The Journal of neuroscience : the official journal of the Society for Neuroscience 2019 - Sex-Specific Differences in Oxytocin Receptor Expression and Function for Parental Behavior.
Mitre, Gender and the genome 2017 - Label-Free Neuroproteomics of the Hippocampal-Accumbal Circuit Reveals Deficits in Neurotransmitter and Neuropeptide Signaling in Mice Lacking Ethanol-Sensitive Adenosine Transporter.
Oliveros, Journal of proteome research 2017 - “...degradation 1.51 9.0 10 6 P61922 GABA-T GABA transaminase Glu degradation 1.73 1.1 10 2 Q8BLE7 SLC17A6 VGLUT2 Glu receptor signaling 1.66 1.5 10 5 P23819 GRIA2 AMPA2, glutamate lonotropic receptor Glu receptor signaling 1.41 5.0 10 3 P03995 GFAP glial fibrillary acidic protein Glu receptor...”
- Alterations in the cerebellar (Phospho)proteome of a cyclic guanosine monophosphate (cGMP)-dependent protein kinase knockout mouse
Corradini, Molecular & cellular proteomics : MCP 2014 - “...P70699 Q61553 P07356 Q80TL4 O89026 O08532 Q5RJG7 O35633 Q8BLE7 Q9EQF6 A2ALU4 O55091 Q61599 P36552 Q3UUG6 Q66L44 Q922J6 Q8BR92 Q9CX80 Q8BYJ6 Q99JP6 Q69ZX8 Q8BYR5...”
A9X190 Solute carrier family 17 member 5 from Papio anubis
23% identity, 64% coverage
NP_543129 vesicular glutamate transporter 2 isoform 1 from Mus musculus
25% identity, 34% coverage
- VGLUT2 and APP family: unraveling the neurobiochemical mechanisms of neurostimulation therapy to STZ-induced diabetes and neuropathy.
Zhang, Frontiers in endocrinology 2024 - GeneRIF: VGLUT2 and APP family: unraveling the neurobiochemical mechanisms of neurostimulation therapy to STZ-induced diabetes and neuropathy.
- Anatomical distribution of µ-opioid receptors, neurokinin-1 receptors, and vesicular glutamate transporter 2 in the mouse brainstem respiratory network.
Furdui, Journal of neurophysiology 2024 (PubMed)- GeneRIF: Anatomical distribution of micro-opioid receptors, neurokinin-1 receptors, and vesicular glutamate transporter 2 in the mouse brainstem respiratory network.
- Vglut2-based glutamatergic signaling in central noradrenergic neurons is dispensable for normal breathing and chemosensory reflexes.
Chang, eLife 2024 - GeneRIF: Vglut2-based glutamatergic signaling in central noradrenergic neurons is dispensable for normal breathing and chemosensory reflexes.
- Increase of vesicular glutamate transporter 2 co-expression in the deep cerebellar nuclei related to skilled reach learning.
Mao, Brain research 2022 (PubMed)- GeneRIF: Increase of vesicular glutamate transporter 2 co-expression in the deep cerebellar nuclei related to skilled reach learning.
- Efferent projections of Vglut2, Foxp2, and Pdyn parabrachial neurons in mice.
Huang, The Journal of comparative neurology 2021 - GeneRIF: Efferent projections of Vglut2, Foxp2, and Pdyn parabrachial neurons in mice.
- Activation of VGluT2-expressing neurons in the bed nuclei of the stria terminalis produces mouse manic-like behaviors.
Liu, CNS neuroscience & therapeutics 2021 - GeneRIF: Activation of VGluT2-expressing neurons in the bed nuclei of the stria terminalis produces mouse manic-like behaviors.
- Deletion of VGLUT2 in midbrain dopamine neurons attenuates dopamine and glutamate responses to methamphetamine in mice.
Shen, Pharmacology, biochemistry, and behavior 2021 - GeneRIF: Deletion of VGLUT2 in midbrain dopamine neurons attenuates dopamine and glutamate responses to methamphetamine in mice.
- Posterodorsal Medial Amygdala Regulation of Female Social Behavior: GABA versus Glutamate Projections.
Johnson, The Journal of neuroscience : the official journal of the Society for Neuroscience 2021 - GeneRIF: Posterodorsal Medial Amygdala Regulation of Female Social Behavior: GABA versus Glutamate Projections.
- More
ANTR1_ARATH / O82390 Sodium-dependent phosphate transport protein 1, chloroplastic; Anion transporter 1; Na(+)/PI cotransporter 1; Phosphate transporter PHT4;1; Sodium/phosphate cotransporter 1 from Arabidopsis thaliana (Mouse-ear cress) (see 4 papers)
O82390 ABC-type phosphate transporter (EC 7.3.2.1) from Arabidopsis thaliana (see 2 papers)
TC 2.A.1.14.22 / O82390 The chloroplast thylakoid Na+:phosphate symporter, ANTR1 (512aas) (Pavón et al., 2008). Residues essential for function have been identified from Arabidopsis thaliana (see 7 papers)
AT2G29650, NP_180526 PHT4;1; carbohydrate transmembrane transporter/ inorganic diphosphate transmembrane transporter/ inorganic phosphate transmembrane transporter/ organic anion transmembrane transporter/ sugar:hydrogen symporter from Arabidopsis thaliana
NP_180526 phosphate transporter 4;1 from Arabidopsis thaliana
20% identity, 91% coverage
- function: Specific for inorganic phosphate transport across the thylakoid membrane in a sodium dependent manner. Binds glutamate but cannot transport it. May act as an ascorbate transporter at the thylakoid membrane (Probable).
- substrates: Na+, phosphate
- Chloroplast phosphate transporter CrPHT4-7 regulates phosphate homeostasis and photosynthesis in Chlamydomonas
Tóth, Plant physiology 2024 - “...A. thaliana PHT4;1 , PHT4;2 , PHT4;3 , PHT4;4 , PHT4;5 , and PHT4;6 are At2g29650, At2g38060, At3g46980, At4g00370, At5g20380, and At5g44370, respectively. Supplementary Material kiad607_Supplementary_Data Acknowledgments The authors thank Drs. Pter Horvth and Balzs Papp (BRC Szeged, Hungary) for laboratory equipment support and Dr. Cornelia...”
- Roles of plastid-located phosphate transporters in carotenoid accumulation
Hao, Frontiers in plant science 2022 - “...510 M Guo etal., 2008a ; Guo etal., 2008b ; Irigoyen etal., 2011 ; AtPHT4;1 At2g29650 Arabidopsis chloroplast in photosynthetic tissues Pi or ascorbate import 75 or 500 M Knockout of AtPHT4;1 has no significant effect on the carotenoid accumulation in photosynthetic tissues Knockout of AtPHT4;1...”
- Unraveling Hidden Components of the Chloroplast Envelope Proteome: Opportunities and Limits of Better MS Sensitivity
Bouchnak, Molecular & cellular proteomics : MCP 2019 - “...out its association with thylakoid membranes. The same is true for the thylakoid transporter ANTR1 (At2g29650). Again, this protein was described as a thylakoid Na + -dependent phosphate transporter from Arabidopsis (see ( 12 )) whereas our previous data (proteomics and Western blotting analyses using specific...”
- The pht4;1-3 mutant line contains a loss of function allele in the Fatty Acid Desaturase 7 gene caused by a remnant inactivated selection marker-a cautionary tale
Nilsson, PeerJ 2017 - “...with the wild-type copy of the gene of interest. The PHT4;1 gene in Arabidopsis thaliana (At2g29650) encodes a phosphate transporter localized to chloroplast membranes ( Guo et al., 2008 ; Karlsson et al., 2015 ; Pavon et al., 2008 ; Yin, Vener & Spetea, 2015 )....”
- C3 cotyledons are followed by C4 leaves: intra-individual transcriptome analysis of Salsola soda (Chenopodiaceae)
Lauterbach, Journal of experimental botany 2017 - “...(log 2 FC between 1.6 and 2.6) in leaves compared to Cot: phosphate transporter4.1 (PHT4.1; AT2G29650) and PHT4.4 (AT4G00370), also known as anion transporter (ANTR) 1 and ANTR2, respectively. Increased abundance of transcripts encoding pyruvate dehydrogenase kinase (PDH kinase; AT3G06483) is also significant (log 2 FC...”
- The circadian clock and defence signalling in plants
Sharma, Molecular plant pathology 2015 (secret) - Function and evolution of channels and transporters in photosynthetic membranes
Pfeil, Cellular and molecular life sciences : CMLS 2014 - “...34 , 35 , 61 ] TC #2. Secondary transporters Phosphate transporter 4;1 (PHT4;1) Arabidopsis At2g29650 Pi PSII repair and photoprotection [ 66 , 67 , 71 ] Thylakoid ATP/ADP carrier (TAAC) Arabidopsis At5g01500 ATP, ADP, PAPS, PAP Thylakoid biogenesis, PSII repair and photoprotection, sulfur metabolism,...”
- Deciphering thylakoid sub-compartments using a mass spectrometry-based approach
Tomizioli, Molecular & cellular proteomics : MCP 2014 - “...(At5g01500) and Na-dependent phosphate transporter Pht4;1 (ANTR1, At2g29650) were found exclusively associated to the envelope in the AT_CHLORO database (14)...”
- More
- The Arabidopsis thylakoid transporter PHT4;1 influences phosphate availability for ATP synthesis and plant growth.
Karlsson, The Plant journal : for cell and molecular biology 2015 (PubMed)- GeneRIF: The Arabidopsis thylakoid transporter PHT4;1 influences phosphate availability for ATP synthesis and plant growth
- Circadian clock-regulated phosphate transporter PHT4;1 plays an important role in Arabidopsis defense.
Wang, Molecular plant 2011 - GeneRIF: The phosphate transporter PHT4;1 is critical for basal defense and also implicate a potential role of the circadian clock in regulating innate immunity of Arabidopsis.
- Functionally important amino acids in the Arabidopsis thylakoid phosphate transporter: homology modeling and site-directed mutagenesis.
Ruiz-Pavón, Biochemistry 2010 - GeneRIF: A three-dimensional structural model of ANTR1 was constructed using the crystal structure of glycerol 3-phosphate/phosphate antiporter from E. coli as a template
- Arabidopsis ANTR1 is a thylakoid Na+-dependent phosphate transporter: functional characterization in Escherichia coli.
Pavón, The Journal of biological chemistry 2008 (PubMed)- GeneRIF: Recombinantly expressed Arabidopsis ANTR1 facilitates Na+-dependent Pi transport into Escherichia coli. [ANTR1]
- GeneRIF: ANTR1 is a thylakoid Na+-dependent phosphate transporter [ANTR1]
- Functionally important amino acids in the Arabidopsis thylakoid phosphate transporter: homology modeling and site-directed mutagenesis
Ruiz-Pavón, Biochemistry 2010 - “...residues in ANTR1 and mammalian SLC17 homologues. The amino acid sequences of Arabidopsis ANTR1 (UniProt O82390), sialin from human (Q9NRA2), vesicular glutamate transporters VGLUT13 from human (Q9P2U7, Q9P2U8, Q8NDX2), and Na + /P i cotransporters NPT1 and NPT3 from human (Q14916 and O00624) and NPT4 from...”
G3V851 Solute carrier family 17 member 6 from Rattus norvegicus
25% identity, 34% coverage
VGLU2_RAT / Q9JI12 Vesicular glutamate transporter 2; VGluT2; Differentiation-associated BNPI; Differentiation-associated Na(+)-dependent inorganic phosphate cotransporter; Solute carrier family 17 member 6 from Rattus norvegicus (Rat) (see 10 papers)
TC 2.A.1.14.16 / Q9JI12 The broad specificity brain synaptic vesicle anion transporter (transports glutamate in a Δψ-dependent fashion requiring Cl- but phosphate by a Na+-dependent mechanism via a different pathway/mechanism from Rattus norvegicus (see 8 papers)
25% identity, 34% coverage
- function: Multifunctional transporter that transports L-glutamate as well as multiple ions such as chloride, proton, potassium, sodium and phosphate (PubMed:11502256, PubMed:11551935, PubMed:11698619, PubMed:17046815, PubMed:18080752, PubMed:25433636, PubMed:27133463, PubMed:29642010, PubMed:32439795). At the synaptic vesicle membrane, mainly functions as a uniporter which transports preferentially L- glutamate but also, phosphate from the cytoplasm into synaptic vesicles at presynaptic nerve terminals of excitatory neural cells (PubMed:11502256, PubMed:11551935, PubMed:11698619, PubMed:17046815, PubMed:18080752, PubMed:27133463, PubMed:29642010, PubMed:32439795). The L-glutamate or phosphate uniporter activity is electrogenic and is driven by the proton electrochemical gradient, mainly by the electrical gradient established by the vacuolar H(+)-ATPase across the synaptic vesicle membrane (PubMed:11502256, PubMed:11551935, PubMed:11698619, PubMed:17046815, PubMed:29642010, PubMed:32439795). In addition, functions as a chloride channel that allows a chloride permeation through the synaptic vesicle membrane therefore affects the proton electrochemical gradient and promotes synaptic vesicles acidification (PubMed:27133463). Moreover, functions as a vesicular K(+)/H(+) antiport allowing to maintain the electrical gradient and to decrease chemical gradient and therefore sustain vesicular L-glutamate uptake (PubMed:25433636). The vesicular H(+)/H(+) antiport activity is electroneutral (PubMed:25433636). At the plasma membrane, following exocytosis, functions as a symporter of Na(+) and phosphate from the extracellular space to the cytoplasm allowing synaptic phosphate homeostasis regulation (PubMed:17046815, PubMed:29642010). The symporter activity is driven by an inside negative membrane potential and is electrogenic (PubMed:17046815, PubMed:29642010). Also involved in the regulation of retinal hyaloid vessel regression during postnatal development (By similarity). May also play a role in the endocrine L- glutamatergic system of other tissues such as pineal gland and pancreas (PubMed:11551935).
catalytic activity: L-glutamate(out) = L-glutamate(in) (RHEA:66336)
catalytic activity: 3 Na(+)(out) + phosphate(out) = 3 Na(+)(in) + phosphate(in) (RHEA:71255)
catalytic activity: phosphate(in) = phosphate(out) (RHEA:32823)
catalytic activity: K(+)(in) + H(+)(out) = K(+)(out) + H(+)(in) (RHEA:29467)
catalytic activity: chloride(in) = chloride(out) (RHEA:29823) - substrates: glutamate
tcdb comment: VGLUT1-3 concentrate glutamate into synaptic vesicles before its exocytotic release. Two distinct roles for Cl- in both allosteric activation and permeation have been proposed (Chang et al. 2018) - Expression and Neurotransmitter Association of the Synaptic Calcium Sensor Synaptotagmin in the Avian Auditory Brain Stem.
MacLeod, Journal of the Association for Research in Otolaryngology : JARO 2022 - Peculiar protrusions along tanycyte processes face diverse neural and nonneural cell types in the hypothalamic parenchyma.
Pasquettaz, The Journal of comparative neurology 2021 - “...6 (VGLUT2) Recombinant protein corresponding to AA 510 to 582 from rat VGLUT2 (UniProt id: Q9JI12) Synaptic system 135,403 135,403/159 AB_887883 Rabbit Polyclonal 1:500 Solute carrier family 32 member 1 (VGAT) Recombinant protein corresponding to AA 2 to 115 from rat VGAT (UniProt id: O35458) Synaptic...”
- Allosteric Inhibition of a Vesicular Glutamate Transporter by an Isoform-Specific Antibody.
Eriksen, Biochemistry 2021 - “...a plasma membrane-targeted version of rat VGLUT (pmVGLUT) 1, 2, or 3 (Uniprot entries: Q62634, Q9JI12, and Q7TSF2) with 6 L of FugeneHD according to the manufacturers protocol. The next day, the cells were seeded onto 12 mm glass coverslips coated with poly-L-lysine (1 mg/mL) in...”
- “...VGLUT1-3 ( PDF ) Accession Codes VGLUT1 (rat): Uniprot entry Q62634. VGLUT2 (rat): Uniprot entry Q9JI12. VGLUT3 (rat): Uniprot entry Q7TSF2. The authors declare no competing financial interest. Complete contact information is available at: https://pubs.acs.org/10.1021/acs.biochem.1c00375 REFERENCES (1) Anne C , and Gasnier B . ( 2014...”
- Identification and characterization of the BRI2 interactome in the brain
Martins, Scientific reports 2018 - “...Q9QUL6 Nsf Vesicle-fusing ATPase CC, HP, CB Q62634 Slc17a7 Vesicular glutamate transporter 1 CC, HP Q9JI12 Slc17a6 Vesicular glutamate transporter 2 CC O35458 Slc32a1 Vesicular inhibitory amino acid transporter CC, HP P62762 Vsnl1 Visinin-like protein 1 CB Q71RJ2 Cacng2 Voltage-dependent calcium channel gamma-2 subunit CB Q6QIX3...”
- Environmental enrichment alters protein expression as well as the proteomic response to cocaine in rat nucleus accumbens.
Lichti, Frontiers in behavioral neuroscience 2014 - “...2.33 0.045 P1 Q69ZK9 NLGN2 0.93 1.90 0.048 S1 Q6PEC4 SKP1 0.91 1.88 0.032 S1 Q9JI12 SLC17A6 4.58 23.87 0.033 S1 Q62634 SLC17A7 4.55 23.43 0.031 S1 Q8BRU6 SLC18A2 0.93 1.91 0.044 S1 Q80ZA5 SLC4A10 3.02 8.10 0.021 3.63 12.37 0.018 3.99 15.90 0.024 S1 P07895...”
- Identification of novel γ-secretase-associated proteins in detergent-resistant membranes from brain.
Hur, The Journal of biological chemistry 2012
8u3gA / Q9NRA2 Structure of naag-bound sialin
25% identity, 55% coverage
- Ligands: aspartic acid; glutamic acid (8u3gA)
PP3377, PP_3377 2-ketogluconate transporter, putative from Pseudomonas putida KT2440
22% identity, 87% coverage
- Metabolic bottlenecks of Pseudomonas taiwanensis VLB120 during growth on d-xylose via the Weimberg pathway
Nerke, Metabolic engineering communications 2024 - “...Bator et al., 2019 ; Meijnen et al., 2009 ). Recently, the 2-ketogluconate transporter KguT (PP_3377) was proven to facilitate d -xylonate transport in P. putida KT2440 ( Lim et al., 2021 ). However, P. taiwanensis VLB120 does not harbor an ortholog of kguT and the...”
- Nitrogen Metabolism in Pseudomonas putida: Functional Analysis Using Random Barcode Transposon Sequencing
Schmidt, Applied and environmental microbiology 2022 (secret) - A reduction in growth rate of Pseudomonas putida KT2442 counteracts productivity advances in medium-chain-length polyhydroxyalkanoate production from gluconate
Follonier, Microbial cell factories 2011 - “...into the medium are actively transported in the cytoplasm by KguT proteins (putative transporter gene PP_3377 [ 29 ]). There, the molecules are phosphorylated and further metabolized for energy production via the Entner-Doudoroff pathway and for biomass production. Interestingly, the genes involved in the periplasmic conversion...”
- A set of activators and repressors control peripheral glucose pathways in Pseudomonas putida to yield a common central intermediate
del, Journal of bacteriology 2008 - “...to PP3382), whereas the genes for 2KG transport (PP3377) and its metabolism (PP3379, PP3378, and PP3376) form another operon that is transcribed from its...”
- Convergent peripheral pathways catalyze initial glucose catabolism in Pseudomonas putida: genomic and flux analysis
del, Journal of bacteriology 2007 - “...system (PP3417), as well as a 2-ketogluconate transporter (PP3377). These two transporters were also induced slightly more than twofold (Table 5). In addition,...”
- “...PP1444 PP1445 PP1009 PP1010 PP1011 PP1022 PP1024 PP3376 PP3377 PP3378 PP3379 PP3382 PP3383 PP3384 PP3416 PP3417 PP3418 PP1015 PP1016 PP1017 PP1018 PP1019...”
ANTR3_ARATH / Q7XJR2 Probable anion transporter 3, chloroplastic; Phosphate transporter PHT4;2 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
Q7XJR2 ABC-type phosphate transporter (EC 7.3.2.1) from Arabidopsis thaliana (see paper)
AT2G38060 PHT4;2 (PHOSPHATE TRANSPORTER 4;2); carbohydrate transmembrane transporter/ inorganic phosphate transmembrane transporter/ organic anion transmembrane transporter/ sugar:hydrogen symporter from Arabidopsis thaliana
NP_181341 phosphate transporter 4;2 from Arabidopsis thaliana
23% identity, 55% coverage
- function: Inorganic phosphate and probable anion transporter.
- Chloroplast phosphate transporter CrPHT4-7 regulates phosphate homeostasis and photosynthesis in Chlamydomonas
Tóth, Plant physiology 2024 - “...thaliana PHT4;1 , PHT4;2 , PHT4;3 , PHT4;4 , PHT4;5 , and PHT4;6 are At2g29650, At2g38060, At3g46980, At4g00370, At5g20380, and At5g44370, respectively. Supplementary Material kiad607_Supplementary_Data Acknowledgments The authors thank Drs. Pter Horvth and Balzs Papp (BRC Szeged, Hungary) for laboratory equipment support and Dr. Cornelia Spetea...”
- “...to the work described in this paper: PHT3 Gramene: Cre03.g172300 PHT3 Araport: Cre03.g172300 PHT4;2 Gramene: AT2G38060 PHT4;2 Araport: AT2G38060 PHT4;3 Gramene: AT3G46980 PHT4;3 Araport: AT3G46980 PHT4;5 Gramene: AT5G20380 PHT4;5 Araport: AT5G20380 PHT4;6 Gramene: AT5G44370 PHT4;6 Araport: AT5G44370 PHT2;1 Gramene: AT3G26570 PHT2;1 Araport: AT3G26570 ATP CHEBI: CHEBI:15422...”
- Beneficial Effects of Phosphite in Arabidopsis thaliana Mediated by Activation of ABA, SA, and JA Biosynthesis and Signaling Pathways
Pérez-Zavala, Plants (Basel, Switzerland) 2024 - “...OF UREA 3 (AT5G45380), XYLULOSE 5-PHOSPHATE/PHOSPHATE TRANSLOCATOR (AT5G17630), PHOSPHATE TRANSPORTER 1;4 (AT2G38940), PHOSPHATE TRANSPORTER 4;2 (AT2G38060), PHOSPHATE TRANSPORTER 3;1 (AT5G14040), PHOSPHOENOLPYRUVATE/PHOSPHATE TRANSLOCATOR (AT5G33320), along with 37 more related to Fe, S, B, Mg, Na, and Zn transport ( Figure S3a ; Table S10 ). We also...”
- Roles of plastid-located phosphate transporters in carotenoid accumulation
Hao, Frontiers in plant science 2022 - “...Pi export Overexpression of CsPHT4;2 enhances carotenoid accumulation in non-photosynthetic tissues Lu etal., 2018 AtPHT4;2 At2g38060 Arabidopsis Plastid in non-photosynthetic tissues Pi export 510 M Guo etal., 2008a ; Guo etal., 2008b ; Irigoyen etal., 2011 ; AtPHT4;1 At2g29650 Arabidopsis chloroplast in photosynthetic tissues Pi or...”
- A BTB-TAZ protein is required for gene activation by Cauliflower mosaic virus 35S multimerized enhancers
Irigoyen, Plant physiology 2022 - “...CULLIN3B , At1g69670; YUCCA1 , At4g32540; PAP1 , At1g56650; JAW , At4g23713 ; PHT4;2 , At2g38060; TPT , At5g46110; EIF-4A2 , At1g54270; ACTIN7 , At5g09810; 18S , At2g01010; CAB2 , At1g29920. Supplemental data The following materials are available in the online version of this article. Supplemental...”
- An amiRNA screen uncovers redundant CBF and ERF34/35 transcription factors that differentially regulate arsenite and cadmium responses
Xie, Plant, cell & environment 2021 - “...AT1G20860 PHT1;8 Phosphate Transporter 1;8 AT1G76430 PHT1;9 phosphate transporter 1;9 AT2G17270 PHT3;3 phosphate transporter 3;3 AT2G38060 PHT4;2 phosphate transporter 4;2 AT3G26570 PHT2;1 phosphate transporter 2;1 AT3G46980 PHT4;3 phosphate transporter 4;3 CBF2 AT1G76430 PHT1;9 phosphate transporter 1;9 AT2G38060 PHT4;2 phosphate transporter 4;2 AT3G26570 PHT2;1 phosphate transporter 2;1...”
- “...PHT2;1 phosphate transporter 2;1 CBF4 AT1G20860 PHT1;8 Phosphate Transporter 1;8 AT1G76430 PHT1;9 phosphate transporter 1;9 AT2G38060 PHT4;2 phosphate transporter 4;2 AT3G26570 PHT2;1 phosphate transporter 2;1 AT3G46980 PHT4;3 phosphate transporter 4;3 AT3G54700 PHT1;7 phosphate transporter 1;7 AT5G43350 PHT1;1 phosphate transporter 1;1 AT5G43360 PHT1;3 Phosphate Transporter 1;3 Table...”
- MaRAP2-4, a waterlogging-responsive ERF from Mentha, regulates bidirectional sugar transporter AtSWEET10 to modulate stress response in Arabidopsis
Phukan, Plant biotechnology journal 2018 - “...0.0288 AT1G13250 Galacturonosyltransferaselike 3 4 DRE 2.76 0.0081 AT1G45130 Betagalactosidase 5 1 DRE 2.75 0.0185 AT2G38060 Phosphate transporter 4;2, 3 DRE 2.71 0.0375 AT3G05400 Sugar transporter ERD6like 12 2 DRE 2.68 0.0214 AT5G42720 Glycosyl hydrolase family 17 protein 1 DRE 2.24 0.0454 AT4G15530 Pyruvate, phosphate dikinase...”
- Hexanoic acid protects tomato plants against Botrytis cinerea by priming defence responses and reducing oxidative stress
Finiti, Molecular plant pathology 2014 (secret) - The AAP gene family for amino acid permeases contributes to development of the cyst nematode Heterodera schachtii in roots of Arabidopsis
Elashry, Plant physiology and biochemistry : PPB 2013 - “...0.2 0.38 At2g29650 AtBNP1hom2 3.6 6.3 2.7 a 0.00 At3g46980 AtBNP1hom3 4.3 4.1 0.2 0.52 At2g38060 AtBNP1hom4 4.8 4.6 0.2 0.45 At4g00370 AtBNP1hom5 5.4 7.6 2.2 a 0.00 a Indicates significant up- or downregulation (false discovery rate <5%)....”
- More
- The sink-specific plastidic phosphate transporter PHT4;2 influences starch accumulation and leaf size in Arabidopsis.
Irigoyen, Plant physiology 2011 - GeneRIF: PHT4;2 contributes to inorganic phosphate (Pi) transport in isolated root plastids.
LOC101254229 probable anion transporter 3, chloroplastic from Solanum lycopersicum
24% identity, 59% coverage
TC 2.A.1.14.26 / F2YPN7 The plasma membrane Lethal (2)01810 glutamate uptake porter (Km=0.07μM) (Inhibited by aspartate) from Drosophila melanogaster
22% identity, 57% coverage
7t3nA / Q9JI12 R184q/e191q mutant of rat vesicular glutamate transporter 2 (vglut2)
24% identity, 41% coverage
- Ligands: (1s,3r)-1-aminocyclopentane-1,3-dicarboxylic acid; (2r)-2-(methoxymethyl)-4-{[(25r)-spirost-5-en-3beta-yl]oxy}butyl 4-o-alpha-d-glucopyranosyl-beta-d-glucopyranoside (7t3nA)
XP_003121458 sialin isoform X3 from Sus scrofa
26% identity, 39% coverage
ANTR5_ARATH / Q9FKV1 Probable anion transporter 5; Phosphate transporter PHT4;6 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
NP_199250 phosphate transporter 4;6 from Arabidopsis thaliana
AT5G44370 PHT4;6 (PHOSPHATE TRANSPORTER 4;6); carbohydrate transmembrane transporter/ inorganic phosphate transmembrane transporter/ organic anion transmembrane transporter/ sugar:hydrogen symporter from Arabidopsis thaliana
22% identity, 70% coverage
- function: Inorganic phosphate and probable anion transporter.
- Function of the Golgi-located phosphate transporter PHT4;6 is critical for senescence-associated processes in Arabidopsis.
Hassler, Journal of experimental botany 2016 - GeneRIF: role in senescence-associated processes
- Lack of the Golgi phosphate transporter PHT4;6 causes strong developmental defects, constitutively activated disease resistance mechanisms and altered intracellular phosphate compartmentation in Arabidopsis.
Hassler, The Plant journal : for cell and molecular biology 2012 (PubMed)- GeneRIF: PHT4;6 plays a role in the intracellular phosphate compartmentation, disease resistance mechanisms and development.
- Chloroplast phosphate transporter CrPHT4-7 regulates phosphate homeostasis and photosynthesis in Chlamydomonas
Tóth, Plant physiology 2024 - “...PHT4;3 , PHT4;4 , PHT4;5 , and PHT4;6 are At2g29650, At2g38060, At3g46980, At4g00370, At5g20380, and At5g44370, respectively. Supplementary Material kiad607_Supplementary_Data Acknowledgments The authors thank Drs. Pter Horvth and Balzs Papp (BRC Szeged, Hungary) for laboratory equipment support and Dr. Cornelia Spetea (University of Gothenburg, Sweden) for...”
- “...AT2G38060 PHT4;3 Gramene: AT3G46980 PHT4;3 Araport: AT3G46980 PHT4;5 Gramene: AT5G20380 PHT4;5 Araport: AT5G20380 PHT4;6 Gramene: AT5G44370 PHT4;6 Araport: AT5G44370 PHT2;1 Gramene: AT3G26570 PHT2;1 Araport: AT3G26570 ATP CHEBI: CHEBI:15422 PHT4;4 Gramene: At5g20380 PHT4;4 Araport: At5g20380 PHT4-7 Gramene: Cre16.g663600 PHT4-7 Araport: Cre16.g663600 STT7 Gramene: Cre02.g12025 STT7 Araport: Cre02.g12025...”
- Interdependent iron and phosphorus availability controls photosynthesis through retrograde signaling
Nam, Nature communications 2021 - “...N469134 (AT4G00370), SAIL_842_E09 (AT4G00380), N866595 (At4g00390), SAIL_633_E10 (At4g00400), SALK_077222 (AT3G02870) SALK_053900 (AT3G46980), SALK_114708 (AT5G20380), SAIL_809_B01 (AT5G44370), SALK_067629 (AT4G28610), and SALK_039445 (AT5G20150) were obtained from the Nottingham Arabidopsis Stock Centre (NASC). Homozygous mutant lines were confirmed by PCR using the primers listed in Supplementary Table 1 ....”
- Function of the Golgi-located phosphate transporter PHT4;6 is critical for senescence-associated processes in Arabidopsis
Hassler, Journal of experimental botany 2016 - “...fluorometer (Imaging-PAM M-series, MINI-version, Walz, Wrzburg, Germany; http://www.walz.com ) using ImagingWin software. Accession numbers PHT4;6 (At5g44370), ATG7 (At5g45900), NAC029 (At1g69490), SGN (At4g22920), SAG12 (At5g45890), SAG13 (At2g29350), S3H (At4g10500), and WRKY53 (At4g23810). Results pht4;6 mutant plants display an accelerated senescence phenotype induced by darkness As stated above,...”
- Genome-wide comparative analysis of 20 miniature inverted-repeat transposable element families in Brassica rapa and B. oleracea
Sampath, PloS one 2014 - “...2 4781 174 AT3G28857 Bra025358 Bra033063 Bra039043 Bol042990 Bol033198 - Paclobutrazol resistance 5 4847 156 AT5G44370 Bra033741 Bra039510 - Bol006387 - - Phosphate transporter 46 4787 174 AT3G60660 Bra007549 - - Bol045621 - - Molecular function unknown 4652 223 AT4G00540 - - Bra008522- - Bol040626 C-Myb-like...”
- The AAP gene family for amino acid permeases contributes to development of the cyst nematode Heterodera schachtii in roots of Arabidopsis
Elashry, Plant physiology and biochemistry : PPB 2013 - “...0.7 0.07 At1g31830 AtLAT4 8.1 7.5 0.6 0.22 At3g19553 AtLAT5 6.2 5.2 1 a 0.09 At5g44370 AtBNP1hom1 5.2 5 0.2 0.38 At2g29650 AtBNP1hom2 3.6 6.3 2.7 a 0.00 At3g46980 AtBNP1hom3 4.3 4.1 0.2 0.52 At2g38060 AtBNP1hom4 4.8 4.6 0.2 0.45 At4g00370 AtBNP1hom5 5.4 7.6 2.2 a...”
- Transcriptome responses to aluminum stress in roots of aspen (Populus tremula)
Grisel, BMC plant biology 2010 - “...PtpAffx.46328.1.A1_at gw1.I.4154.1 AT3G19640 Mg transporter CorA-like family protein (MRS2-3) 3.8 2.8 1.3 ns PtpAffx.204370.1.S1_at fgenesh4_pg.C_LG_IX000025 AT5G44370 Phosphate transporter 4;6 (PHT4;6) 4.3 1.8 ns 1.1 ns PtpAffx.249.377.A1_at fgenesh4_pm.C_LG_V000517 AT3G51895 Sulfate transmembrane transporter 3;1 (SULTR3;1) 2.4 1.3 ns 1.0 ns PtpAffx.63924.1.S1_at eugene3.01570002 AT5G19600 Sulfate transmembrane transporter 3;5 (SULTR3;5)...”
- The phosphate transporter PHT4;6 is a determinant of salt tolerance that is localized to the Golgi apparatus of Arabidopsis
Cubero, Molecular plant 2009 (PubMed)- “...mutations that disrupt the function of PHT4;6 (At5g44370) cause NaCl hypersensitivity of Arabidopsis seedlings that is characterized by reduced growth of...”
- “...and pht4;6-2 (449bp downstream of the start codon) in At5g44370. The left border sequence (LB) of the T-DNA in both mutants and the direction of transcription...”
NP_620115 dietary and metabolic glutamate transporter from Drosophila melanogaster
22% identity, 57% coverage
- l(2)01810 is a novel type of glutamate transporter that is responsible for megamitochondrial formation
Shim, The Biochemical journal 2011 - “...(NP_651536), Cele aat-1 (NP_501707), Drer SLC7a11-like (XP_001919426), Mmus xCT (NP_036120), Hsap xCT (NP_055146), Dmel l(2)01810 (NP_620115), Dmel VGLUT (NP_608681), Cele eat-4 (NP_499023), Drer SLC17a7 (NP_001092225), Hsap VGLUT1 (NP_064705), Rnor VGLUT1 (NP_446311), Dmel arala1 (NP_733365), Cele Q21153 (NP_497274), Drer SLC25a12 (NP_997947), Mmus aralar1 (NP_766024) and Hsap aralar1...”
W9RGS2 Putative anion transporter 3 from Morus notabilis
23% identity, 54% coverage
- Identification and Characterization of Verticillium nonalfalfae-Responsive MicroRNAs in the Roots of Resistant and Susceptible Hop Cultivars.
Kunej, Plants (Basel, Switzerland) 2021 - “...homolog 2 (225117.XP_009378785.1), LOB domain-containing protein (W9SE87) hlu-miR159cd 1.28 0.95 NS Putative anion transporter 3 (W9RGS2) 1,3 , Transcription factor GAMYB (W9QVM8) 2,4 , Integrase catalytic domain-containing protein (A0A087HSL5) 1,2,3,4 , Acetyltransferase At3g50280-like (M5VT21) 2,4 , Transcription factor MYB51-like (102107.XP_008226955.1), Cytochrome p450 (57918.XP_004291627.1) hlu-miR160b NS 1.21...”
S17A5_SHEEP / Q9MZD1 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Membrane glycoprotein SP55; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Ovis aries (Sheep) (see paper)
26% identity, 39% coverage
- function: Multifunctional anion transporter that operates via two distinct transport mechanisms, namely proton-coupled anion cotransport and membrane potential-dependent anion transport (By similarity). Electroneutral proton-coupled acidic monosaccharide symporter, with a sugar to proton stoichiometry of 1:1. Exports glucuronic acid and free sialic acid derived from sialoglycoconjugate degradation out of lysosomes, driven by outwardly directed lysosomal pH gradient. May regulate lysosome function and metabolism of sialylated conjugates that impact oligodendrocyte lineage differentiation and myelinogenesis in the central nervous system (By similarity). Electrogenic proton-coupled nitrate symporter that transports nitrate ions across the basolateral membrane of salivary gland acinar cells, with nitrate to proton stoichiometry of 2:1. May contribute to nitrate clearance from serum by salivary glands, where it is further concentrated and secreted in the saliva (By similarity). Uses membrane potential to drive the uptake of acidic amino acids and peptides into synaptic vesicles. Responsible for synaptic vesicular storage of L-aspartate and L-glutamate in pinealocytes as well as vesicular uptake of N-acetyl-L-aspartyl-L- glutamate neuropeptide, relevant to aspartegic-associated glutamatergic neurotransmission and activation of metabotropic receptors that inhibit subsequent transmitter release (By similarity).
function: Receptor for CM101, a polysaccharide produced by group B Streptococcus with antipathoangiogenic properties.
catalytic activity: N-acetylneuraminate(in) + H(+)(in) = N-acetylneuraminate(out) + H(+)(out) (RHEA:28987)
catalytic activity: D-glucuronate(out) + H(+)(out) = D-glucuronate(in) + H(+)(in) (RHEA:72591)
catalytic activity: 2 nitrate(out) + H(+)(out) = 2 nitrate(in) + H(+)(in) (RHEA:71539)
catalytic activity: L-aspartate(out) = L-aspartate(in) (RHEA:66332)
catalytic activity: L-glutamate(out) = L-glutamate(in) (RHEA:66336)
catalytic activity: N-acetyl-L-aspartyl-L-glutamate(out) = N-acetyl-L-aspartyl-L- glutamate(in) (RHEA:72599)
S17A5_RAT / Q5Q0U0 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 (Anion/sugar transporter), member 5; Vesicular excitatory amino acid transporter; VEAT from Rattus norvegicus (Rat) (see 2 papers)
27% identity, 38% coverage
- function: Multifunctional anion transporter that operates via two distinct transport mechanisms, namely proton-coupled anion cotransport and membrane potential-dependent anion transport (By similarity). Electroneutral proton-coupled acidic monosaccharide symporter, with a sugar to proton stoichiometry of 1:1. Exports glucuronic acid and free sialic acid derived from sialoglycoconjugate degradation out of lysosomes, driven by outwardly directed lysosomal pH gradient. May regulate lysosome function and metabolism of sialylated conjugates that impact oligodendrocyte lineage differentiation and myelinogenesis in the central nervous system (By similarity) (PubMed:15516337, PubMed:20424173). Electrogenic proton-coupled nitrate symporter that transports nitrate ions across the basolateral membrane of salivary gland acinar cells, with nitrate to proton stoichiometry of 2:1. May contribute to nitrate clearance from serum by salivary glands, where it is further concentrated and secreted in the saliva (By similarity). Uses membrane potential to drive the uptake of acidic amino acids and peptides into synaptic vesicles. Responsible for synaptic vesicular storage of L-aspartate and L-glutamate in pinealocytes as well as vesicular uptake of N-acetyl-L-aspartyl-L-glutamate neuropeptide, relevant to aspartegic-associated glutamatergic neurotransmission and activation of metabotropic receptors that inhibit subsequent transmitter release (By similarity).
function: Receptor for CM101, a polysaccharide produced by group B Streptococcus with antipathoangiogenic properties.
catalytic activity: N-acetylneuraminate(in) + H(+)(in) = N-acetylneuraminate(out) + H(+)(out) (RHEA:28987)
catalytic activity: D-glucuronate(out) + H(+)(out) = D-glucuronate(in) + H(+)(in) (RHEA:72591)
catalytic activity: 2 nitrate(out) + H(+)(out) = 2 nitrate(in) + H(+)(in) (RHEA:71539)
catalytic activity: L-aspartate(out) = L-aspartate(in) (RHEA:66332)
catalytic activity: L-glutamate(out) = L-glutamate(in) (RHEA:66336)
catalytic activity: N-acetyl-L-aspartyl-L-glutamate(out) = N-acetyl-L-aspartyl-L- glutamate(in) (RHEA:72599)
LOC100819182 probable anion transporter 3, chloroplastic from Glycine max
22% identity, 61% coverage
BCAL1804 Major Facilitator Superfamily protein from Burkholderia cenocepacia J2315
24% identity, 88% coverage
LOC100647822 putative inorganic phosphate cotransporter from Bombus terrestris
22% identity, 57% coverage
VGLU3_RAT / Q7TSF2 Vesicular glutamate transporter 3; VGluT3; Solute carrier family 17 member 8 from Rattus norvegicus (Rat) (see 8 papers)
23% identity, 40% coverage
- function: Multifunctional transporter that transports L-glutamate as well as multiple ions such as chloride, sodium and phosphate (PubMed:12097496, PubMed:12388773, PubMed:27133463). At the synaptic vesicle membrane, mainly functions as an uniporter that mediates the uptake of L-glutamate into synaptic vesicles at presynaptic nerve terminals of excitatory neural cells (PubMed:12097496, PubMed:12388773, PubMed:27133463). The L-glutamate uniporter activity is electrogenic and is driven by the proton electrochemical gradient, mainly by the electrical gradient established by the vacuolar H(+)-ATPase across the synaptic vesicle membrane (PubMed:12097496, PubMed:12388773). In addition, functions as a chloride channel that allows a chloride permeation through the synaptic vesicle membrane that affects the proton electrochemical gradient and promotes synaptic vesicles acidification (PubMed:27133463). At the plasma membrane, following exocytosis, functions as a symporter of Na(+) and phosphate from the extracellular space to the cytoplasm allowing synaptic phosphate homeostasis regulation (By similarity). The symporter activity is electrogenic (By similarity). Moreover, operates synergistically with SLC18A3/VACHT under a constant H(+) gradient, thereby allowing striatal vesicular acetylcholine uptake (PubMed:18278042).
catalytic activity: L-glutamate(out) = L-glutamate(in) (RHEA:66336)
catalytic activity: chloride(in) = chloride(out) (RHEA:29823)
catalytic activity: 3 Na(+)(out) + phosphate(out) = 3 Na(+)(in) + phosphate(in) (RHEA:71255) - Allosteric Inhibition of a Vesicular Glutamate Transporter by an Isoform-Specific Antibody.
Eriksen, Biochemistry 2021 - “...membrane-targeted version of rat VGLUT (pmVGLUT) 1, 2, or 3 (Uniprot entries: Q62634, Q9JI12, and Q7TSF2) with 6 L of FugeneHD according to the manufacturers protocol. The next day, the cells were seeded onto 12 mm glass coverslips coated with poly-L-lysine (1 mg/mL) in 24 well...”
- “...Codes VGLUT1 (rat): Uniprot entry Q62634. VGLUT2 (rat): Uniprot entry Q9JI12. VGLUT3 (rat): Uniprot entry Q7TSF2. The authors declare no competing financial interest. Complete contact information is available at: https://pubs.acs.org/10.1021/acs.biochem.1c00375 REFERENCES (1) Anne C , and Gasnier B . ( 2014 ) Chapter Three - Vesicular...”
- Slow NMDA-Mediated Excitation Accelerates Offset-Response Latencies Generated via a Post-Inhibitory Rebound Mechanism.
Rajaram, eNeuro 2019 - “...Rabbit 1:1000 VGLUT3 Peptide (C)ELNHEAFVSPRKK, corresponding to amino acid residues 533545 of rat VGLUT3 (accession Q7TSF2); cytoplasmic, C terminus Alomone Labs AGC-037 Rabbit 1:300 Secondary antibody Host species Supplier Catalog number Conjugated Dilution Rabbit Donkey Dianova 711-165-152 Cy3 1:300 Rabbit Donkey Dianova 711-586-152 Alexa Fluor 594...”
LOC100789297 probable anion transporter 4, chloroplastic from Glycine max
29% identity, 31% coverage
LOC101746043 putative inorganic phosphate cotransporter from Bombyx mori
23% identity, 80% coverage
LOC7466045 probable anion transporter 3, chloroplastic from Populus trichocarpa
20% identity, 58% coverage
- Genome-Wide Analysis of Major Facilitator Superfamily and Its Expression in Response of Poplar to Fusarium oxysporum
Diao, Frontiers in genetics 2021 - “...the networks, such as PtrMFS32 (LOC7458066), PtrMFS38 (LOC7455882), PtrMFS33 (LOC7496936), PtrMFS6 (LOC7470780), PtrMFS5 (LOC7478542), PtrMFS39 (LOC7466045), PtrMFS3 (LOC18094568), PtrMFS13 (LOC7453664), PtrMFS25 (LOC7463307). We have observed that the shared gene expression patterns in the co-expression network are not exactly the same, which indicated that MFS genes under...”
CCNA_02571 transporter from Caulobacter crescentus NA1000
CC_2486 major facilitator family transporter from Caulobacter crescentus CB15
24% identity, 53% coverage
KSMBR1_3299 MFS transporter from Candidatus Kuenenia stuttgartiensis
26% identity, 55% coverage
NP_001349351 glucose-6-phosphate exchanger SLC37A2 isoform 2 from Danio rerio
22% identity, 89% coverage
H0VDT5 Solute carrier family 17 member 8 from Cavia porcellus
22% identity, 65% coverage
S17A5_MOUSE / Q8BN82 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Mus musculus (Mouse) (see 3 papers)
26% identity, 39% coverage
- function: Multifunctional anion transporter that operates via two distinct transport mechanisms, namely proton-coupled anion cotransport and membrane potential-dependent anion transport (By similarity) (PubMed:18695252). Electroneutral proton-coupled acidic monosaccharide symporter, with a sugar to proton stoichiometry of 1:1. Exports glucuronic acid and free sialic acid derived from sialoglycoconjugate degradation out of lysosomes, driven by outwardly directed lysosomal pH gradient. May regulate lysosome function and metabolism of sialylated conjugates that impact oligodendrocyte lineage differentiation and myelinogenesis in the central nervous system (By similarity) (PubMed:20007460). Electrogenic proton-coupled nitrate symporter that transports nitrate ions across the basolateral membrane of salivary gland acinar cells, with nitrate to proton stoichiometry of 2:1. May contribute to nitrate clearance from serum by salivary glands, where it is further concentrated and secreted in the saliva (By similarity). Uses membrane potential to drive the uptake of acidic amino acids and peptides into synaptic vesicles. Responsible for synaptic vesicular storage of L-aspartate and L-glutamate in pinealocytes as well as vesicular uptake of N-acetyl-L-aspartyl-L-glutamate neuropeptide, relevant to aspartegic-associated glutamatergic neurotransmission and activation of metabotropic receptors that inhibit subsequent transmitter release (PubMed:18695252, PubMed:23889254).
function: Receptor for CM101, a polysaccharide produced by group B Streptococcus with antipathoangiogenic properties.
catalytic activity: N-acetylneuraminate(in) + H(+)(in) = N-acetylneuraminate(out) + H(+)(out) (RHEA:28987)
catalytic activity: D-glucuronate(out) + H(+)(out) = D-glucuronate(in) + H(+)(in) (RHEA:72591)
catalytic activity: 2 nitrate(out) + H(+)(out) = 2 nitrate(in) + H(+)(in) (RHEA:71539)
catalytic activity: L-aspartate(out) = L-aspartate(in) (RHEA:66332)
catalytic activity: L-glutamate(out) = L-glutamate(in) (RHEA:66336)
catalytic activity: N-acetyl-L-aspartyl-L-glutamate(out) = N-acetyl-L-aspartyl-L- glutamate(in) (RHEA:72599)
disruption phenotype: Mutant mice have smaller size, develop severe tremor and uncoordinated gait associated with marked central nervous system hypomyelination, and die prematurely during the third postnatal week.
VGLU3_HUMAN / Q8NDX2 Vesicular glutamate transporter 3; VGluT3; Solute carrier family 17 member 8 from Homo sapiens (Human) (see 2 papers)
TC 2.A.1.14.32 / Q8NDX2 Vesicular glutamate transporter 3 (VGluT3) (Solute carrier family 17 member 8). Loss in mice produces circadian-dependent hyperdopaminergia and amiliorates motor disfunction and dopa-mediated dyskinesias in a model of Parkinson's Disease (Divito et al. 2015). VGLUT3 is expressed selectively in the inner hair cells (IHCs) and transports the neurotransmitter glutamate into synaptic vesicles. Mutation of the SLC17A8 gene is associated with DFNA25 (deafness, autosomal dominant 25), a non-syndromic hearing loss (ADNSHL) in humans (Ryu et al. 2016). Glut3 contributes to stress response and related psychopathologies from Homo sapiens (see 4 papers)
NP_647480 vesicular glutamate transporter 3 isoform 1 from Homo sapiens
23% identity, 40% coverage
- function: Multifunctional transporter that transports L-glutamate as well as multiple ions such as chloride, sodium and phosphate (PubMed:12151341, PubMed:33440152). At the synaptic vesicle membrane, mainly functions as an uniporter that mediates the uptake of L- glutamate into synaptic vesicles at presynaptic nerve terminals of excitatory neural cells (PubMed:12151341). The L-glutamate uniporter activity is electrogenic and is driven by the proton electrochemical gradient, mainly by the electrical gradient established by the vacuolar H(+)-ATPase across the synaptic vesicle membrane (PubMed:12151341). In addition, functions as a chloride channel that allows a chloride permeation through the synaptic vesicle membrane that affects the proton electrochemical gradient and promotes synaptic vesicles acidification (By similarity). At the plasma membrane, following exocytosis, functions as a symporter of Na(+) and phosphate from the extracellular space to the cytoplasm allowing synaptic phosphate homeostasis regulation (Probable). The symporter activity is electrogenic (PubMed:33440152). Moreover, operates synergistically with SLC18A3/VACHT under a constant H(+) gradient, thereby allowing striatal vesicular acetylcholine uptake (By similarity).
catalytic activity: L-glutamate(out) = L-glutamate(in) (RHEA:66336)
catalytic activity: 3 Na(+)(out) + phosphate(out) = 3 Na(+)(in) + phosphate(in) (RHEA:71255)
catalytic activity: chloride(in) = chloride(out) (RHEA:29823) - substrates: glutamate
- The c.824C>A and c.616dupA mutations in the SLC17a8 gene are associated with auditory neuropathy and lead to defective expression of VGluT3.
Qi, Neuroreport 2021 (PubMed)- GeneRIF: The c.824C>A and c.616dupA mutations in the SLC17a8 gene are associated with auditory neuropathy and lead to defective expression of VGluT3.
- Targeting Vesicular Glutamate Transporter Machinery: Implications on Metabotropic Glutamate Receptor 5 Signaling and Behavior.
Ibrahim, Molecular pharmacology 2020 (PubMed)- GeneRIF: Targeting Vesicular Glutamate Transporter Machinery: Implications on Metabotropic Glutamate Receptor 5 Signaling and Behavior.
- Characterization of a Human Point Mutation of VGLUT3 (p.A211V) in the Rodent Brain Suggests a Nonuniform Distribution of the Transporter in Synaptic Vesicles.
Ramet, The Journal of neuroscience : the official journal of the Society for Neuroscience 2017 - GeneRIF: A point mutation in VGLUT3 dramatically reduces its expression in synaptic terminals without altering its function.
- Identification of a novel splicing mutation within SLC17A8 in a Korean family with hearing loss by whole-exome sequencing.
Ryu, Gene 2017 (PubMed)- GeneRIF: Novel pathogenic splicing mutation in SLC17A8 gene identified in a family with hearing loss.
- Screening of the SLC17A8 gene as a causative factor for autosomal dominant non-syndromic hearing loss in Koreans.
Ryu, BMC medical genetics 2016 - GeneRIF: The results from our study suggest that the p.M206Nfs*4 mutation in the SLC17A8 gene is likely a pathogenic mutation that causes autosomal dominant non-syndromic hearing loss.
- The absence of VGLUT3 predisposes to cocaine abuse by increasing dopamine and glutamate signaling in the nucleus accumbens.
Sakae, Molecular psychiatry 2015 (PubMed)- GeneRIF: The results of this study identify VGLUT3 as an unexpected regulator of drug abuse.
- Loss of VGLUT3 Produces Circadian-Dependent Hyperdopaminergia and Ameliorates Motor Dysfunction and l-Dopa-Mediated Dyskinesias in a Model of Parkinson's Disease.
Divito, The Journal of neuroscience : the official journal of the Society for Neuroscience 2015 - GeneRIF: The absence of VGLUT3 in transgenic mice leads to an up-regulation of the midbrain dopamine system and ameliorates motor dysfunction in a model of Parkinson's disease.
- Developmental pattern of three vesicular glutamate transporters in the myenteric plexus of the human fetal small intestine.
Linke, Histology and histopathology 2008 (PubMed)- GeneRIF: VGLUT3 immunoreactivity covered only a limited portion of the possible Glu-ergic pathways in the human fetal small intestine.
- More
- Structural bioinformatics studies of glutamate transporters and their AlphaFold2 predicted water-soluble QTY variants and uncovering the natural mutations of L->Q, I->T, F->Y and Q->L, T->I and Y->F.
Karagöl, PloS one 2024 - “...for the EAATs 14, VGLUTs 13, and YLAT2 are P43003, P43004, P43005, P48664, Q9P2U7, Q9P2U8, Q8NDX2, and Q92536, respectively. The sequences were available from UniProt [ 24 ]. The QTY code was applied to transmembrane alpha-helices of each protein sequence, using the topological information and cellular...”
- THE CONCISE GUIDE TO PHARMACOLOGY 2017/18: Transporters
Alexander, British journal of pharmacology 2017 - “...Systematic nomenclature SLC17A7 SLC17A6 SLC17A8 HGNC, UniProt SLC17A7 , Q9P2U7 SLC17A6 , Q9P2U8 SLC17A8 , Q8NDX2 Common abreviation VGLUT1 VGLUT2 VGLUT3 Endogenous substrates Lglutamic acid > Dglutamic acid Lglutamic acid > Dglutamic acid Lglutamic acid > Dglutamic acid Stoichiometry Unknown Unknown Unknown Comments Endogenous ketoacids produced...”
- The Concise Guide to PHARMACOLOGY 2015/16: Transporters
Alexander, British journal of pharmacology 2015 - “...Common abreviation VGLUT1 VGLUT2 VGLUT3 HGNC, UniProt SLC17A7 , Q9P2U7 SLC17A6 , Q9P2U8 SLC17A8 , Q8NDX2 Endogenous substrates Lglutamic acid > Dglutamic acid Lglutamic acid > Dglutamic acid Lglutamic acid > Dglutamic acid Stoichiometry Unknown Unknown Unknown Comments Endogenous ketoacids produced during fasting have been proposed...”
- The Concise Guide to PHARMACOLOGY 2013/14: transporters
Alexander, British journal of pharmacology 2013 - “...SLC17A7 SLC17A6 SLC17A8 Common abbreviation VGLUT1 VGLUT2 VGLUT3 HGNC, UniProt SLC17A7, Q9P2U7 SLC17A6, Q9P2U8 SLC17A8, Q8NDX2 Endogenous substrates L-glutamic acid > D-glutamic acid L-glutamic acid > D-glutamic acid L-glutamic acid > D-glutamic acid Stoichiometry Unknown Unknown Unknown Comments Endogenous ketoacids produced during fasting have been proposed...”
- Functionally important amino acids in the Arabidopsis thylakoid phosphate transporter: homology modeling and site-directed mutagenesis.
Ruiz-Pavón, Biochemistry 2010 - “...ANTR1 (UniProt O82390), sialin from human (Q9NRA2), vesicular glutamate transporters VGLUT13 from human (Q9P2U7, Q9P2U8, Q8NDX2), and Na + /P i cotransporters NPT1 and NPT3 from human (Q14916 and O00624) and NPT4 from rat (Q8CJH9) were aligned using MUSCLE. The five mutated residues are indicated in...”
NP_001263381 sialin isoform b from Mus musculus
26% identity, 41% coverage
- Progressive leukoencephalopathy impairs neurobehavioral development in sialin-deficient mice.
Stroobants, Experimental neurology 2017 (PubMed)- GeneRIF: This study demonstrated that Progressive leukoencephalopathy impairs neurobehavioral development in sialin-deficient mice.
- Autophagy regulates the stability of sialin, a lysosomal sialic acid transporter.
Huang, Bioscience, biotechnology, and biochemistry 2015 (PubMed)- GeneRIF: Autophagy regulates the stability of sialin, a lysosomal sialic acid transporter.
- Vesicular uptake and exocytosis of L-aspartate is independent of sialin.
Morland, FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2013 - GeneRIF: l-aspartate is exocytotically released from nerve terminals after vesicular accumulation by a transporter other than sialin.
- Vesicular uptake of N-acetylaspartylglutamate is catalysed by sialin (SLC17A5).
Lodder-Gadaczek, The Biochemical journal 2013 (PubMed)- GeneRIF: The uptake of N-acetylaspartylglutamate into synaptic vesicles depends on sialic acid transporter sialin, SLC17A5.
- The lysosomal sialic acid transporter sialin is required for normal CNS myelination.
Prolo, The Journal of neuroscience : the official journal of the Society for Neuroscience 2009 - GeneRIF: These findings suggest that a defect in maturation of cells in the oligodendrocyte lineage leads to increased apoptosis and underlies the myelination defect associated with sialin loss.
- Identification of a vesicular aspartate transporter.
Miyaji, Proceedings of the National Academy of Sciences of the United States of America 2008 - GeneRIF: sialin possesses dual physiological functions and acts as a vesicular aspartate/glutamate transporter
Q9I1L1 Probable 2-ketogluconate transporter from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
PA2262 probable 2-ketogluconate transporter from Pseudomonas aeruginosa PAO1
EIP97_RS14865 MFS transporter from Pseudomonas aeruginosa UCBPP-PA14
21% identity, 89% coverage
VGLU3_MOUSE / Q8BFU8 Vesicular glutamate transporter 3; VGluT3; Solute carrier family 17 member 8 from Mus musculus (Mouse) (see 5 papers)
TC 2.A.1.14.23 / Q8BFU8 Vesicular glutamate transporter #3 (VGLUT3) [Its absence in mice causes sensorineural deafness and seizures]. 70% identical to VGLUT2 (TC# 2.A.1.14.16) (Gras et al., 2002). VGLUT1-3 concentrate glutamate into synaptic vesicles before its exocytotic release and contribute to the regulation of serotonergic transmission and anxiety (Amilhon et al., 2010). It may catalyze uptake of the neurotransmitter coupled with H+ export and K+ uptake from Mus musculus (see 6 papers)
NP_892004 vesicular glutamate transporter 3 isoform 1 from Mus musculus
23% identity, 39% coverage
- function: Multifunctional transporter that transports L-glutamate as well as multiple ions such as chloride, sodium and phosphate (PubMed:12384506, PubMed:18080752, PubMed:18215623). At the synaptic vesicle membrane, mainly functions as an uniporter that mediates the uptake of L-glutamate into synaptic vesicles at presynaptic nerve terminals of excitatory neural cells (PubMed:12384506, PubMed:18080752, PubMed:18215623). The L-glutamate uniporter activity is electrogenic and is driven by the proton electrochemical gradient, mainly by the electrical gradient established by the vacuolar H(+)-ATPase across the synaptic vesicle membrane (PubMed:12384506). In addition, functions as a chloride channel that allows a chloride permeation through the synaptic vesicle membrane that affects the proton electrochemical gradient and promotes synaptic vesicles acidification (By similarity). At the plasma membrane, following exocytosis, functions as a symporter of Na(+) and phosphate from the extracellular space to the cytoplasm allowing synaptic phosphate homeostasis regulation (By similarity). The symporter activity is electrogenic (By similarity). Moreover, operates synergistically with SLC18A3/VACHT under a constant H(+) gradient, thereby allowing striatal vesicular acetylcholine uptake (PubMed:18278042).
catalytic activity: L-glutamate(out) = L-glutamate(in) (RHEA:66336)
catalytic activity: 3 Na(+)(out) + phosphate(out) = 3 Na(+)(in) + phosphate(in) (RHEA:71255)
catalytic activity: chloride(in) = chloride(out) (RHEA:29823)
disruption phenotype: Mice are hyperactive and suffer from intermittent, spontaneous cortical seizures. They exhibit reduced cholinergic transmission in the ventral portion of the striatum and defective acetylcholine release. They are hypersensitive to cocaine and less prone to haloperidol-induced catalepsy. - substrates: H+, K+, glutamate
- Neurochemical Markers in the Mammalian Brain: Structure, Roles in Synaptic Communication, and Pharmacological Relevance.
Rees, Current medicinal chemistry 2017 - “...Subcellular localization(s) Sequence length (aa) Molecular weight (kDa) Isoelectric point (pH) Hydropathy (GRAVY) Transporters vGluT3 (Q8BFU8) Solute carrier family 17 (sodium phosphate), member 3; Solute carrier family 17 (vesicular glutamate transporter), member 3 Cytoplasmic vesicle membrane 601 66.148 6.05 0.186 Ca 2+ proteins binding CB (P12658)...”
- Spinal VGLUT3 lineage neurons drive visceral mechanical allodynia but not sensitized visceromotor reflexes.
Qi, Neuron 2023 (PubMed)- GeneRIF: Spinal VGLUT3 lineage neurons drive visceral mechanical allodynia but not sensitized visceromotor reflexes.
- Absence of VGLUT3 Expression Leads to Impaired Fear Memory in Mice.
de, eNeuro 2023 - GeneRIF: Absence of VGLUT3 Expression Leads to Impaired Fear Memory in Mice.
- VGLUT3 Deletion Rescues Motor Deficits and Neuronal Loss in the zQ175 Mouse Model of Huntington's Disease.
Ibrahim, The Journal of neuroscience : the official journal of the Society for Neuroscience 2023 - GeneRIF: VGLUT3 Deletion Rescues Motor Deficits and Neuronal Loss in the zQ175 Mouse Model of Huntington's Disease.
- Interrelationships between Cellular Density, Mosaic Patterning, and Dendritic Coverage of VGluT3 Amacrine Cells.
Keeley, The Journal of neuroscience : the official journal of the Society for Neuroscience 2021 - GeneRIF: Interrelationships between Cellular Density, Mosaic Patterning, and Dendritic Coverage of VGluT3 Amacrine Cells.
- Neurochemically and Hodologically Distinct Ascending VGLUT3 versus Serotonin Subsystems Comprise the r2-Pet1 Median Raphe.
Senft, The Journal of neuroscience : the official journal of the Society for Neuroscience 2021 - GeneRIF: Neurochemically and Hodologically Distinct Ascending VGLUT3 versus Serotonin Subsystems Comprise the r2-Pet1 Median Raphe.
- Low-Threshold Mechanosensitive VGLUT3-Lineage Sensory Neurons Mediate Spinal Inhibition of Itch by Touch.
Sakai, The Journal of neuroscience : the official journal of the Society for Neuroscience 2020 - GeneRIF: Low-Threshold Mechanosensitive VGLUT3-Lineage Sensory Neurons Mediate Spinal Inhibition of Itch by Touch.
- Differential expression of VGLUT3 in laboratory mouse strains: Impact on drug-induced hyperlocomotion and anxiety-related behaviors.
Sakae, Genes, brain, and behavior 2019 (PubMed)- GeneRIF: Five inbred mouse strains express very different levels of VGLUT3. Cocaine-induced hyperlocomotion and anxiety was highly heterogeneous and only partially correlated to VGLUT3 levels.
- VGLUT3 gates psychomotor effects induced by amphetamine.
Mansouri-Guilani, Journal of neurochemistry 2019 (PubMed)- GeneRIF: the expression of VGLUT3 in multiple brain areas is pivotal in gating amphetamine-induced psychomotor adaptations
- More
NPT4_HUMAN / O00476 Sodium-dependent phosphate transport protein 4; Na(+)/PI cotransporter 4; NPT4; Sodium/phosphate cotransporter 4; Solute carrier family 17 member 3 from Homo sapiens (Human) (see 3 papers)
TC 2.A.1.14.28 / O00476 Solute carrier family 17 (sodium phosphate), member 3 from Homo sapiens (see 5 papers)
NP_006623 sodium-dependent phosphate transport protein 4 isoform b from Homo sapiens
26% identity, 36% coverage
- function: [Isoform 2]: Transports organic anions in a voltage-driven, multispecific, manner, on the apical side of renal proximal tubule (PubMed:20810651). In particular, participates in the secretion of urate from the cell into the lumen (PubMed:20810651). Urate is the end product of purine metabolism (PubMed:20810651). May have roles in the metabolism and secretion of estrone sulfate, estradiol-17-beta- glucuronide, ochratoxin A, as wells as drugs such as bumetanide (PubMed:20810651).
catalytic activity: [Isoform 2]: urate(in) + Na(+)(out) = urate(out) + Na(+)(in) (RHEA:72383) - substrates: Na+, Urate, phosphate
tcdb comment: Catalyzes voltage-driven Na+:phosphate cotransport, but also functions in cell elimination of urate at renal tubular cell apical membranes (Prestin et al. 2014) - SLC17A3 rs9379800 and Ischemic Stroke Susceptibility at the Northern Region of Malaysia.
Ching, Journal of stroke and cerebrovascular diseases : the official journal of National Stroke Association 2021 (PubMed)- GeneRIF: SLC17A3 rs9379800 and Ischemic Stroke Susceptibility at the Northern Region of Malaysia.
- Brain age estimation at tract group level and its association with daily life measures, cardiac risk factors and genetic variants.
Salih, Scientific reports 2021 - GeneRIF: Brain age estimation at tract group level and its association with daily life measures, cardiac risk factors and genetic variants.
- The homocysteine associated variant rs548987 of SLC17A3 confers susceptibility to ischemic stroke in Chinese population.
Huang, Journal of the neurological sciences 2016 (PubMed)- GeneRIF: Study used rs548987 of SLC17A3 as a candidate variant of ischemic stroke and performed association analysis in a Chinese population; although rs548987 failed to show significant association with total ischemic stroke and large vessel disease subtype, the C allele of rs548987 showed significant association with small vessel disease subtype of ischemic stroke (OR=0.68, p=0.004).
- Functional analysis of human sodium-phosphate transporter 4 (NPT4/SLC17A3) polymorphisms.
Jutabha, Journal of pharmacological sciences 2011 (PubMed)- GeneRIF: variants carrying SNP V257F, G279R, or P378L exhibited reduced transport of para-aminohippurate, bumetanide, estrone and urate; SNPs may contribute to inter-individual differences in disposition of anionic drugs and certain endogenous organic anions
- A novel human organic anion transporter NPT4 mediates the transport of ochratoxin A.
Jutabha, Journal of pharmacological sciences 2011 (PubMed)- GeneRIF: hNPT4 (SLC17A3) mediated time- and concentration-dependent uptake of OTxA (K(m): 802.8 microM) in a pH- and voltage-sensitive manner.
- Sex and age interaction with genetic association of atherogenic uric acid concentrations.
Brandstätter, Atherosclerosis 2010 - GeneRIF: Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
- GeneRIF: Genetic variants within SLC2A9,ABCG2 and SLC17A3 are associated with uric acid levels
- Common variants in SLC17A3 gene affect intra-personal variation in serum uric acid levels in longitudinal time series.
Polasek, Croatian medical journal 2010 - GeneRIF: SLC17A3 seems to have a major role in determination of serum uric acid repeated measurements variation.
- GeneRIF: Observational study of gene-disease association. (HuGE Navigator)
- Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
Ucisik-Akkaya, Molecular human reproduction 2010 (PubMed)- GeneRIF: Observational study of gene-disease association. (HuGE Navigator)
- More
- Near-Single-Cell Proteomics Profiling of the Proximal Tubular and Glomerulus of the Normal Human Kidney.
Sigdel, Frontiers in medicine 2020 - “...0.37 PT SLC5A8 Q8N695 SC5A8_HUMAN Solute carrier family 5 member 8 23.83 1.84 PT SLC17A3 O00476 NPT4_HUMAN Solute carrier family 17 member 3 23.52 1.75 PT UGT2A1 Q9Y4X1 UD2A1_HUUMAN UDP glucuronosyltransferase family 2 member A1 complex locus 23.21 1.35 Discussion With rapid advancement of single cell...”
- THE CONCISE GUIDE TO PHARMACOLOGY 2017/18: Transporters
Alexander, British journal of pharmacology 2017 - “...nomenclature SLC17A1 SLC17A2 SLC17A3 SLC17A4 HGNC, UniProt SLC17A1 , Q14916 SLC17A2 , O00624 SLC17A3 , O00476 SLC17A4 , Q9Y2C5 Common abreviation NPT1 NPT3 NPT4 Substrates probenecid [ 74 ], penicillin G [ 74 ], Cl [ 263 ], organic acids [ 274 ], uric acid [...”
- ATM/G6PD-driven redox metabolism promotes FLT3 inhibitor resistance in acute myeloid leukemia.
Gregory, Proceedings of the National Academy of Sciences of the United States of America 2016 - The Concise Guide to PHARMACOLOGY 2015/16: Transporters
Alexander, British journal of pharmacology 2015 - “...Common abreviation NPT1 NPT3 NPT4 HGNC, UniProt SLC17A1 , Q14916 SLC17A2 , O00624 SLC17A3 , O00476 SLC17A4 , Q9Y2C5 Substrates probenecid [ 69 ], penicillin G [ 69 ], Cl [ 240 ], organic acids [ 240 ], uric acid [ 240 ], phosphate [ 240...”
- The Concise Guide to PHARMACOLOGY 2013/14: transporters
Alexander, British journal of pharmacology 2013 - “...SLC17A2 SLC17A3 SLC17A4 Common abbreviation NPT1 NPT3 NPT4 HGNC, UniProt SLC17A1, Q14916 SLC17A2, O00624 SLC17A3, O00476 SLC17A4, Q9Y2C5 Substrates Cl- 275 , probenecid 274 , PO34- 275 , uric acid 275 , penicillin G 274 , organic acids 275 Stoichiometry Unknown Unknown Unknown Unknown Sialic acid...”
- An insulin-like modular basis for the evolution of glucose transporters (GLUT) with implications for diabetes.
Root-Bernstein, Evolutionary bioinformatics online 2007 - “...phosphate transporter proteins 1, 2A, 2B, 2C, 3, and 4 (Q14916, Q06495, O95436, Q8N130, O00624, O00476), the sodium dependent phosphate transporter 1 (Q8WUM9), the yeast mannose transporter (P40107), and the arabidopsis mannose transporter (Q941R4). Similarities were determined using LALIGN ( Huang and Miller, 1991 ). The...”
LOC101889974 putative inorganic phosphate cotransporter from Musca domestica
22% identity, 41% coverage
ANTR6_ARATH / Q3E9A0 Probable anion transporter 6, chloroplastic; Phosphate transporter PHT4;5 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
AT5G20380 PHT4;5; inorganic phosphate transmembrane transporter from Arabidopsis thaliana
23% identity, 57% coverage
- function: Inorganic phosphate and probable anion transporter.
- Genetically manipulated chloroplast stromal phosphate levels alter photosynthetic efficiency
Raju, Plant physiology 2024 - “...AT5G23570 PHT2;1 Gramene: AT3G26570 PHT2;1 Araport: AT3G26570 TPT Gramene: At5g46110 TPT Araport: At5g46110 PHT4;4 Gramene: At5g20380 PHT4;4 Araport: At5g20380 References Aflalo C , Shavit N . Steady-state kinetics of photophosphorylation: limited access of nucleotides to the active site on the ATP synthetase . FEBS Lett. 1983...”
- Chloroplast phosphate transporter CrPHT4-7 regulates phosphate homeostasis and photosynthesis in Chlamydomonas
Tóth, Plant physiology 2024 - “...family 17 (sodium-dependent Pi co-transporter, SLC17A). CrPHT4-7 shows 42.6% similarity to the A. thaliana AtPHT4;5 (AT5G20380) Pi transporter and around 29% to 36% similarity with other Pi transporters in the PHT4 family, namely AtPHT4;2, 4;1, 4;6, and 4;3. CrPHT4-7 also shows a relatively high, 37.4% similarity...”
- “...PHT4;2 , PHT4;3 , PHT4;4 , PHT4;5 , and PHT4;6 are At2g29650, At2g38060, At3g46980, At4g00370, At5g20380, and At5g44370, respectively. Supplementary Material kiad607_Supplementary_Data Acknowledgments The authors thank Drs. Pter Horvth and Balzs Papp (BRC Szeged, Hungary) for laboratory equipment support and Dr. Cornelia Spetea (University of Gothenburg,...”
- The chloroplastic phosphate transporter CrPHT4-7 supports phosphate homeostasis and photosynthesis in Chlamydomonas
Tóth, 2023 - Interdependent iron and phosphorus availability controls photosynthesis through retrograde signaling
Nam, Nature communications 2021 - “...SALK_128714 (AT4G00360), N469134 (AT4G00370), SAIL_842_E09 (AT4G00380), N866595 (At4g00390), SAIL_633_E10 (At4g00400), SALK_077222 (AT3G02870) SALK_053900 (AT3G46980), SALK_114708 (AT5G20380), SAIL_809_B01 (AT5G44370), SALK_067629 (AT4G28610), and SALK_039445 (AT5G20150) were obtained from the Nottingham Arabidopsis Stock Centre (NASC). Homozygous mutant lines were confirmed by PCR using the primers listed in Supplementary Table...”
- Identification and selection of reference genes for gene expression analysis by quantitative real-time PCR in Suaeda glauca's response to salinity
Wang, Scientific reports 2021 - “...0.994 R: CTGTTCCAGTGATCAACTTAGT BE656716.1 At2g43790 0.81 MPK6 F: CAACCTCATTCATCAGTCATCA 112 87 0.9763 R: TGGTTTGCGGTGGTTGATTAG AW982148.1 AT5G20380 0.75 PHT4;5 F: AGCAACAGCATTCGTTCCAG 106 106 0.9983 R: GATCTGTGGCAGCTGATGGT R: AACTTCAAAGGCAATGTTGAAAAC BE644575.1 At5g52660 0.85 MYB F: CTGCTAATGTGGTGTCACCAT 114 98 0.9923 R: CATGCTCTTCTTCAGTCCAAC BE231371.1 AP2 F: AACTCTTTCTTCCTTAATCACTCT 124 95 0.9748 R:...”
- Translational Regulation of Metabolic Dynamics during Effector-Triggered Immunity
Yoo, Molecular plant 2020 - “...for the endogenous TBF1 mRNA in WT and rps2 (A) , TEup (AT1G77380) and TEdn (AT5G20380) genes in WT (B) . Read coverage was normalized to uniquely mapped reads with the Integrated Genome Browser (IGB) ( Nicol et al., 2009 ). Figure S4. Related to Figure...”
- Analysis of miRNAs and their targets during adventitious shoot organogenesis of Acacia crassicarpa
Liu, PloS one 2014 - “...4 AT5G44280 3 RING 1A AT5G55590 3 Pectin lyase-like superfamily protein AT5G55835 3 MIR156H; miRNA AT5G20380 3 phosphate transporter 4;5 AT1G48742 2 MIR157D; miRNA AT3G18217 2 MIR157C; miRNA AT1G30450 3 cation-chloride co-transporter 1 AT1G73650 3 Protein of unknown function (DUF1295) AT3G13490 3 Lysyl-tRNA synthetase, class II...”
- Phylogenomic analysis of the Chlamydomonas genome unmasks proteins potentially involved in photosynthetic function and regulation
Grossman, Photosynthesis research 2010 - “...CGL19 AthCDF2 205894 At5g39660 Photoperiodic flowering response transcription factor Nucleic acid transactions CGL15 AthPHT4 205891 At5g20380 Phosphate transporter 4;5 Transport/Trafficking CPLD23 AthGONST3 149680 At1g76340 Golgi nucleotide-sugar transporter Transport/trafficking TRXL1 AthACHT1 205754 At4g26160 Atypical Cys His rich thioredoxin 1 Redox CPLD30 AthENH1 183051 At5g17170 Rubredoxin domain protein...”
A1S_1867 General substrate transporter:Major facilitator superfamily from Acinetobacter baumannii ATCC 17978
24% identity, 66% coverage
Q03567 Uncharacterized transporter slc-17.2 from Caenorhabditis elegans
25% identity, 51% coverage
- Major facilitator superfamily
Pao, Microbiology and molecular biology reviews : MMBR 1998 - “...Z70286 Z73910 A56410 D28532 X77241 A48916 U28504 Z48055 Z47070 Z70037 P34272 Q03567 P34644 U58737 S44900 U41110 GB GB GB GB GB GB GB PIR GB GB PIR GB GB GB GB...”
TC 2.A.1.15.7 / Q6FBB3 Aromatic compound (benzoate) uptake transporter of 450 aas from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
26% identity, 57% coverage
Q8CJH9 Na/Pi cotransporter 4 from Rattus norvegicus
26% identity, 34% coverage
BRA0300 nitrite extrusion protein from Brucella suis 1330
25% identity, 33% coverage
BMEII0948 NITRITE EXTRUSION PROTEIN from Brucella melitensis 16M
25% identity, 31% coverage
- Comparative Transcriptome Analysis of Artificially Induced Rough-Mutant Brucella Strain RM57 and Its Parent Strain Brucella melitensis M1981
Peng, Frontiers in veterinary science 2019 - “...BMEI1362 , BMEII0988 , BMEII0353 , and BMEII0321 while BMEI0427 , BMEI1313 , BMEI0877 , BMEII0948 , BMEII0759 , BMEI0422 , BMEI0386 , BMEII0758 , BMEI0454 , and BMEII0844 were highly down-regulated. Figure 6 Heat map of the comparative transcriptome analysis of RM57 and M1981. With...”
- Erythritol triggers expression of virulence traits in Brucella melitensis
Petersen, Microbes and infection 2013 - “...FixG 2.64 0.99 BMEI1967 N utilization substance protein A 2.02 0.68 BMEII0246 Nitroreductase 2.31 0.88 BMEII0948 Nitrite extrusion protein 2.35 0.93 BMEII0975 Regulatory protein NosR 2.60 0.97 Iron Metabolism BMEI0673 Thiosulfate-binding protein precursor 2.73 0.99 BMEI1591 Ferredoxin-NADP reductase 2.38 0.89 BMEII0105 Iron-regulated outer membrane protein FrpB...”
Q7A_444 MFS transporter from Methylophaga nitratireducenticrescens
30% identity, 41% coverage
BTH_I1856 nitrate/nitrite transporter from Burkholderia thailandensis E264
26% identity, 66% coverage
CCNA_00339 transporter from Caulobacter crescentus NA1000
25% identity, 69% coverage
RSc1093 PUTATIVE 4-HYDROXYBENZOATE TRANSPORTER TRANSMEMBRANE PROTEIN from Ralstonia solanacearum GMI1000
22% identity, 47% coverage
LOC101738703 putative inorganic phosphate cotransporter from Bombyx mori
24% identity, 35% coverage
LOC101737579 putative inorganic phosphate cotransporter from Bombyx mori
23% identity, 35% coverage
NPT3_MOUSE / Q5SZA1 Sodium-dependent phosphate transport protein 3; Na(+)/PI cotransporter 3; Sodium/phosphate cotransporter 3; Solute carrier family 17 member 2 from Mus musculus (Mouse) (see paper)
22% identity, 75% coverage
- function: Acts as a membrane potential-dependent organic anion transporter, the transport requires a low concentration of chloride ions (PubMed:25972451). Mediates chloride-dependent transport of urate (PubMed:25972451). Can actively transport inorganic phosphate into cells via Na(+) cotransport (PubMed:25972451).
catalytic activity: 3 Na(+)(out) + phosphate(out) = 3 Na(+)(in) + phosphate(in) (RHEA:71255)
catalytic activity: urate(out) + n chloride(in) = urate(in) + n chloride(out) (RHEA:72319)
AOLE_11820 MFS transporter from Acinetobacter oleivorans DR1
23% identity, 58% coverage
XP_006516584 sodium-dependent phosphate transport protein 4 isoform X2 from Mus musculus
22% identity, 43% coverage
lmo2816 similar to transport protein from Listeria monocytogenes EGD-e
21% identity, 71% coverage
Bxe_B0430 Major facilitator superfamily (MFS) metabolite/H+ symporter from Burkholderia xenovorans LB400
Bxe_B0430 MFS transporter from Paraburkholderia xenovorans LB400
21% identity, 61% coverage
NPT1_RABIT / Q28722 Sodium-dependent phosphate transport protein 1; NAPI-1; Na(+)/PI cotransporter 1; Renal Na(+)-dependent phosphate cotransporter 1; Renal sodium-dependent phosphate transport protein 1; Renal sodium-phosphate transport protein 1; Sodium/phosphate cotransporter 1; Solute carrier family 17 member 1 from Oryctolagus cuniculus (Rabbit) (see paper)
22% identity, 60% coverage
- function: Important for the resorption of phosphate by the kidney. May be involved in actively transporting phosphate into cells via Na(+) cotransport in the renal brush border membrane. Plays a role in urate transport in the kidney.
catalytic activity: 3 Na(+)(out) + phosphate(out) = 3 Na(+)(in) + phosphate(in) (RHEA:71255)
catalytic activity: urate(out) = urate(in) (RHEA:60368)
subunit: Interacts with PDZK1.
XP_008260566 sodium-dependent phosphate transport protein 1 isoform X2 from Oryctolagus cuniculus
22% identity, 60% coverage
OG1RF_12274 MFS transporter from Enterococcus faecalis OG1RF
25% identity, 60% coverage
Smlt2769 putative MFS transmembrane nitrite extrusion transporter protein from Stenotrophomonas maltophilia K279a
23% identity, 59% coverage
LOC100164217 putative inorganic phosphate cotransporter from Acyrthosiphon pisum
28% identity, 21% coverage
AZOLI_p20645 MFS transporter from Azospirillum lipoferum 4B
28% identity, 42% coverage
LI17339_03285 nitrate/nitrite transporter from Bacillus licheniformis LMG 17339
24% identity, 62% coverage
- Nitrous oxide emission by the non-denitrifying, nitrate ammonifier Bacillus licheniformis
Sun, BMC genomics 2016 - “...amt2 LI6934_06945 (contig13_69958_71169) LI7559_12245 (contig20_86027_87406) LI17339_15165 (contig06_266544_265900) nitrate/nitrite transporter (NarK2-type) narK1 LI6934_10275 (contig17_50582_49398) LI7559_10215 (contig17_107711_109207) LI17339_03285 (contig01_609186_608002) narK2 LI6934_11810 (contig19_2217_3713) LI7559_18410 (contig29_340309_339125) LI17339_16960 (contig09_16054_161849) narK3 LI6934_04585 (contig09_42906_44111) LI7559_1255 (contig21_43506_44711) - formate/nitrite transporter nirC LI6934_08170 (contig13_306187_306975) LI7559_03215 (contig06_176423_177211) LI17339_04610 (contig03_178114_177326) NO reduction to N 2 O NO...”
HWX41_RS13665 nitrate transporter NarK from Bacillus paramycoides
23% identity, 61% coverage
- Genomic Analysis of Endophytic Bacillus cereus T4S and Its Plant Growth-Promoting Traits
Adeleke, Plants (Basel, Switzerland) 2021 - “...HWX41_RS13710 HWX41_RS13705 nar nitrate reductase subunit alpha HWX41_RS13715 nar nitrate reductase HWX41_RS13945 nark nitrate transporter HWX41_RS13665 Ammonia assimilation glt X glutamate-tRNA ligase HWX41_RS26220 glt P glutamate/aspartate: proton symporter Glt P HWX41_RS16800 plants-10-01776-t003_Table 3 Table 3 Genes Involved in Phosphate Solubilization and Transport. Pathway Gene Product Locus...”
VDAG_08086 vitamin H transporter 1 from Verticillium dahliae VdLs.17
23% identity, 55% coverage
- Transcriptomic analysis of gene expression of Verticillium dahliae upon treatment of the cotton root exudates
Zhang, BMC genomics 2020 - “...sugar transporter genes (VDAG_07141, VDAG_04513, VDAG_08286, VDAG_09121, VDAG_07563, VDAG_03714), 3 vitamin transporter genes (VDAG_01193, VDAG_09734, VDAG_08086), 2 oligopeptide transporter (VDAG_06060, VDAG_05125), 1 MFS transporter gene (VDAG_09088), 1 quinate permease gene (VDAG_02089). Functional analysis for these candidate genes may be useful for the study of the pathogenicity...”
- “...18 VDAG_07563 Sugar transporter STL1 3.617449 23.46294 4.627167 4.448156 3.630124 4.030519 3.522212 2.785485 1.485532 19 VDAG_08086 Vitamin H transporter 1 1.611487 2.873923 3.84332 1.865509 3.010686 2.468418 1.583815 1.710399 2.150159 20 VDAG_09088 MFS transporter 0.338652 3.60446 0.393707 0.739129 0.402541 0.835313 0.099841 1.023219 0.125486 21 VDAG_09121 Maltose permease...”
RL0996 putative transmembrane transporter from Rhizobium leguminosarum bv. viciae 3841
27% identity, 42% coverage
- Adaptation of Rhizobium leguminosarum to pea, alfalfa and sugar beet rhizospheres investigated by comparative transcriptomics
Ramachandran, Genome biology 2011 - “...elevated in that of pea (Figure 2 ). The gene for MFS transporter of tartrate (RL0996) was induced by three-fold or more in the pea rhizosphere (Figure 1 ; Additional file 7 ) while that for tartrate dehydrogenase (RL0995), which converts tartrate to oxaloglycolate for metabolism...”
- “...glyoxylate cycle, was only induced by legumes [ 20 ] (Figure 2 ). Mutation of RL0996, encoding the tartrate transporter, led to the largest effect on ability to compete in the pea rhizosphere (RCI = 0.35; Additional file 8 ). RL0996 was also induced 1.5-fold in...”
NP_525116 Na[+]-dependent inorganic phosphate cotransporter, isoform A from Drosophila melanogaster
22% identity, 75% coverage
NP_611376 uncharacterized protein, isoform A from Drosophila melanogaster
22% identity, 60% coverage
S17A9_MOUSE / Q8VCL5 Voltage-gated purine nucleotide uniporter SLC17A9; Solute carrier family 17 member 9; Vesicular nucleotide transporter; VNUT from Mus musculus (Mouse) (see 5 papers)
NP_898984 voltage-gated purine nucleotide uniporter SLC17A9 from Mus musculus
20% identity, 88% coverage
- function: Voltage-gated ATP nucleotide uniporter that can also transport the purine nucleotides ADP and GTP. Uses the membrane potential as the driving force to control ATP accumulation in lysosomes and secretory vesicles (PubMed:23876310, PubMed:24962569, PubMed:27477609). By controlling ATP storage in lysosomes, regulates ATP-dependent proteins of these organelles (PubMed:23832620, PubMed:24962569, PubMed:27477609). Also indirectly regulates the exocytosis of ATP through its import into lysosomes in astrocytes and secretory vesicles such as adrenal chromaffin granules, mucin granules and synaptic vesicles (By similarity).
catalytic activity: ATP(in) = ATP(out) (RHEA:75687)
catalytic activity: ADP(in) = ADP(out) (RHEA:75783)
catalytic activity: GTP(in) = GTP(out) (RHEA:75787) - Clodronate, an inhibitor of the vesicular nucleotide transporter, ameliorates steatohepatitis and acute liver injury.
Hasuzawa, Scientific reports 2021 - GeneRIF: Clodronate, an inhibitor of the vesicular nucleotide transporter, ameliorates steatohepatitis and acute liver injury.
- Transient Receptor Potential Vanilloid 4 Regulation of Adenosine Triphosphate Release by the Adenosine Triphosphate Transporter Vesicular Nucleotide Transporter, a Novel Therapeutic Target for Gastrointestinal Baroreception and Chronic Inflammation.
Mihara, Digestion 2020 - GeneRIF: Transient Receptor Potential Vanilloid 4 Regulation of Adenosine Triphosphate Release by the Adenosine Triphosphate Transporter Vesicular Nucleotide Transporter, a Novel Therapeutic Target for Gastrointestinal Baroreception and Chronic Inflammation.
- VNUT/SLC17A9, a vesicular nucleotide transporter, regulates osteoblast differentiation.
Inoue, FEBS open bio 2020 - GeneRIF: VNUT/SLC17A9, a vesicular nucleotide transporter, regulates osteoblast differentiation.
- Live Imaging Reveals Cerebellar Neural Stem Cell Dynamics and the Role of VNUT in Lineage Progression.
Paniagua-Herranz, Stem cell reports 2020 - GeneRIF: Live Imaging Reveals Cerebellar Neural Stem Cell Dynamics and the Role of VNUT in Lineage Progression.
- Vesicular nucleotide transporter mediates ATP release and migration in neutrophils.
Harada, The Journal of biological chemistry 2018 - GeneRIF: Data (including data from studies using knockout mice) suggest that Vnut/Slc17a9 localized in tertiary/secretory granules of neutrophils is responsible for vesicular ATP release and subsequent neutrophil migration/infiltration.
- Anti-Depressant Fluoxetine Reveals its Therapeutic Effect Via Astrocytes.
Kinoshita, EBioMedicine 2018 - GeneRIF: FLX-induced anti-depressive behavior was decreased in astrocyte-selective VNUT-knockout mice or when VNUT was deleted in mice, but it was increased when astrocyte-selective VNUT was overexpressed in mice
- Involvement of VNUT-exocytosis in transient receptor potential vanilloid 4-dependent ATP release from gastrointestinal epithelium.
Mihara, PloS one 2018 - GeneRIF: expression of TRPV4 and VNUT in normal human gastrointestinal cell derived cell lines
- Clock Genes Regulate the Circadian Expression of Piezo1, TRPV4, Connexin26, and VNUT in an Ex Vivo Mouse Bladder Mucosa.
Ihara, PloS one 2017 - GeneRIF: clock genes exist in the mouse bladder mucosa and regulate exact circadian gene expression in mice
- More
Q7JRA7 RH60267p from Drosophila melanogaster
22% identity, 62% coverage
MAV_1387 drug transporter from Mycobacterium avium 104
24% identity, 28% coverage
S17A9_RAT / P0DX21 Voltage-gated purine nucleotide uniporter SLC17A9; Solute carrier family 17 member 9; Vesicular nucleotide transporter; VNUT from Rattus norvegicus (Rat) (see 2 papers)
20% identity, 88% coverage
- function: Voltage-gated ATP nucleotide uniporter that can also transport the purine nucleotides ADP and GTP. Uses the membrane potential as the driving force to control ATP accumulation in lysosomes and secretory vesicles (PubMed:18375752). By controlling ATP storage in lysosomes, regulates ATP-dependent proteins of these organelles (By similarity). Also indirectly regulates the exocytosis of ATP through its import into lysosomes in astrocytes and secretory vesicles such as adrenal chromaffin granules, mucin granules and synaptic vesicles (PubMed:18375752).
catalytic activity: ATP(in) = ATP(out) (RHEA:75687)
catalytic activity: ADP(in) = ADP(out) (RHEA:75783)
catalytic activity: GTP(in) = GTP(out) (RHEA:75787)
O61369 Putative inorganic phosphate cotransporter from Drosophila ananassae
24% identity, 39% coverage
blr6569 MFS permease from Bradyrhizobium japonicum USDA 110
28% identity, 41% coverage
- Transcriptomic Characterization of Bradyrhizobium diazoefficiens Bacteroids Reveals a Post-Symbiotic, Hemibiotrophic-Like Lifestyle of the Bacteria within Senescing Soybean Nodules
Franck, International journal of molecular sciences 2018 - “...blr2533, blr2715, blr2809, blr3324, blr3400, blr3517, blr4155, blr4311, blr4566, blr4772, blr5162, blr5169, blr5229, blr6118, blr6544, blr6569, blr6661, blr6771, blr7060, blr7216, blr7281, blr7496, blr7595, blr7717, blr7815, blr8000, blr8060, blr8194, bsl3895, bsl7758, bsr1887, and bsr3197. Figure 8 Expressed genes representing the post-symbiotic category. The 33 genes shown in...”
NP_001148138 glycerol 3-phosphate permease from Zea mays
24% identity, 46% coverage
- Janus-Faced Nature of Light in the Cold Acclimation Processes of Maize
Szalai, Frontiers in plant science 2018 - “...chloroplastic 1.807035 2.80E-04 AQK87666 Trehalose-6-phosphate synthase12 1.4775023 1.85E-04 ONM30490 Glycosyltransferase family 61 protein 2.2052014 0.001584862 NP_001148138 Glycerol 3-phosphate permease 1.7980256 0.003462655 ACG38167 Xyloglucan endotransglycosylase/hydrolase protein 8 precursor 1.2368568 2.24E-04 ONM10098 Aldehyde oxidase1 2.1058974 0.00453268 NP_001105608 Pyruvate dehydrogenase (lipoamide) kinase 2 1.6757569 5.62E-05 NP_001105608 Pyruvate dehydrogenase (lipoamide)...”
S17A4_MOUSE / Q5NCM1 Probable small intestine urate exporter; Solute carrier family 17 member 4 from Mus musculus (Mouse) (see paper)
24% identity, 47% coverage
- function: Acts as a membrane potential-dependent organic anion transporter, the transport requires a low concentration of chloride ions (PubMed:22460716). Mediates chloride-dependent transport of urate (PubMed:22460716). Mediates sodium-independent high affinity transport of thyroid hormones including L-thyroxine (T4) and 3,3',5-triiodo-L- thyronine (T3) (By similarity). Can actively transport inorganic phosphate into cells via Na(+) cotransport (By similarity).
catalytic activity: 3 Na(+)(out) + phosphate(out) = 3 Na(+)(in) + phosphate(in) (RHEA:71255)
catalytic activity: urate(out) + n chloride(in) = urate(in) + n chloride(out) (RHEA:72319)
catalytic activity: L-thyroxine(out) = L-thyroxine(in) (RHEA:71819)
catalytic activity: 3,3',5-triiodo-L-thyronine(out) = 3,3',5-triiodo-L- thyronine(in) (RHEA:71811)
GRMZM2G124136 Putative glycerol-3-phosphate transporter 4-like from Zea mays
20% identity, 94% coverage
- Identification of Genomic Regions Associated with Agronomic and Disease Resistance Traits in a Large Set of Multiple DH Populations
Sadessa, Genes 2022 - “...genes are more relevant to plants response to drought stress. Putative candidate genes GRMZM2G142383 and GRMZM2G124136 detected for AD under WW and WS are functionally designated as Uridine kinase-like protein 2 chloroplastic involved in the pyrimidine salvage pathway [ 64 ] and putative glycerol-3-phosphate transporter 4...”
- “...10 11 0.08 0.69 GRMZM5G814904 catechol- O -methyltransferase S5_196250543 5 6.05 10 6 0.17 0.33 GRMZM2G124136 Putative glycerol-3-phosphate transporter 4 S7_127270714 7 3.75 10 8 0.31 0.54 GRMZM2G096092 uncharacterized LOC101027214 S7_132076042 7 7.51 10 6 0.17 0.41 GRMZM2G070375 FIP1 S7_147051998 7 3.71 10 7 0.46 0.32...”
BCAL2625 Major Facilitator Superfamily protein from Burkholderia cenocepacia J2315
27% identity, 49% coverage
A1B9V7 Nitrite transporter from Paracoccus denitrificans (strain Pd 1222)
Pden_4237 nitrite transporter from Paracoccus denitrificans PD1222
26% identity, 32% coverage
- The NtrYX Two-Component System of Paracoccus denitrificans Is Required for the Maintenance of Cellular Iron Homeostasis and for a Complete Denitrification under Iron-Limited Conditions
Olaya-Abril, International journal of molecular sciences 2022 - “...GT TTATGGATCG CG (-248) GT CCCGACCCTG CG (-128) 0.5 0.1 0.7 0.1 20.0 1.3 Pden_4237 A1B9V7 Nitrate/nitrite transporter NarK CT CAAATCGTCA GC (-150) GT CCGGCCGGCC CG (-89) GA TTGGGACTTT CG (-12) GA CTTCTCAAAT CG (-145) GA TTTTTGCAAG CG (-221) 6.8 0.8 8.8 0.13 45.3 3.5 Pden_4238...”
- Denitrification in low oxic environments increases the accumulation of nitrogen oxide intermediates and modulates the evolutionary potential of microbial populations
Takahashi, Environmental microbiology reports 2024 - “...immediately upstream of the following genes using the primer sets listed in Table S3 ; Pden_4237 ( narK ) (genomic positions 1,403,7681,404,041), Pden_2487 ( nirS ) (genomic positions 250,272250,399), Pden_2486 ( nirI ) (genomic positions 250,272250,399) and Pden_4219 ( nosZ ) (genomic positions 1,385,2041,385,540). Each promoter...”
- The NtrYX Two-Component System of Paracoccus denitrificans Is Required for the Maintenance of Cellular Iron Homeostasis and for a Complete Denitrification under Iron-Limited Conditions
Olaya-Abril, International journal of molecular sciences 2022 - “...and iron-depleted conditions. These genes were the nitrate/nitrite-responsive transcriptional regulator nasT (Pden_4455), nitrate/nitrite transporter narK (Pden_4237), the nitrate transporter nasA (Pden_4453), small subunit of the nitric oxide reductase norC (Pden_ Pden_2484), and putative heme-containing nosC (Pden_4221), among others. Similarly, these genes were also upregulated in the...”
- “...(-91) GT TTATGGATCG CG (-248) GT CCCGACCCTG CG (-128) 0.5 0.1 0.7 0.1 20.0 1.3 Pden_4237 A1B9V7 Nitrate/nitrite transporter NarK CT CAAATCGTCA GC (-150) GT CCGGCCGGCC CG (-89) GA TTGGGACTTT CG (-12) GA CTTCTCAAAT CG (-145) GA TTTTTGCAAG CG (-221) 6.8 0.8 8.8 0.13 45.3 3.5...”
S17A4_HUMAN / Q9Y2C5 Probable small intestine urate exporter; Solute carrier family 17 member 4 from Homo sapiens (Human) (see 4 papers)
TC 2.A.1.14.24 / Q9Y2C5 Intestinal mucosal sodium/phosphate symporter, SLC17A4. Maintains phosphate homeostasis; mediates intestinal absorption, bone deposition and resorption and renal excretion from Homo sapiens (see 3 papers)
23% identity, 47% coverage
- function: Acts as a membrane potential-dependent organic anion transporter, the transport requires a low concentration of chloride ions (PubMed:22460716). Mediates chloride-dependent transport of urate (PubMed:22460716). Mediates sodium-independent high affinity transport of thyroid hormones including L-thyroxine (T4) and 3,3',5-triiodo-L- thyronine (T3) (PubMed:30367059, PubMed:34937426). Can actively transport inorganic phosphate into cells via Na(+) cotransport (PubMed:22460716).
catalytic activity: 3 Na(+)(out) + phosphate(out) = 3 Na(+)(in) + phosphate(in) (RHEA:71255)
catalytic activity: urate(out) + n chloride(in) = urate(in) + n chloride(out) (RHEA:72319)
catalytic activity: L-thyroxine(out) = L-thyroxine(in) (RHEA:71819)
catalytic activity: 3,3',5-triiodo-L-thyronine(out) = 3,3',5-triiodo-L- thyronine(in) (RHEA:71811) - substrates: Na+, phosphate
- THE CONCISE GUIDE TO PHARMACOLOGY 2017/18: Transporters
Alexander, British journal of pharmacology 2017 - “...SLC17A3 SLC17A4 HGNC, UniProt SLC17A1 , Q14916 SLC17A2 , O00624 SLC17A3 , O00476 SLC17A4 , Q9Y2C5 Common abreviation NPT1 NPT3 NPT4 Substrates probenecid [ 74 ], penicillin G [ 74 ], Cl [ 263 ], organic acids [ 274 ], uric acid [ 263 ], phosphate...”
- The Concise Guide to PHARMACOLOGY 2015/16: Transporters
Alexander, British journal of pharmacology 2015 - “...NPT3 NPT4 HGNC, UniProt SLC17A1 , Q14916 SLC17A2 , O00624 SLC17A3 , O00476 SLC17A4 , Q9Y2C5 Substrates probenecid [ 69 ], penicillin G [ 69 ], Cl [ 240 ], organic acids [ 240 ], uric acid [ 240 ], phosphate [ 240 ] Stoichiometry Unknown...”
- The Concise Guide to PHARMACOLOGY 2013/14: transporters
Alexander, British journal of pharmacology 2013 - “...SLC17A4 Common abbreviation NPT1 NPT3 NPT4 HGNC, UniProt SLC17A1, Q14916 SLC17A2, O00624 SLC17A3, O00476 SLC17A4, Q9Y2C5 Substrates Cl- 275 , probenecid 274 , PO34- 275 , uric acid 275 , penicillin G 274 , organic acids 275 Stoichiometry Unknown Unknown Unknown Unknown Sialic acid transporter Overview...”
EF2992 major facilitator family transporter from Enterococcus faecalis V583
24% identity, 60% coverage
- Large-scale screening of a targeted Enterococcus faecalis mutant library identifies envelope fitness factors
Rigottier-Gois, PloS one 2011 - “...( ef1027 , ef1172 , ef1705 , ef2170 , ef2196 , ef2198 , ef2167 , ef2992 ). The affected genes mostly encode proteins with predicted roles in cell envelope metabolism, in polysaccharide synthesis or degradation, or in transport or substrate binding. 10.1371/journal.pone.0029023.g001 Figure 1 Venn diagram...”
BMB171_RS10550 nitrate transporter NarK from Bacillus thuringiensis BMB171
23% identity, 61% coverage
BA2138 nitrate transporter from Bacillus anthracis str. Ames
23% identity, 61% coverage
BWI76_RS23725 2-deoxy-D-ribonate transporter 2 from Klebsiella michiganensis M5al
20% identity, 68% coverage
- mutant phenotype: Important in carbon source 2-Deoxy-D-ribonic acid lithium salt. Similar to deoxyribonate transporters in other bacteria. However it is not clear why this organism has two deoxyribonate transporters (this gene and BWI76_RS23715)
BC2128 Nitrite extrusion protein from Bacillus cereus ATCC 14579
23% identity, 61% coverage
- SecDF as part of the Sec-translocase facilitates efficient secretion of Bacillus cereus toxins and cell wall-associated proteins
Vörös, PloS one 2014 - “...BC3941-3944; BC0695-0698) including a cytochrome d ubiquinol oxidase (BC4792-4793), fermentation (BC0491-0492, BC2220), anaerobic respiration (BC2134, BC2128) and the regulator of the arginine deaminase operon arcABDC (BC0410). The genome of B. cereus ATCC 14579 also contains a cryptic, linear plasmid pBClin15, encoding what appears to be a...”
- Global gene expression profile for swarming Bacillus cereus bacteria
Salvetti, Applied and environmental microbiology 2011 - “...BC0408 BC0409 BC0410 BC0491 BC0492 BC2220 BC0668 BC2134 BC2128 Virulence Other a BC3526 BC3698 BC3101 BC0753 BC0754 BC0755 BC0756 BC1435 BC1436 Gene name...”
- “...BC2220), oxidative phosphorylation (BC4792), and anaerobic respiration (BC2128 and BC2134), were downregulated in the swarming compared to the nonswarming...”
BWI76_RS23725 MFS transporter from Klebsiella sp. M5al
20% identity, 68% coverage
- Oxidative Pathways of Deoxyribose and Deoxyribonate Catabolism
Price, mSystems 2019 - “...michiganensis are important for growth on deoxyribonate, although BWI76_RS23715 mutants have a stronger phenotype than BWI76_RS23725 mutants (average fitness of 4.0 versus 1.4). Although the genome of K. michiganesis contains a deoxyribose-phosphate aldolase (BWI76_RS04130), it does not seem to encode deoxyribose kinase. This might explain why...”
STM2290 putative MFS family transport protein from Salmonella typhimurium LT2
25% identity, 42% coverage
- Salmonella serovar identification using PCR-based detection of gene presence and absence
Arrach, Journal of clinical microbiology 2008 - “...STM2152, STM2232, STM2240, STM2243, STM2274, STM2289, STM2290, STM2315, STM2377, STM2397, STM2421, STM2423, STM2453, STM2460, STM2514, STM2574, STM2575,...”
MMJJ_01610 MFS transporter from Methanococcus maripaludis
22% identity, 70% coverage
- Proteomic and transcriptomic analysis of selenium utilization in Methanococcus maripaludis
Funkner, mSystems 2024 - “...change of +5.9 log 2 -fold. Other putative transporter-encoding genes with higher mRNA abundances were MMJJ_01610, (change of 6.3 log 2 -fold), MMJJ_00160 (change of 5.8 log 2 -fold), and MMJJ_13000 (change of 5.3 log 2 -fold) ( Table 1 ). TABLE 1 Genes for putative...”
- “...transporters, influenced by the selenium status Locus tag a Annotation Log 2 -fold change Deletion MMJJ_01610 Putative sulfoacetate transporter SauU +6.30 0.13 JpST3 MMJJ_09780 Phosphoglycerate transport regulatory protein PgtC precursor +5.88 0.15 JpST1 MMJJ_00160 Molybdate ABC transporter periplasmic molybdate-binding protein +5.79 0.20 No MMJJ_13000 YedE family...”
ABAYE3680 MFS family transporter from Acinetobacter baumannii AYE
21% identity, 70% coverage
NanX / b4279 sialic acid transporter NanX from Escherichia coli K-12 substr. MG1655 (see 5 papers)
nanX / P39352 sialic acid transporter NanX from Escherichia coli (strain K12) (see 4 papers)
NANX_ECOLI / P39352 Sialic acid transporter NanX from Escherichia coli (strain K12) (see 3 papers)
b4279 putative transport protein from Escherichia coli str. K-12 substr. MG1655
24% identity, 42% coverage
- function: Probably transports across the inner membrane the two dehydrated forms of N-acetylneuraminate (Neu5Ac), 2,7-anhydro-N- acetylneuraminate (2,7-AN) and 2-deoxy-2,3-didehydro-N- acetylneuraminate (2,3-EN).
disruption phenotype: Inactivation of the gene in NanR-deficient cells prevents the growth on 2,7-AN and 2,3-EN (PubMed:32542330). Deletion of the gene in strain BW25113 results in loss of growth on 2,7-AN but not on Neu5Ac (PubMed:32669363). - Multiple evolutionary origins reflect the importance of sialic acid transporters in the colonization potential of bacterial pathogens and commensals
Severi, Microbial genomics 2021 - “...26, 51, 52, 92 ] 2020 [ 51, 52 ] H+ 2,7-Anhydro-Neu5Ac Neu5Ac2en Escherichia coli P39352 ST2 DctP PF03480 SiaPQM SiaP (SBP), SiaQM (TMD1+TMD2) or SiaP (SBP), SiaQ (TMD1), SiaM (TMD2) SiaPT, NanPU, NeuT [ 19, 42, 86, 9397 ] 2005 [ 15, 93 ] Na+...”
- Major facilitator superfamily
Pao, Microbiology and molecular biology reviews : MMBR 1998 - “...Haemophilus influenzae Escherichia coli 496 407 425 P41036 C64167 P39352 SP PIR SP a For abbreviations, see Table 3 footnotes. ble 11). This protein, the...”
- Microarray analysis of transposition targets in Escherichia coli: the impact of transcription
Manna, Proceedings of the National Academy of Sciences of the United States of America 2004 - “...b1139 b0557 b3624 b1721 b0555 b1719 b1458 b2034 b1718 b4279 b1156 b1145 b2369 b1245 b1243 b1142 b1503 b1048 b3623 b0544 rfaS wbbH b1505 b1368 trkG lit ybcU...”
BTH_II2286 major facilitator family transporter from Burkholderia thailandensis E264
24% identity, 55% coverage
Avin_51300 major facilitator superfamily (MFS) permease from Azotobacter vinelandii AvOP
28% identity, 43% coverage
- Precision control of ammonium release in Azotobacter vinelandii
Barney, Microbial biotechnology 2024 - “...of biomass and corresponding PHB. The dgoK , dgoA , galD , dgoT and unnamed Avin_51300 and Avin_51290 genes are organized as one continuous cluster with dgoR upstream in A. vinelandii (Avin_51350 to Avin_51290). The genes galD , dgoK and dgoA represent genes that convert d...”
- “...on the current annotations. The dgoT gene is annotated as a d galactonate transporter, and Avin_51300 is annotated as a major facilitator superfamily permease, while Avin_51290 is annotated as a 2hydroxyacid dehydrogenase and dgoR is annotated as a transcriptional regulator protein. Each of these genes showed...”
VF_0072 sn-glycerol-3-phosphate transporter from Vibrio fischeri ES114
23% identity, 94% coverage
YfaV / b2246 putative transporter YfaV from Escherichia coli K-12 substr. MG1655 (see 4 papers)
TC 2.A.1.14.35 / P76470 Inner membrane transport protein RhmT from Escherichia coli (strain K12) (see 4 papers)
23% identity, 42% coverage
- substrates: Rhamnonate, Unknown
QL104_06755 spinster family MFS transporter from Pseudomonas piscis
27% identity, 51% coverage
LOC100809973 probable anion transporter 5 from Glycine max
21% identity, 44% coverage
STM2274 putative permease from Salmonella typhimurium LT2
22% identity, 62% coverage
- AT Homopolymer Strings in Salmonella enterica Subspecies I Contribute to Speciation and Serovar Diversity
Guard, Microorganisms 2021 - “...ssp H2 SEEG pseudogene E3 ubiquitin-protein ligase; induced by the SPI-2 regulatory ssrA/B virulence factor STM2274 SEEG9184_09070 SEN_RS11735 conserved unnamed SEEG pseudogene MFS transporter transporter STM2691 SEEG9184_07115 SEN_RS13585 conserved unnamed SEEG pseudogene type I secretion system permease/ATPase: TolC family OMP virulence factor STM3658 SEEG9184_00930 SEN_RS18105 conserved...”
- Salmonella serovar identification using PCR-based detection of gene presence and absence
Arrach, Journal of clinical microbiology 2008 - “...STM2135, STM2151, STM2152, STM2232, STM2240, STM2243, STM2274, STM2289, STM2290, STM2315, STM2377, STM2397, STM2421, STM2423, STM2453, STM2460, STM2514,...”
- An allele of gyrA prevents Salmonella enterica serovar Typhimurium from using succinate as a carbon source
Schmitz, Journal of bacteriology 2006 - “...with insertions in rcsB, yojN, apbE, ompC, STM2273, STM2274, or STM2275 generated two phenotypic classes (Suc and Suc) when the succinate-negative mutant was...”
SPA_RS02955 MFS transporter from Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC
22% identity, 62% coverage
NPT1_HUMAN / Q14916 Sodium-dependent phosphate transport protein 1; Na(+)/PI cotransporter 1; Na/Pi-4; Renal Na(+)-dependent phosphate cotransporter 1; Renal sodium-dependent phosphate transport protein 1; Renal sodium-phosphate transport protein 1; Sodium/phosphate cotransporter 1; Solute carrier family 17 member 1 from Homo sapiens (Human) (see 3 papers)
TC 2.A.1.14.27 / Q14916 Voltage-driven Na+:phosphate cotransporter; solute carrier family 17, member 1 from Homo sapiens (see 7 papers)
XP_016866690 sodium-dependent phosphate transport protein 1 isoform X1 from Homo sapiens
24% identity, 54% coverage
- function: Important for the resorption of phosphate by the kidney (PubMed:7826357). May be involved in actively transporting phosphate into cells via Na(+) cotransport in the renal brush border membrane (PubMed:7826357). Plays a role in urate transport in the kidney (PubMed:25252215, PubMed:27906618).
catalytic activity: 3 Na(+)(out) + phosphate(out) = 3 Na(+)(in) + phosphate(in) (RHEA:71255)
catalytic activity: urate(out) = urate(in) (RHEA:60368)
subunit: Interacts with PDZK1. - substrates: Na+, Urate, phosphate
tcdb comment: Orthologous to 2.A.1.14.6. Transports other anions including urate; functions in urate cell elimination at the renal apical membrane (Prestin et al. 2014) - Examining the Association of Rare Allelic Variants in Urate Transporters SLC22A11, SLC22A13, and SLC17A1 with Hyperuricemia and Gout.
Vávra, Disease markers 2024 - GeneRIF: Examining the Association of Rare Allelic Variants in Urate Transporters SLC22A11, SLC22A13, and SLC17A1 with Hyperuricemia and Gout.
- GWAS of clinically defined gout and subtypes identifies multiple susceptibility loci that include urate transporter genes.
Nakayama, Annals of the rheumatic diseases 2017 - GeneRIF: A meta-analysis of all gout with Japanese, Caucasian and NZ Polynesian populations revealed that rs2285340 of SLC22A12 and rs1165196 of SLC17A1 showed a significant association but did not reach a genome-wide significance level.
- Expression of a human NPT1/SLC17A1 missense variant which increases urate export.
Sakiyama, Nucleosides, nucleotides & nucleic acids 2016 (PubMed)- GeneRIF: I269T, a common missense variant of NPT1, might have faster conformation changes than NPT1 wild type in terms of the alternating-access model of transporters, and increases renal urate export in humans.
- NPT1/SLC17A1 is a renal urate exporter in humans and its common gain-of-function variant decreases the risk of renal underexcretion gout.
Chiba, Arthritis & rheumatology (Hoboken, N.J.) 2015 (PubMed)- GeneRIF: NPT1/SLC17A1 is a renal urate exporter in humans and its common gain-of-function variant decreases the risk of renal underexcretion gout.
- Polymorphisms in GCKR, SLC17A1 and SLC22A12 were associated with phenotype gout in Han Chinese males: a case-control study.
Zhou, BMC medical genetics 2015 - GeneRIF: Polymorphisms in GCKR, SLC17A1 and SLC22A12 were associated with phenotype gout in Han Chinese males.
- Genetic variants of SLC17A1 are associated with cholesterol homeostasis and hyperhomocysteinaemia in Japanese men.
Koyama, Scientific reports 2015 - GeneRIF: Data suggest that single nucleotide polymorphisms (SNPs) of solute carrier family 17 member 1 (SLC17A1) are potential biomarkers for altered cholesterol homeostasis and hyperhomocysteinaemia in Japanese men.
- [Polymorphisms of SLC17A1 gene and their interaction with alcohol drinking among Uygur patients with hyperuricemia].
Wang, Zhonghua yi xue yi chuan xue za zhi = Zhonghua yixue yichuanxue zazhi = Chinese journal of medical genetics 2015 (PubMed)- GeneRIF: Data suggest that single nucleotide polymorphisms (SNPs) rs9467596 and rs2096386 of the solute carrier family 17 (sodium phosphate), member 1 protein (SLC17A1) gene may have a correlation between hyperuricemia and alcohol drinking among Uygur patients.
- Population-specific effects of SLC17A1 genotype on serum urate concentrations and renal excretion of uric acid during a fructose load.
Dalbeth, Annals of the rheumatic diseases 2014 (PubMed)- GeneRIF: We observed a clear effect of SLC17A1 genotype on fructose load in Europeans but not Polynesian subgroups.
- More
- Bioinformatic characterization of ENPEP, the gene encoding a potential cofactor for SARS-CoV-2 infection.
Arppo, PloS one 2024 - “...ENTPD5 0.8081 3367 O75356 Ectonucleoside triphosphate diphosphohydrolase 5 nucleotide phosphatase Kidney cortex SLC17A1 0.8066 10929 Q14916 Sodium-dependent phosphate transport protein 1 secondary carrier transporter Kidney cortex ACE2 0.8062 13557 Q9BYF1 Angiotensin-converting enzyme 2 metalloprotease Testis STOM 0.7812 3383 P27105 Erythrocyte band 7 integral membrane protein cytoskeletal...”
- THE CONCISE GUIDE TO PHARMACOLOGY 2017/18: Transporters
Alexander, British journal of pharmacology 2017 - “...cotransporter 4 Sodium/phosphate cotransporter homolog Systematic nomenclature SLC17A1 SLC17A2 SLC17A3 SLC17A4 HGNC, UniProt SLC17A1 , Q14916 SLC17A2 , O00624 SLC17A3 , O00476 SLC17A4 , Q9Y2C5 Common abreviation NPT1 NPT3 NPT4 Substrates probenecid [ 74 ], penicillin G [ 74 ], Cl [ 263 ], organic acids...”
- Signatures of Evolutionary Adaptation in Quantitative Trait Loci Influencing Trace Element Homeostasis in Liver.
Engelken, Molecular biology and evolution 2016 - “...Quantified SLC11A2 2 NRAM2 (P49281) 2 Targeted Quantified rs6580783 g2 , rs6580784 c2 SLC17A1 NPT1 (Q14916) rs17342717 h SLC40A1 S40A1 (Q9NP59) Quantified rs1437883 c , rs2067416 a STEAP3 3 STEA3 (Q658P3) 3 Quantified Quantified TF TRFE (P02787) Quantified Quantified rs1525889 a , rs1799852 f , rs3811647...”
- The Concise Guide to PHARMACOLOGY 2015/16: Transporters
Alexander, British journal of pharmacology 2015 - “...Systematic nomenclature SLC17A1 SLC17A2 SLC17A3 SLC17A4 Common abreviation NPT1 NPT3 NPT4 HGNC, UniProt SLC17A1 , Q14916 SLC17A2 , O00624 SLC17A3 , O00476 SLC17A4 , Q9Y2C5 Substrates probenecid [ 69 ], penicillin G [ 69 ], Cl [ 240 ], organic acids [ 240 ], uric acid...”
- Identification of target proteins involved in cochlear otosclerosis.
Richard, Otology & neurotology : official publication of the American Otological Society, American Neurotology Society [and] European Academy of Otology and Neurotology 2015 - “...II catalytic activity, protein binding P62314 Small nuclear ribonucleoprotein Sm D1 protein binding, RNA binding Q14916 Sodium-dependent phosphate transport protein 1 metal ion binding, transporter activity B2R9V7 Superoxide dismutase antioxidant activity, catalytic activity, metal ion binding, protein binding Q5PY19 Transforming growth factor beta 1 protein binding,...”
- The Concise Guide to PHARMACOLOGY 2013/14: transporters
Alexander, British journal of pharmacology 2013 - “...homolog Systematic nomenclature SLC17A1 SLC17A2 SLC17A3 SLC17A4 Common abbreviation NPT1 NPT3 NPT4 HGNC, UniProt SLC17A1, Q14916 SLC17A2, O00624 SLC17A3, O00476 SLC17A4, Q9Y2C5 Substrates Cl- 275 , probenecid 274 , PO34- 275 , uric acid 275 , penicillin G 274 , organic acids 275 Stoichiometry Unknown Unknown...”
- Functionally important amino acids in the Arabidopsis thylakoid phosphate transporter: homology modeling and site-directed mutagenesis.
Ruiz-Pavón, Biochemistry 2010 - “...human (Q9P2U7, Q9P2U8, Q8NDX2), and Na + /P i cotransporters NPT1 and NPT3 from human (Q14916 and O00624) and NPT4 from rat (Q8CJH9) were aligned using MUSCLE. The five mutated residues are indicated in dark boxes. Conservation is marked in ClustalX style, where asterisks (*) indicate...”
- An insulin-like modular basis for the evolution of glucose transporters (GLUT) with implications for diabetes.
Root-Bernstein, Evolutionary bioinformatics online 2007 - “...control sequences the sodium dependent phosphate transporter proteins 1, 2A, 2B, 2C, 3, and 4 (Q14916, Q06495, O95436, Q8N130, O00624, O00476), the sodium dependent phosphate transporter 1 (Q8WUM9), the yeast mannose transporter (P40107), and the arabidopsis mannose transporter (Q941R4). Similarities were determined using LALIGN ( Huang...”
BAbS19_II02030 MucK, cis,cis-muconate transport protein from Brucella abortus S19
BAB2_0213 Binding-protein-dependent transport systems inner membrane component:Tetracycline resistance protein TetB:General substrate t... from Brucella melitensis biovar Abortus 2308
22% identity, 75% coverage
- Identification of potential antigenic peptides of Brucella through proteome and peptidome
Pei, Veterinary medicine and science 2023 - “...we identified four proteins containing both MHCI and MHCIIbinding peptides including AtpA, AtpD, DnaK and BAbS19_II02030. They were also compared with the predicted peptides to estimate their reliability. Conclusions The peptides we screened could bind to MHC molecules. After being stimulated with antigen T epitopes, Memory...”
- “...wider than for MHCIbinding peptides. Interestingly, we found four proteins (including AtpA, AtpD, DnaK and BAbS19_II02030) that had both MHCI and MHCIIbinding peptides, indicating the potential to simultaneously activate humoral and cellular immunity. It has been reported that DnaK can be used as an antigen for...”
- Molecular control of gene expression by Brucella BaaR, an IclR-type transcriptional repressor
Herrou, The Journal of biological chemistry 2018 - “...transcription by adipic acid required the gene bab2_0213, which encodes a major facilitator superfamily transporter, suggesting that Bab2_0213 transports adipic...”
- “...molecules, adipic acid, required the transporter gene bab2_0213, providing evidence that bab2_0213 encodes an adipic acid transporter. However, none of the...”
- Molecular control of gene expression byBrucellaBaaR, an IclR-family repressor
Herrou, 2018
TC 2.A.1.53.6 / I7I0I1 MFS uptake permease specific for pyrimidines, PhtC of 422 aas and 12 TMSs from Legionella pneumophila subsp. pneumophila
19% identity, 72% coverage
- substrates: Pyrimidines
tcdb comment: Together with PhtD (TC# 2.A.1.53.6), it contributes to protection of L. pneumophila from dTMP starvation, protects the cell from 5-fluorodeoxyuridine (FUdR) toxicity and is required for growth of L. pneumophila in macrophage (Fonseca et al. 2014)
SEN2256 putative transmembrane transpot protein from Salmonella enterica subsp. enterica serovar Enteritidis str. P125109
SEN_RS11735 MFS transporter from Salmonella enterica subsp. enterica serovar Enteritidis str.
22% identity, 62% coverage
SMb20436 putative nitrate transporter protein from Sinorhizobium meliloti 1021
27% identity, 32% coverage
- The Nitrate Assimilatory Pathway in Sinorhizobium meliloti: Contribution to NO Production
Ruiz, Frontiers in microbiology 2019 - “...Other genes are colored as follow: brown, nirD (encoding a small nitrite reductase subunit); green, SMb20436 (encoding the putative nitrite transporter); red, cysG (SMb20987) (encoding the putative protein involved in the synthesis of sirohaem, the nitrite reductase cofactor); purple, flp . Closest homologs (protein identity) found...”
- “...to note that the closest NarK homolog in S. meliloti (26.5% identity) is encoded by SMb20436 which has not been characterized yet but was found to be highly induced under nitrogen deprivation conditions (LS and CB, unpublished). Its involvement in NO 2 export remains, however, to...”
- Global mapping of transcription start sites and promoter motifs in the symbiotic α-proteobacterium Sinorhizobium meliloti 1021
Schlüter, BMC genomics 2013 - “...and SMa0872. Only four of our predicted promoters ( dctA , glnB , glnK , SMb20436) were previously characterized as RpoN-dependent or predicted by in silico methods [ 25 ]; therefore, our data provide a useful resource for the identification of additional RpoN-regulated genes and characterization...”
- Absence of functional TolC protein causes increased stress response gene expression in Sinorhizobium meliloti
Santos, BMC microbiology 2010 - “...nrtB nitrate transporter, permease -33.0 SMa0585 nrtA nitrate ABC transporter, periplasmic nitrate binding protein -34.8 SMb20436 Probable nitrate transporter -62.2/-63.5 SMb20602 ABC transporter, ATP-binding protein -12.0 SMb20603 ABC transporter, permease -15.7 SMb20604 ABC transporter, permease -25.0 SMb20605 ABC transporter, periplasmic solute-binding protein -22.4 SMb21095 ABC transporter,...”
- “...tolC mutant (Fig. 5 ). For example, nitrate transporters encoded by nrtABC , SMb21114 and SMb20436 showed in excess of 10-fold decreased expression while the ammonium transporter encoded by the amtB gene showed 8-fold decreased expression. Genes associated with general amino acid transport ( aapJMPQ )...”
- The role of sigma factor RpoH1 in the pH stress response of Sinorhizobium meliloti
de, BMC microbiology 2010 - “...role in nitrate assimilation, such as nirB , nirD and narB and the nitrate transporter smb20436 (Figure 4 , Additional file 5 ). Analysis of expression profiles of the S. meliloti rpoH1 mutant following an acidic pH shift in view of wild type results In order...”
- The complete sequence of the 1,683-kb pSymB megaplasmid from the N2-fixing endosymbiont Sinorhizobium meliloti
Finan, Proceedings of the National Academy of Sciences of the United States of America 2001 - “...Superfamily, including DctA, and possible nitrate (SMb20436), sulfate (SMb20070), and xanthine/uracil (SMb21281) permeases. Genes encoding transmembrane efflux...”
TC 2.A.1.14.6 / Q61983 Na:Pi symporter, NPT1 or SLC17A1. (Renal chloride-dependent polyspecific anion exporter; transports organic acids such as p-aminohippurate, ureate, and acetylsalicylate (asprin)). Catalyzes ureate excretion. A mutant form shows increased risk of gout in humans from Mus musculus (Mouse) (see 3 papers)
20% identity, 60% coverage
- substrates: Acetylsalicylate, Ureate, p-aminohippurate
NPT1_MOUSE / Q61983 Sodium-dependent phosphate transport protein 1; Na(+)/PI cotransporter 1; Renal Na(+)-dependent phosphate cotransporter 1; Renal sodium-dependent phosphate transport protein 1; Renal sodium-phosphate transport protein 1; Sodium/phosphate cotransporter 1; Solute carrier family 17 member 1 from Mus musculus (Mouse) (see 2 papers)
20% identity, 60% coverage
- function: Important for the resorption of phosphate by the kidney. May be involved in actively transporting phosphate into cells via Na(+) cotransport in the renal brush border membrane. Plays a role in urate transport in the kidney.
catalytic activity: 3 Na(+)(out) + phosphate(out) = 3 Na(+)(in) + phosphate(in) (RHEA:71255)
catalytic activity: urate(out) = urate(in) (RHEA:60368)
subunit: Interacts with PDZK1.
NP_598238 sodium-dependent phosphate transport protein 1 from Rattus norvegicus
20% identity, 54% coverage
- Localization of vesicular glutamate transporters and neuronal nitric oxide synthase in rat nucleus tractus solitarii.
Lin, Neuroscience 2004 (PubMed)- GeneRIF: A high density of VGluT1-immunoreactive fibers is present in gracilis and cuneatus nuclei, a moderate density in lateral and interstitial subnuclei, and a low density in dorsolateral, ventral and intermediate subnuclei of the nucleus tractus solitarii.
- Expression of vesicular glutamate transporters in rat lumbar spinal cord, with a note on dorsal root ganglia.
Landry, The Journal of comparative neurology 2004 (PubMed)- GeneRIF: VGLUT1 and VGLUT2 transcripts are colocalized in most sensory neurons of the dorsal root ganglia, as well as in motor neurons of the ventral horn.
- Vesicular glutamate transporters in the spinal cord, with special reference to sensory primary afferent synapses.
Alvarez, The Journal of comparative neurology 2004 (PubMed)- GeneRIF: VGLUT1 localization (most abundant in LIII/LIV and medial LV of sponal cord) is consistent with an origin from cutaneous and muscle mechanoreceptors and disappeared after rhizotomy.
- Expression of vesicular glutamate transporters, VGluT1 and VGluT2, in axon terminals of nociceptive primary afferent fibers in the superficial layers of the medullary and spinal dorsal horns of the rat.
Li, The Journal of comparative neurology 2003 (PubMed)- GeneRIF: Both VGluT1 and VGluT2 were expressed in axon terminals of primary afferent fibers, including SP-containing nociceptive fibers and that VGluT in unmyelinated primary afferent fibers terminating in lamina II was primarily VGluT2.
- Postnatal development of the glutamate vesicular transporter VGLUT1 in rat cerebral cortex.
Minelli, Brain research. Developmental brain research 2003 (PubMed)- GeneRIF: VGLUT is localized to puncta coexpressing synaptophysin. Faint at birth, increases in subplate during first postnatal week, invades supragranular layers in second week and reaches adult pattern at P20-P30.
- Differential distribution of vesicular glutamate transporters in the rat cerebellar cortex.
Hioki, Neuroscience 2003 (PubMed)- GeneRIF: In the cerebellar granular layer, vesicular glutamate transporter 1 (Slc17a1) immunoreactivity is found in mossy fiber terminals and in single-axon terminals and in most brainstem precerebellar nuclei sending mossy fibers.
- Vesicular glutamate transporters, VGluT1 and VGluT2, in the trigeminal ganglion neurons of the rat, with special reference to coexpression.
Li, The Journal of comparative neurology 2003 (PubMed)- GeneRIF: More than 80% of trigeminal ganglion neurons express vesicular glutamate transporter (VGluT)1 and VGluT2. VGluT1 is coexpressed with VGluT2 in the cell bodies and axon terminals in most trigeminal ganglion neurons.
LOC101739720 putative inorganic phosphate cotransporter from Bombyx mori
22% identity, 89% coverage
EAT4_CAEEL / P34644 Probable vesicular glutamate transporter eat-4; Abnormal pharyngeal pumping eat-4 from Caenorhabditis elegans (see 9 papers)
TC 2.A.1.14.42 / P34644 Vesicular glutamate transporter, EAT-4/VGLUT of 576 aas from Caenorhabditis elegans
NP_499023 putative vesicular glutamate transporter eat-4 from Caenorhabditis elegans
25% identity, 30% coverage
- function: Required for glutamatergic synaptic transmission (PubMed:10818169, PubMed:14762140, PubMed:14981253, PubMed:15371514, PubMed:9526004, PubMed:9870947). In AWB and AWC sensory neurons, required for the detection of preferred food sources, probably via glutamatergic neurotransmission from sensory neurons (PubMed:25009271). Negatively regulates the turning step of male mating behavior (PubMed:17611271).
disruption phenotype: Defective preference between different food odors (PubMed:25009271). Abnormal repetitive turning behavior during male mating (PubMed:17611271). - substrates: glutamate
tcdb comment: EAT-4 is responsible for loading glutamate into synaptic vesicles, and thus in defining the glutamatergic phenotype of a neuron (Serrano-Saiz et al. 2013) - Major facilitator superfamily
Pao, Microbiology and molecular biology reviews : MMBR 1998 - “...Z73910 A56410 D28532 X77241 A48916 U28504 Z48055 Z47070 Z70037 P34272 Q03567 P34644 U58737 S44900 U41110 GB GB GB GB GB GB GB PIR GB GB PIR GB GB GB GB SP SP...”
- l(2)01810 is a novel type of glutamate transporter that is responsible for megamitochondrial formation
Shim, The Biochemical journal 2011 - “...(XP_001919426), Mmus xCT (NP_036120), Hsap xCT (NP_055146), Dmel l(2)01810 (NP_620115), Dmel VGLUT (NP_608681), Cele eat-4 (NP_499023), Drer SLC17a7 (NP_001092225), Hsap VGLUT1 (NP_064705), Rnor VGLUT1 (NP_446311), Dmel arala1 (NP_733365), Cele Q21153 (NP_497274), Drer SLC25a12 (NP_997947), Mmus aralar1 (NP_766024) and Hsap aralar1 (NP_003696). All amino acid sequences in...”
- Human vesicular glutamate transporters functionally complement EAT-4 in C. elegans.
Lee, Molecules and cells 2008 (PubMed)- GeneRIF: Results report that mutants of eat-4 exhibit hyperforaging behavior and that each of the isoforms of human VGLUT functionally rescues the defects in eat-4 worms.
AZL_a09170 3-hydroxyphenylpropionic acid from Azospirillum sp. B510
27% identity, 42% coverage
TC 2.A.1.8.11 / Q93PW1 NarK, component of The 24 TMS, 2 domain, NarK1-NarK2 porter (NarK1 = a NO3-/H+ symporter; NarK2 = a NO3-/NO2- antiporter) from Paracoccus pantotrophus (Thiosphaera pantotropha) (see paper)
26% identity, 32% coverage
- substrates: Nitrite, nitrate
tcdb comment: NarK1 is a nitrate/proton symporter with high affinity for nitrate while NarK2 is a nitrate/nitrite antiporter with lower affinity for nitrate (Goddard et al., 2008). Each transporter requires two conserved arginine residues for activity. A transporter consisting of inactivated NarK1 fused to active NarK2 has a dramatically increased affinity for nitrate compared with NarK2 alone, implying a functional interaction between the two domains (Goddard et al., 2008)
NP_001289572 voltage-gated purine nucleotide uniporter SLC17A9 isoform 2 from Homo sapiens
19% identity, 84% coverage
- LINC01836 Promotes Colorectal Cancer Progression and Functions as ceRNA to Target SLC17A9 by Sponging miR-1226-3p.
Xu, Protein and peptide letters 2024 (PubMed)- GeneRIF: LINC01836 Promotes Colorectal Cancer Progression and Functions as ceRNA to Target SLC17A9 by Sponging miR-1226-3p.
- The HHEX-ABI2/SLC17A9 axis induces cancer stem cell-like properties and tumorigenesis in HCC.
Li, Journal of translational medicine 2024 - GeneRIF: The HHEX-ABI2/SLC17A9 axis induces cancer stem cell-like properties and tumorigenesis in HCC.
- [VNUT Is a Therapeutic Target for Type 2 Diabetes and NASH].
Hasuzawa, Yakugaku zasshi : Journal of the Pharmaceutical Society of Japan 2021 (PubMed)- GeneRIF: [VNUT Is a Therapeutic Target for Type 2 Diabetes and NASH].
- Transient Receptor Potential Vanilloid 4 Regulation of Adenosine Triphosphate Release by the Adenosine Triphosphate Transporter Vesicular Nucleotide Transporter, a Novel Therapeutic Target for Gastrointestinal Baroreception and Chronic Inflammation.
Mihara, Digestion 2020 - GeneRIF: Transient Receptor Potential Vanilloid 4 Regulation of Adenosine Triphosphate Release by the Adenosine Triphosphate Transporter Vesicular Nucleotide Transporter, a Novel Therapeutic Target for Gastrointestinal Baroreception and Chronic Inflammation.
- High expression of SLC17A9 correlates with poor prognosis in colorectal cancer.
Yang, Human pathology 2019 (PubMed)- GeneRIF: our data suggested that SLC17A9 may play an important role in the progression of colorectal cancer
- High SLC17A9 expression correlates with poor survival in gastric carcinoma.
Li, Future oncology (London, England) 2019 (PubMed)- GeneRIF: High expression of SLC17A9 was associated with gastric cancer.
- Vesicular nucleotide transporter mediates ATP release and migration in neutrophils.
Harada, The Journal of biological chemistry 2018 - GeneRIF: Data (including data from studies using knockout mice) suggest that VNUT/SLC17A9 localized in tertiary/secretory granules of neutrophils is responsible for vesicular ATP release and subsequent neutrophil migration/infiltration.
- Involvement of VNUT-exocytosis in transient receptor potential vanilloid 4-dependent ATP release from gastrointestinal epithelium.
Mihara, PloS one 2018 - GeneRIF: expression of TRPV4 and VNUT in normal human gastrointestinal cell derived cell lines
- More
XP_006516679 sodium-dependent phosphate transport protein 1 isoform X1 from Mus musculus
20% identity, 57% coverage
Q9SA71 ABC-type glycerol 3-phosphate transporter (EC 7.6.2.10) from Arabidopsis thaliana (see paper)
AT1G30560 transporter, putative from Arabidopsis thaliana
22% identity, 75% coverage
- Characterization of microRNAs and their target genes associated with transcriptomic changes in gamma-irradiated Arabidopsis
Kim, Genetics and molecular research : GMR 2016 (PubMed)- “...target genes was only observed between miR169d and At1g30560 in the wild-type, and between miR827 and At1g70700 in the cmt3-11t mutant. Quantitative RT-PCR...”
- “...a 2-fold change (Table 6). Transcription of At1g70700 or At1g30560 was closely correlated with miR169d in the cmt3-11t mutant at 5 days or with miR827 in the...”
- Transcriptomic Analysis of Soil-Grown Arabidopsis thaliana Roots and Shoots in Response to a Drought Stress
Rasheed, Frontiers in plant science 2016 - “...members of diverse gene families such as major facilitator super family (MFS) transporters [ AT1G08900, AT1G30560, AT1G33440, AT1G72140, AT1G80530, AT2G26690, AT2G34355, AT3G20460, AT3G45680, AT3G47960, AT4G19450, STP8 (AT5G26250), AT5G27350 , and AT5G62680 ], MATE efflux transporters ( AT1G71140, AT5G17700, AT5G19700 , and AT5G38030 ), microRNA genes [...”
- “...MATE transporter ( AT1G71140 ), (K) MATE transporter ( AT5G17700 ), (L) MFS transporter ( AT1G30560 ), (M) MFS transporter ( AT1G33440 ), (N) OPT3 , (O) Raffinose synthase 5 , (P) SWEET 15 . Error bars represent standard deviation. Gene ontology (GO) and MapMan analysis...”
- Genome-wide analysis of overlapping genes regulated by iron deficiency and phosphate starvation reveals new interactions in Arabidopsis roots
Li, BMC research notes 2015 - “...deficiency were AtOCT1 , an unknown protein gene AT5G20790 and a major facilitator protein gene AT1G30560, which were induced by more than 50-fold (Table 1 ; Fig. 2 c). Highly induced genes under Pi deficiency were ATPS3 (phosphate starvation-induced gene 3), SQD2 (sulfoquinovosyl diacylglycerol 2) and...”
- “...AGL44, ANR1, AGAMOUS-like 44 2.01 0.37 0.82 0.09 At5G20790 Unknown protein 0.32 0.13 90.27 24.26 At1G30560 Major facilitator superfamily protein 55.93 32.45 At5G01220 SQD2, sulfoquinovosyldiacylglycerol 2 0.86 0.06 10.49 3.02 At1G72070 Chaperone DnaJ-domain superfamily protein 1.72 0.62 6.60 3.34 At3G52720 ACA1, ATACA1, CAH1, alpha carbonic anhydrase...”
- Integrative analyses of genetic variation in enzyme activities of primary carbohydrate metabolism reveal distinct modes of regulation in Arabidopsis thaliana
Keurentjes, Genome biology 2008 - “...genes QTLs were found to be involved in epistatic locus pairs (PGM, protein, G1P, UDPG; At1g30560, At3g03250, At5g03300, At5g17310, At5g51820 and At5g51830) (Table 2 ; Tables S1 and S2 in Additional data file 1). In several instances co-location could be observed between structural gene positions and...”
- “...At5g38430; Tables S1 and S2 in Additional data file 1). For three of these genes (At1g30560, At4g39120 and At5g35790) trans eQTL(s) were found, while for the others no significant eQTL could be detected. None of the trans -acting eQTLs coincided with the second locus of the...”
S17A9_HUMAN / Q9BYT1 Voltage-gated purine nucleotide uniporter SLC17A9; Solute carrier family 17 member 9; Vesicular nucleotide transporter; VNUT from Homo sapiens (Human) (see 4 papers)
TC 2.A.1.14.21 / Q9BYT1 The vesicular purine nucleotide (ADP, ATP, GTP) transporter, VNUT or SLC17A9. It is found in synaptic vesicles and chromafin granules (Sawada et al., 2008)) and is associated with disseminated superficial actinic porokeratosis (DSAP), a rare autosomal dominant genodermatosis (Cui et al. 2014). It plays a key role in purinergic signaling through its ability to transport nucleotides using the pmf. It catalyzes Cl--dependent transport activity involving essential arginines in the transmembrane region. Ketoacids inhibit these transporters through modulation of Cl- activation, but Cl- and the arginine residues are not important for ATP binding (Iwai et al. 2019). High expression of SLC17A9 correlates with a poor prognosis for colorectal cancer from Homo sapiens (Human) (see 5 papers)
19% identity, 84% coverage
- function: Voltage-gated ATP nucleotide uniporter that can also transport the purine nucleotides ADP and GTP. Uses the membrane potential as the driving force to control ATP accumulation in lysosomes and secretory vesicles (PubMed:18375752, PubMed:23467297). By controlling ATP storage in lysosomes, regulates ATP-dependent proteins of these organelles (PubMed:35269509). Also indirectly regulates the exocytosis of ATP through its import into lysosomes in astrocytes and secretory vesicles such as adrenal chromaffin granules, mucin granules and synaptic vesicles (PubMed:18375752, PubMed:23467297).
catalytic activity: ATP(in) = ATP(out) (RHEA:75687)
catalytic activity: ADP(in) = ADP(out) (RHEA:75783)
catalytic activity: GTP(in) = GTP(out) (RHEA:75787) - substrates: ADP, ATP, GTP
- THE CONCISE GUIDE TO PHARMACOLOGY 2017/18: Transporters
Alexander, British journal of pharmacology 2017 - “...potential [ 473 ]. Nomenclature Vesicular nucleotide transporter Systematic nomenclature SLC17A9 HGNC, UniProt SLC17A9 , Q9BYT1 Common abreviation VNUT Endogenous substrates guanosine 5'diphosphate [ 473 ], guanosine5'triphosphate [ 473 ], ATP [ 473 ] Stoichiometry Unknown Comments VGLUTs and VNUT can be inhibited by DIDS and...”
- The Concise Guide to PHARMACOLOGY 2015/16: Transporters
Alexander, British journal of pharmacology 2015 - “...]. Nomenclature Vesicular nucleotide transporter Systematic nomenclature SLC17A9 Common abreviation VNUT HGNC, UniProt SLC17A9 , Q9BYT1 Endogenous substrates guanosine 5'diphosphate [ 431 ], guanosine5'triphosphate [ 431 ], ATP [ 431 ] Stoichiometry Unknown Comments VGLUTs and VNUT can be inhibited by DIDS and evans blue dye...”
- The Concise Guide to PHARMACOLOGY 2013/14: transporters
Alexander, British journal of pharmacology 2013 - “...278 . Nomenclature Vesicular nucleotide transporter Systematic nomenclature SLC17A9 Common abbreviation VNUT HGNC, UniProt SLC17A9, Q9BYT1 Endogenous substrates ATP 278 , GTP 278 , GDP 278 Stoichiometry Unknown Comments VGLUTs and VNUT can be inhibited by DIDS and evans blue dye. Further reading Biber J Hernando...”
Tsp_11467 transporter, major facilitator family from Trichinella spiralis
24% identity, 36% coverage
- Global gene expression analysis of the zoonotic parasite Trichinella spiralis revealed novel genes in host parasite interaction
Liu, PLoS neglected tropical diseases 2012 - “...protein A (Tsp_06317), MIF (Tsp_06335), cystatin (Tsp_11249), systeine-glycine (Tsp_01806) and two unknown proteins (Tsp_05189 and Tsp_11467) (C) in Ad (light blue), ML (purple) and NBL (orange) was analyzed by quantitative real-time PCR. Numbers of mRNA transcripts relative to the standard were with log10 scale in plus...”
- “...factor (MIF) (Tsp_06335), cystatin (Tsp_11249), systeine-glycine (Tsp_01806) and two genes with unknown functions (Tsp_05189 and Tsp_11467) were analyzed by quantitative real-time PCR. The q-PCR results confirmed the data obtained in the sequencing analysis ( Figure 4 A, B and C ). Functional annotation of differentially expressed...”
NCU09678 MFS transporter from Neurospora crassa OR74A
29% identity, 23% coverage
- Aspects of the Neurospora crassa Sulfur Starvation Response Are Revealed by Transcriptional Profiling and DNA Affinity Purification Sequencing
Huberman, mSphere 2021 - “...response to sulfur starvation. These included 8 MFS transporter genes (NCU07609, NCU09039, NCU05886, mfs-15 [NCU05884], NCU09678, NCU10512, mdr-7 [NCU01095], and predicted pantothenate transporter gene mfs-29 [NCU07820]) ( Fig.4A ). The direct activation of transporter gene expression by CYS-3 suggested one role of CYS-3 is regulating sulfur...”
- Control of Development, Secondary Metabolism and Light-Dependent Carotenoid Biosynthesis by the Velvet Complex of Neurospora crassa
Bayram, Genetics 2019 - “...NCU07819 NCU05883 NCU05888 NCU07610 NCU07820 NCU05887 NCU01095 NCU09678 NCU05884 Table 3 Top 10 downregulated genes under iron starvation conditions in ve-1...”
STM14_5299 MFS transporter from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
STM4412 putative pemease from Salmonella typhimurium LT2
26% identity, 42% coverage
- Genetic Determinants in Salmonella enterica Serotype Typhimurium Required for Overcoming In Vitro Stressors in the Mimicking Host Environment
Mandal, Microbiology spectrum 2021 - “...vitro or in vivo systemic infection were STM14_1138, STM14_4880, STM14_4992, STM14_5184, STM14_2759, STM14_2807, STM14_3334, STM14_4825, STM14_5299, and STM14_5300. CONCLUSION A recent study by Kroger et al. presented transcriptomes of S. Typhimurium under 22 distinct infection-relevant environmental conditions in vitro . The study found induction of Salmonella...”
- In silico identification and experimental validation of PmrAB targets in Salmonella typhimurium by regulatory motif detection
Marchal, Genome biology 2004 - “...CTTAATACTCACATTAT / / 1000 Other distributions STM4413 Putative imidazolonepropionase and related amidohydrolases; putative RBS for STM4412 ; first gene of operon with STM4412 ( D -galactonate transport) 0.771153 GTGAATGTTAAATTAAT / / 1000 Some or all Salmonella only ybdO STM0606 ; ortholog of E. coli putative transcriptional...”
A1S_1210 major facilitator superfamily MFS_1 from Acinetobacter baumannii ATCC 17978
23% identity, 41% coverage
- Light Regulates Acinetobacter baumannii Chromosomal and pAB3 Plasmid Genes at 37°C
Squire, Journal of bacteriology 2022 (secret) - Mucin acts as a nutrient source and a signal for the differential expression of genes coding for cellular processes and virulence factors in Acinetobacter baumannii
Ohneck, PloS one 2018 - “...3.675535189 5.93865E -05 Alpha/beta hydrolase family protein, CatD A1S_1209 5.473142215 0.002552661 Benzoate transport porin, BenP A1S_1210 5.025999281 0.006720615 Major facilitator superfamily transporter, BenK A1S_1211 4.50743886 8.89275E -06 Benzoate transporter, BenE benD (A1S_1212) 7.230360928 0.000872548 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase, BenD A1S_1213 6.923948731 0.003951293 Benzoate 1,2-dioxygenase electron transfer component, BenC...”
NIAP_ACIAD / Q6FFF7 Niacin transporter NiaP from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) (see paper)
ACIAD0233 putative transport protein (MFS superfamily) from Acinetobacter sp. ADP1
22% identity, 73% coverage
- function: Functions as a high-affinity transporter of niacin (nicotinamide or nicotinate) (PubMed:20926389). Probably substantially contributes to niacin transport when its concentration in the medium is very low (PubMed:20926389).
disruption phenotype: When compared with a nadB mutant (with blocked de novo NAD biosynthesis route), the nadB-niaP double mutant requires at least a 200-fold higher niacin concentration for normal growth. - Genomics-driven reconstruction of acinetobacter NAD metabolism: insights for antibacterial target selection
Sorci, The Journal of biological chemistry 2010 - “...ACIAD0651 ACIAD0062a G G ABAYE0935 ABAYE3104 ABAYE3823 niaP ACIAD0233 BG ABAYE3680 pncA pncB nadV ACIAD3584 ACIAD3562 ACIAD0963 BG BG BG ABAYE0059b ABAYE0102...”
- “...(4) PS6304 ilvC::TetR-tdk (4) PS6308 ilvC::KanR-sacB (4) ACIAD0233 niaP :: tdk-Kan R (5) ACIAD0962 nrtR :: tdk-KanR (5) ACIAD3562 pncB:: tdk-Kan...”
VCA0684 regulatory protein UhpC from Vibrio cholerae O1 biovar eltor str. N16961
23% identity, 46% coverage
VS_RS07525 glycerol-3-phosphate transporter from Vibrio atlanticus
23% identity, 89% coverage
- Indole decreases the virulence of the bivalve model pathogens Vibrio tasmaniensis LGP32 and Vibrio crassostreae J2-9
Zhang, Scientific reports 2022 - “...Down 8.10E59 Glycerol kinase VS_RS21245 3.165892799 Down 4.78E27 MULTISPECIES: sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC VS_RS07525 2.58950755 Down 1.19E20 Glycerol-3-phosphate transporter Chemotaxis VS_RS15830 2.1220644 Down 1.73E15 Methyl-accepting chemotaxis protein VS_RS19890 2.589006414 Down 9.30E20 Methyl-accepting chemotaxis protein VS_RS20855 3.088890925 Down 3.23E24 MULTISPECIES: methyl-accepting chemotaxis protein VS_RS20915 3.323245847...”
VKPMB3780_12375 aromatic acid/H+ symport family MFS transporter from Acinetobacter pittii
23% identity, 41% coverage
YE1193 putative sugar transporter from Yersinia enterocolitica subsp. enterocolitica 8081
29% identity, 25% coverage
- Insights into the evolution of sialic acid catabolism among bacteria
Almagro-Moreno, BMC evolutionary biology 2009 - “...VVA1200 0 Yersinia bercovieri ATCC 43970 NanT YberA_01002486 1.00E-91 Yersinia enterocolitica subsp. enterocolitica 8081 NanT YE1193 0 Yersinia frederiksenii ATCC 33641 NanT YfreA_01001471 0 Yersinia mollaretii ATCC 43969 NanT YmolA_01003560 0 Yersinia pestis KIM NanT y1465 1.00E-180 Yersinia pseudotuberculosis IP 32953 NanT YPTB2736 0 NanT (b3224)...”
P34272 Uncharacterized transporter slc-17.3 from Caenorhabditis elegans
25% identity, 32% coverage
- Major facilitator superfamily
Pao, Microbiology and molecular biology reviews : MMBR 1998 - “...U23521 Z70286 Z73910 A56410 D28532 X77241 A48916 U28504 Z48055 Z47070 Z70037 P34272 Q03567 P34644 U58737 S44900 U41110 GB GB GB GB GB GB GB PIR GB GB PIR GB GB...”
A1S_1805 General substrate transporter:Major facilitator superfamily from Acinetobacter baumannii ATCC 17978
27% identity, 37% coverage
- A1S_2811, a CheA/Y-like hybrid two-component regulator from Acinetobacter baumannii ATCC17978, is involved in surface motility and biofilm formation in this bacterium
Chen, MicrobiologyOpen 2017 - “...The most upregulated genes were A1S1792 (nucleosidediphosphatesugar epimerase), A1S_1791 (tartrate symporter MFS superfamily protein), and A1S_1805 (major facilitator superfamily transporter). Table 2 Downregulated differentially expressed genes in the 2811::FRT mutant (log2.Fold_change <2) Gene_ID Readcount_mu Readcount_wt log2.Fold_change qvalue a Gene_description A1S_0113 2.9 2,952.1 10 0 AcylCoA dehydrogenase...”
- “...6.2 4 1.70E21 Nucleosidediphosphatesugar epimerase A1S_1791 106.7 10.4 3.4 2.30E20 Tartrate symporter MFS superfamily protein A1S_1805 104 10.4 3.3 1.00E19 Major facilitator superfamily transporter A1S_1794 69.4 7.6 3.2 5.80E13 Hypothetical protein A1S_1790 54.3 7.3 2.9 1.50E09 6phosphogluconate dehydrogenase A1S_1422 66.7 12.7 2.4 1.60E09 TriphosphoribosyldephosphoCoA synthase A1S_1806...”
SGRAN_3845 nitrate/nitrite transporter from Sphingopyxis granuli
23% identity, 31% coverage
- Genomic analysis of the nitrate-respiring Sphingopyxis granuli (formerly Sphingomonas macrogoltabida) strain TFA
García-Romero, BMC genomics 2016 - “...coding for proteins involved in nitrate respiration has been found (Fig. 4a ). Gene narU (SGRAN_3845) is annotated as coding for a nitrate/nitrite transporter while the narG (SGRAN_3846), narH (SGRAN_3847) and narI (SGRAN_3849) genes encode, respectively, alpha, beta and gamma subunits of a respiratory nitrate reductase....”
- “...resistance to 20mM nitrite might be due to the presence of a nitrate/nitrite antiporter (NarU; SGRAN_3845) similar to NarK in E. coli , which is involved in a nitrite-extrusion system during anaerobic nitrate respiration [ 40 ]. It is also possible that in environmental conditions, nitrite...”
ESA_03611 hypothetical protein from Enterobacter sakazakii ATCC BAA-894
ESA_03611 MFS transporter from Cronobacter sakazakii ATCC BAA-894
31% identity, 26% coverage
PA14_13750 putative nitrite extrusion protein from Pseudomonas aeruginosa UCBPP-PA14
25% identity, 38% coverage
- PtsN in Pseudomonas aeruginosa Is Phosphorylated by Redundant Upstream Proteins and Impacts Virulence-Related Genes
Underhill, Journal of bacteriology 2023 (secret) - A metabolic and physiological design study of Pseudomonas putida KT2440 capable of anaerobic respiration
Kampers, BMC microbiology 2021 - “...dauBAR operon PDC, T, Steen et al., 2012 PF13309 PDC, T, Steen et al., 2012 PA14_13750 PF07690 Nitrite extrusion protein (putative) NarK2 Membrane protein; Transport of small molecules PDC, T, Steen et al., 2012 PA14_13770 PF07690 Nitrite extrusion protein NarK1 Membrane protein; Transport of small molecules...”
- Gene Expression Profiling of Pseudomonas aeruginosa Upon Exposure to Colistin and Tobramycin
Cianciulli, Frontiers in microbiology 2021 - “...PA14_06830 Nitric-oxide reductase subunit B 134.06 3.35 norD PA14_06840 Dinitrification protein NorD 328.15 2.77 narK1 PA14_13750 Nitrite extrusion protein 1 59.67 X narK2 PA14_13770 Nitrite extrusion protein 2 22.48 X narG PA14_13780 Respiratory nitrate reductase alpha subunit 2.33 X nosL PA14_20150 NosL protein 56.67 3.16 nosY...”
- The Atypical Response Regulator AtvR Is a New Player in Pseudomonas aeruginosa Response to Hypoxia and Virulence
Kaihami, Infection and immunity 2017 - “...PA14/pJN105. PA14 locus PAO1 locus gene fold change PA14_13750 PA3877 narK1 3.62 PA14_13770 PA3876 narK2 5.44 PA14_13780 PA3875 narG 10.23 PA14_13800 PA3874...”
BPSS2206 putative transport related, membrane protein from Burkholderia pseudomallei K96243
23% identity, 47% coverage
NCgl1031 MFS transporter from Corynebacterium glutamicum ATCC 13032
23% identity, 42% coverage
STM14_2712 MFS transporter from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
23% identity, 50% coverage
AAU60_15415 MFS transporter from Acinetobacter johnsonii
24% identity, 60% coverage
- Genome-sequence analysis of Acinetobacter johnsonii MB44 reveals potential nematode-virulent factors
Tian, SpringerPlus 2016 - “...AAU60_14255 AAU60_15880 AAU60_10855 RND transporter AAU60_15305 AAU60_13180 AAU60_06585 MFS transporter AAU60_15825 AAU60_07305 AAU60_08870 AAU60_07850 AAU60_07470 AAU60_15415 Resistance Drug/multi-drug resistance AAU60_03375 AAU60_03380 AAU60_01105 AAU60_00855 a HS: predictions from both HMM (hidden markov model) and SVM (hybrid support vector machines) modules are in consensus Acinetobacter baumannii is the...”
BCAS0706 Major Facilitator Superfamily protein from Burkholderia cenocepacia J2315
23% identity, 77% coverage
ABO_0547 nitrite extrusion protein from Alcanivorax borkumensis SK2
25% identity, 21% coverage
Q9V7S5 Putative inorganic phosphate cotransporter from Drosophila melanogaster
24% identity, 35% coverage
PFLU3002 putative transport system, membrane protein from Pseudomonas fluorescens SBW25
26% identity, 36% coverage
IX87_RS20020 MFS transporter from Acinetobacter baumannii
26% identity, 39% coverage
- Antimicrobial Peptide Cec4 Eradicates the Bacteria of Clinical Carbapenem-Resistant Acinetobacter baumannii Biofilm
Liu, Frontiers in microbiology 2020 - “...artP) in the ABC transport system was down-regulated 1.68-fold, 1.61-fold, and 1.66-fold; the MFS transporter (IX87_RS20020) was down-regulated 2.96-fold, and the EamA family transporter (IX87_RS12100) expression was down-regulated 2.29-fold ( Table 1 ). The expression of MBL fold metallo-hydrolase (IX87_RS19070) was down-regulated about 3-fold, ADC family...”
- “...down-regulated response to Cec4. Gene name Description log 2 Fold_change Corrected p -value Membrane protein IX87_RS20020 MFS transporter 2.96 2.87 10 4 IX87_RS02655 amino acid ABC transporter permease 1.68 4.86 10 3 artP amino acid ABC transporter ATP-binding protein 1.66 2.30 10 2 IX87_RS02660 amino acid...”
TC 2.A.1.15.5 / O30513 Benzoate porter, BenK from Acinetobacter calcoaceticus (see 2 papers)
32% identity, 16% coverage
- substrates: Benzoate
- Biochemical and molecular characterization of the gentisate transporter GenK in Corynebacterium glutamicum
Xu, PloS one 2012 - “...) for comparison are as follows: GenK (accession no. NP_602219), BenK (accession no. NP_602219 and O30513), PcaK (accession no. Q51955), TfdK (accession no. Q46M63), VanK (accession no. O24842), MhpT (accession no. P77589), MucK (accession no. P94131), MmlH (accession no. O51798), Orf1 (accession no. O24723), YceI (accession...”
For advice on how to use these tools together, see
Interactive tools for functional annotation of bacterial genomes.
The PaperBLAST database links 798,070 different protein sequences to 1,261,478 scientific articles. Searches against EuropePMC were last performed on May 12 2025.
PaperBLAST builds a database of protein sequences that are linked
to scientific articles. These links come from automated text searches
against the articles in EuropePMC
and from manually-curated information from GeneRIF, UniProtKB/Swiss-Prot,
BRENDA,
CAZy (as made available by dbCAN),
BioLiP,
CharProtDB,
MetaCyc,
EcoCyc,
TCDB,
REBASE,
the Fitness Browser,
and a subset of the European Nucleotide Archive with the /experiment tag.
Given this database and a protein sequence query,
PaperBLAST uses protein-protein BLAST
to find similar sequences with E < 0.001.
To build the database, we query EuropePMC with locus tags, with RefSeq protein
identifiers, and with UniProt
accessions. We obtain the locus tags from RefSeq or from MicrobesOnline. We use
queries of the form "locus_tag AND genus_name" to try to ensure that
the paper is actually discussing that gene. Because EuropePMC indexes
most recent biomedical papers, even if they are not open access, some
of the links may be to papers that you cannot read or that our
computers cannot read. We query each of these identifiers that
appears in the open access part of EuropePMC, as well as every locus
tag that appears in the 500 most-referenced genomes, so that a gene
may appear in the PaperBLAST results even though none of the papers
that mention it are open access. We also incorporate text-mined links
from EuropePMC that link open access articles to UniProt or RefSeq
identifiers. (This yields some additional links because EuropePMC
uses different heuristics for their text mining than we do.)
For every article that mentions a locus tag, a RefSeq protein
identifier, or a UniProt accession, we try to select one or two
snippets of text that refer to the protein. If we cannot get access to
the full text, we try to select a snippet from the abstract, but
unfortunately, unique identifiers such as locus tags are rarely
provided in abstracts.
PaperBLAST also incorporates manually-curated protein functions:
- Proteins from NCBI's RefSeq are included if a
GeneRIF
entry links the gene to an article in
PubMed®.
GeneRIF also provides a short summary of the article's claim about the
protein, which is shown instead of a snippet.
- Proteins from Swiss-Prot (the curated part of UniProt)
are included if the curators
identified experimental evidence for the protein's function (evidence
code ECO:0000269). For these proteins, the fields of the Swiss-Prot entry that
describe the protein's function are shown (with bold headings).
- Proteins from BRENDA,
a curated database of enzymes, are included if they are linked to a paper in PubMed
and their full sequence is known.
- Every protein from the non-redundant subset of
BioLiP,
a database
of ligand-binding sites and catalytic residues in protein structures, is included. Since BioLiP itself
does not include descriptions of the proteins, those are taken from the
Protein Data Bank.
Descriptions from PDB rely on the original submitter of the
structure and cannot be updated by others, so they may be less reliable.
(For SitesBLAST and Sites on a Tree, we use a larger subset of BioLiP so that every
ligand is represented among a group of structures with similar sequences, but for
PaperBLAST, we use the non-redundant set provided by BioLiP.)
- Every protein from EcoCyc, a curated
database of the proteins in Escherichia coli K-12, is included, regardless
of whether they are characterized or not.
- Proteins from the MetaCyc metabolic pathway database
are included if they are linked to a paper in PubMed and their full sequence is known.
- Proteins from the Transport Classification Database (TCDB)
are included if they have known substrate(s), have reference(s),
and are not described as uncharacterized or putative.
(Some of the references are not visible on the PaperBLAST web site.)
- Every protein from CharProtDB,
a database of experimentally characterized protein annotations, is included.
- Proteins from the CAZy database of carbohydrate-active enzymes
are included if they are associated with an Enzyme Classification number.
Even though CAZy does not provide links from individual protein sequences to papers,
these should all be experimentally-characterized proteins.
- Proteins from the REBASE database
of restriction enzymes are included if they have known specificity.
- Every protein with an evidence-based reannotation (based on mutant phenotypes)
in the Fitness Browser is included.
- Sequence-specific transcription factors (including sigma factors and DNA-binding response regulators)
with experimentally-determined DNA binding sites from the
PRODORIC database of gene regulation in prokaryotes.
- Putative transcription factors from RegPrecise
that have manually-curated predictions for their binding sites. These predictions are based on
conserved putative regulatory sites across genomes that contain similar transcription factors,
so PaperBLAST clusters the TFs at 70% identity and retains just one member of each cluster.
- Coding sequence (CDS) features from the
European Nucleotide Archive (ENA)
are included if the /experiment tag is set (implying that there is experimental evidence for the annotation),
the nucleotide entry links to paper(s) in PubMed,
and the nucleotide entry is from the STD data class
(implying that these are targeted annotated sequences, not from shotgun sequencing).
Also, to filter out genes whose transcription or translation was detected, but whose function
was not studied, nucleotide entries or papers with more than 25 such proteins are excluded.
Descriptions from ENA rely on the original submitter of the
sequence and cannot be updated by others, so they may be less reliable.
Except for GeneRIF and ENA,
the curated entries include a short curated
description of the protein's function.
For entries from BioLiP, the protein's function may not be known beyond binding to the ligand.
Many of these entries also link to articles in PubMed.
For more information see the
PaperBLAST paper (mSystems 2017)
or the code.
You can download PaperBLAST's database here.
Changes to PaperBLAST since the paper was written:
- November 2023: incorporated PRODORIC and RegPrecise. Many PRODORIC entries were not linked to a protein sequence (no UniProt identifier), so we added this information.
- February 2023: BioLiP changed their download format. PaperBLAST now includes their non-redundant subset. SitesBLAST and Sites on a Tree use a larger non-redundant subset that ensures that every ligand is represented within each cluster. This should ensure that every binding site is represented.
- June 2022: incorporated some coding sequences from ENA with the /experiment tag.
- March 2022: incorporated BioLiP.
- April 2020: incorporated TCDB.
- April 2019: EuropePMC now returns table entries in their search results. This has expanded PaperBLAST's database, but most of the new entries are of low relevance, and the resulting snippets are often just lists of locus tags with annotations.
- February 2018: the alignment page reports the conservation of the hit's functional sites (if available from from Swiss-Prot or UniProt)
- January 2018: incorporated BRENDA.
- December 2017: incorporated MetaCyc, CharProtDB, CAZy, REBASE, and the reannotations from the Fitness Browser.
- September 2017: EuropePMC no longer returns some table entries in their search results. This has shrunk PaperBLAST's database, but has also reduced the number of low-relevance hits.
Many of these changes are described in Interactive tools for functional annotation of bacterial genomes.
PaperBLAST cannot provide snippets for many of the papers that are
published in non-open-access journals. This limitation applies even if
the paper is marked as "free" on the publisher's web site and is
available in PubmedCentral or EuropePMC. If a journal that you publish
in is marked as "secret," please consider publishing elsewhere.
Many important articles are missing from PaperBLAST, either because
the article's full text is not in EuropePMC (as for many older
articles), or because the paper does not mention a protein identifier such as a locus tag, or because of PaperBLAST's heuristics. If you notice an
article that characterizes a protein's function but is missing from
PaperBLAST, please notify the curators at UniProt
or add an entry to GeneRIF.
Entries in either of these databases will eventually be incorporated
into PaperBLAST. Note that to add an entry to UniProt, you will need
to find the UniProt identifier for the protein. If the protein is not
already in UniProt, you can ask them to create an entry. To add an
entry to GeneRIF, you will need an NCBI Gene identifier, but
unfortunately many prokaryotic proteins in RefSeq do not have
corresponding Gene identifers.
References
PaperBLAST: Text-mining papers for information about homologs.
M. N. Price and A. P. Arkin (2017). mSystems, 10.1128/mSystems.00039-17.
Europe PMC in 2017.
M. Levchenko et al (2017). Nucleic Acids Research, 10.1093/nar/gkx1005.
Gene indexing: characterization and analysis of NLM's GeneRIFs.
J. A. Mitchell et al (2003). AMIA Annu Symp Proc 2003:460-464.
UniProt: the universal protein knowledgebase.
The UniProt Consortium (2016). Nucleic Acids Research, 10.1093/nar/gkw1099.
BRENDA in 2017: new perspectives and new tools in BRENDA.
S. Placzek et al (2017). Nucleic Acids Research, 10.1093/nar/gkw952.
The EcoCyc database: reflecting new knowledge about Escherichia coli K-12.
I. M. Keeseler et al (2016). Nucleic Acids Research, 10.1093/nar/gkw1003.
The MetaCyc database of metabolic pathways and enzymes.
R. Caspi et al (2018). Nucleic Acids Research, 10.1093/nar/gkx935.
CharProtDB: a database of experimentally characterized protein annotations.
R. Madupu et al (2012). Nucleic Acids Research, 10.1093/nar/gkr1133.
The carbohydrate-active enzymes database (CAZy) in 2013.
V. Lombard et al (2014). Nucleic Acids Research, 10.1093/nar/gkt1178.
The Transporter Classification Database (TCDB): recent advances
M. H. Saier, Jr. et al (2016). Nucleic Acids Research, 10.1093/nar/gkv1103.
REBASE - a database for DNA restriction and modification: enzymes, genes and genomes.
R. J. Roberts et al (2015). Nucleic Acids Research, 10.1093/nar/gku1046.
Deep annotation of protein function across diverse bacteria from mutant phenotypes.
M. N. Price et al (2016). bioRxiv, 10.1101/072470.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory