PaperBLAST

PaperBLAST Hits for B2RT14 UDP-glucuronosyltransferase (Mus musculus) (529 a.a., MGLRMPLQGL...)

Show query sequence

>B2RT14 UDP-glucuronosyltransferase (Mus musculus)
MGLRMPLQGLVGLLLLCALPWTEGEKVLVFPVGGSHWLSMRDVVRELHAQGHQTVVLAPE
VNMRIKEEDFFTFKVYAVPYTRQELEEMMENLKVFFDTGNYMKKIFKTSEALRNMSTVLL
KTCTNILHNESLLHHLNSSSFDVVFTDPVFPCGALLAKYLGIPAVFFLRYIPCGIEYEAT
QCPSPSSYIPNLFTRLSDHMDFLQRVQNMLYHLVLKYICHLLITPYESLASELFQREVSS
VELFSYASVWLFRGDFVLDYPRPIMPNMVFIGGINCVTKKPLSQEFEAYVNASGEHGIVV
FSLGSMVSEIPEKKAMEIAEALGRIPQTVLWRYTGTRPSNLAKNTILVKWLPQNDLLGHP
KTRAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTADDLE
NALKTVINNKSYKENIMRLSSLHKDRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHDLTWY
QYHSLDVIGFLLAIVLTVVFIVFKCCAYGCRKCFGGKGRVKKSHKSKTH

Running BLASTp...

Found 256 similar proteins in the literature:

B2RT14 UDP-glucuronosyltransferase from Mus musculus
100% identity, 100% coverage

• Proteomic Identification and Quantification of Snake Venom Biomarkers in Venom and Plasma Extracellular Vesicles
  Willard, Toxins 2021
  • “...VV region >100 G3UXX3 Sepiapterin reductase >100 A0A1W2P7F1 Complement component 1, s subcomponent 2 >100 B2RT14 UDP-glucuronosyltransferase >100 Q01279 Epidermal growth factor receptor >100 Q8R0Y6 Cytosolic 10-formyltetrahydrofolate dehydrogenase >100 P55258 Ras-related protein Rab-8A >100 Q9D1D4 Transmembrane emp24 domain-containing protein 10 >100 Q9QXF8 Glycine N-methyltransferase >100 Q3TNA1...”
• Nanoparticle exposure driven circulating bioactive peptidome causes systemic inflammation and vascular dysfunction.
  Mostovenko, Particle and fibre toxicology 2019
  • “...Matrin-3 Matr3 Q8K310 MEROPS 6642.0386 6661.0724 41.86 53.01 2.32 11.24 7.078 0.000 ELFQREVSSVELFSYA UDP-glucuronosyltransferase Ugt1a5 B2RT14 SignalP 1884.9258 1903.9390 30.24 88.84 2.73 11.73 7.071 0.000 RPCPTEQLSPSHPPLATCFGSDVDLQLEMAVPQPGQYVLVVEYVGEDSHQEMGVAVHTPQ Laminin subunit alpha-5 Lama5 Q61001 MEROPS 6608.1184 6627.1148 39.56 58.20 3.33 12.10 7.065 0.000 YLPSGQQLYMSKEM MCG3425 Vmn2r75 G5E8Z7 SignalP 1655.7688...”

AAL67850.1 Glucuronosyltransferase 1.5 (EC 2.4.1.17) (see protein)
87% identity, 96% coverage

Q64638 glucuronosyltransferase (EC 2.4.1.17) from Rattus norvegicus (see paper)
87% identity, 96% coverage

• Investigation into potential mechanisms of metabolic syndrome by integrative analysis of metabolomics and proteomics.
  Chen, PloS one 2022
  • “...Succinate dehydrogenase [ubiquinone] Carbohydrate metabolism 0.797 0.0424 Ugt1a1 Q64550 UDP-glucuronosyltransferase 11 Glycosyltransferase 0.722 0 Ugt1a5 Q64638 UDP-glucuronosyltransferase 15 Glycosyltransferase 0.694 0.0246 Ugt2b7 Q62789 UDP-glucuronosyltransferase 2B7 Lipid metabolism 0.623 0.0038 As shown in Table 1 , all impact values of these pathways were greater than 0.2. Generally,...”

UD12_MOUSE / P70691 UDP-glucuronosyltransferase 1-2; UDPGT 1-2; UGT1*2; UGT1-02; UGT1.2; Bilirubin-specific UDPGT; UDP-glucuronosyltransferase 1A2; UGT1A2; EC 2.4.1.17 from Mus musculus (Mouse) (see paper)
BAA13482.1 Glucuronosyltransferase 1.2 (Ugt1a2) (EC 2.4.1.17) (see protein)
NP_038729 UDP-glucuronosyltransferase 1-2 precursor from Mus musculus
85% identity, 99% coverage

• function: UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
• A role for UDP-glucose glycoprotein glucosyltransferase in expression and quality control of MHC class I molecules.
  Zhang, Proceedings of the National Academy of Sciences of the United States of America 2011
  • GeneRIF: in addition to the extensively studied tapasin-mediated quality control mechanism, UGT1 adds a new level of control in the MHC class I antigen presentation pathway.
• Control of steroid, heme, and carcinogen metabolism by nuclear pregnane X receptor and constitutive androstane receptor.
  Xie, Proceedings of the National Academy of Sciences of the United States of America 2003
  • GeneRIF: induced in transgenic mice, functions to eliminate steroids, heme metabolites and environmental toxins

NP_958826 UDP-glucuronosyltransferase 1-2 precursor from Rattus norvegicus
84% identity, 96% coverage

• Transcriptional enhancement of UDP-glucuronosyltransferase form 1A2 (UGT1A2) by nuclear factor I-A (NFI-A) in rat hepatocytes.
  Emi, Journal of biochemistry 2005 (PubMed)
  • GeneRIF: Data suggest that activation of UDP-glucuronosyltransferase 1A2 (UGT1A2) by nuclear factor I (NFI)-A1 is suppressed by NFI-C1 in the liver, and culture-associated expression of UGT1A2 is triggered by disappearance of NFI-C1 in cultured hepatocytes.

P20720 glucuronosyltransferase (EC 2.4.1.17) from Rattus norvegicus (see paper)
84% identity, 96% coverage

• Genetic resources of narrow-leaved lupine (Lupinus angustifolius L.) and their role in its domestication and breeding.
  Vishnyakova, Vavilovskii zhurnal genetiki i selektsii 2021
  • “...et al., 2012a) classifying accessions according to their domestication status and origin. The designated accessions (P20720, P22872, P26167, P26562, P26603, P26668, P27221, and P28221) were used in enriching BC2 crosses with cv. Mandelup (from Berger et al., 2013). Methods for identifying differentiation in the gene pool...”
• Exploring the genetic and adaptive diversity of a pan-Mediterranean crop wild relative: narrow-leafed lupin.
  Mousavi-Derazmahalleh, TAG. Theoretical and applied genetics. Theoretische und angewandte Genetik 2018
  • “...accessions from Italy and one accession from Greece that fell within the western clusters (Accessions P20720, P20724, P25040, P25051, P25052, P26107, P26109 and P26991). Investigating historic population bottlenecks To explore further how genomic diversity differs between the distinct eastern and western Mediterranean population groups and to...”

AAA42312.1 Glucuronosyltransferase 1A2 (Ugt1a2) (EC 2.4.1.17) (see protein)
84% identity, 96% coverage

UGT1A3 / P35503 UDP-glucuronosyltransferase 1A3 (EC 2.4.1.17) from Homo sapiens (see 4 papers)
UD13_HUMAN / P35503 UDP-glucuronosyltransferase 1A3; UGT1A3; UDP-glucuronosyltransferase 1-3; UDPGT 1-3; UGT1*3; UGT1-03; UGT1.3; UDP-glucuronosyltransferase 1-C; UGT-1C; UGT1C; UDP-glucuronosyltransferase 1A isoform 3; EC 2.4.1.17 from Homo sapiens (Human) (see 10 papers)
P35503 glucuronosyltransferase (EC 2.4.1.17) from Homo sapiens (see 26 papers)
AAG30423.1 UDP-GlcA: glucuronosyltransferase 1A3 (Ugt1a3;UGT1C;UGT1;GNT1) (EC 2.4.1.17) (see protein)
NP_061966 UDP-glucuronosyltransferase 1A3 precursor from Homo sapiens
75% identity, 99% coverage

• function: [Isoform 1]: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile (PubMed:15472229, PubMed:18674515, PubMed:18719240, PubMed:23288867, PubMed:23756265, PubMed:24641623, PubMed:21422672). Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds (PubMed:23756265). Catalyzes the glucuronidation of endogenous estrogen hormones such as estradiol and estrone (PubMed:15472229, PubMed:18719240, PubMed:23288867). Contributes to bile acid (BA) detoxification by catalyzing the glucuronidation of BA substrates, which are natural detergents for dietary lipids absorption (PubMed:23756265). Involved in the glucuronidation of calcidiol, which is the major circulating form of vitamin D3, essential for the regulation of calcium and phosphate homeostasis (PubMed:24641623). Involved in the glucuronidation of the phytochemical ferulic acid at the phenolic or the carboxylic acid group (PubMed:21422672). Involved in the glucuronidation of the AGTR1 angiotensin receptor antagonists losartan, candesartan and zolarsartan, which can inhibit the effect of angiotensin II (PubMed:18674515).
  function: [Isoform 2]: Lacks UDP-glucuronosyltransferase (UGT) activity but acts as a negative regulator of isoform 1.
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
  catalytic activity: 17beta-estradiol + UDP-alpha-D-glucuronate = 17beta-estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52460)
  catalytic activity: 17beta-estradiol + UDP-alpha-D-glucuronate = 17beta-estradiol 17-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52464)
  catalytic activity: 17alpha-estradiol + UDP-alpha-D-glucuronate = 17alpha- estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52868)
  catalytic activity: estrone + UDP-alpha-D-glucuronate = estrone 3-O-(beta-D- glucuronate) + UDP + H(+) (RHEA:52476)
  catalytic activity: chenodeoxycholate + UDP-alpha-D-glucuronate = chenodeoxycholoyl-24-O-(beta-D-glucuronate) + UDP (RHEA:52940)
  catalytic activity: deoxycholate + UDP-alpha-D-glucuronate = deoxycholoyl-24-O- (beta-D-glucuronate) + UDP (RHEA:52948)
  catalytic activity: lithocholate + UDP-alpha-D-glucuronate = lithocholoyl-24-O- (beta-D-glucuronate) + UDP (RHEA:52952)
  catalytic activity: hyodeoxycholate + UDP-alpha-D-glucuronate = hyodeoxycholoyl- 24-O-(beta-D-glucuronate) + UDP (RHEA:52956)
  catalytic activity: hyocholate + UDP-alpha-D-glucuronate = hyocholoyl-24-O-(beta- D-glucuronate) + UDP (RHEA:52960)
  catalytic activity: calcidiol + UDP-alpha-D-glucuronate = calcidiol 25-O-(beta-D- glucuronide) + UDP + H(+) (RHEA:55840)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-4-O-(beta-D- glucuronosyl)-ferulate + UDP + H(+) (RHEA:79951)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-ferulic acid beta-D-glucuronate ester + UDP (RHEA:79955)
  catalytic activity: losartan + UDP-alpha-D-glucuronate = losartan-2-N-beta-D- glucuronide + UDP (RHEA:63720)
  catalytic activity: candesartan + UDP-alpha-D-glucuronate = candesartan-2-N-beta- D-glucuronide + UDP (RHEA:63728)
  catalytic activity: zolasartan + UDP-alpha-D-glucuronate = zolarsartan-2-N-beta-D- glucuronide + UDP (RHEA:63748)
  subunit: Homodimer (PubMed:17179145). Homooligomer (Probable). Interacts with UGT1A1, UGT1A4, UGT1A6, UGT1A7, UGT1A8, UGT1A9 and UGT1A10 to form heterodimers (PubMed:17179145). Isoform 1 interacts with isoform 2/i2 suggesting that oligomerization is involved in negative regulation of transferase activity by isoform 2. Isoform 1 also interacts with respective i2 isoforms of UGT1A1, UGT1A4, UGT1A6, UGT1A7, UGT1A8, UGT1A9 and UGT1A10 (PubMed:20610558).
• Evaluation of pharmacogenomics and hepatic nuclear imaging-related covariates by population pharmacokinetic models of irinotecan and its metabolites.
  Liu, European journal of clinical pharmacology 2022 (PubMed)
  • GeneRIF: Evaluation of pharmacogenomics and hepatic nuclear imaging-related covariates by population pharmacokinetic models of irinotecan and its metabolites.
• Identification of low-frequency variants of UGT1A3 associated with bladder cancer risk by next-generation sequencing.
  Zheng, Oncogene 2021
  • GeneRIF: Identification of low-frequency variants of UGT1A3 associated with bladder cancer risk by next-generation sequencing.
• UGT1A3 and Sex Are Major Determinants of Telmisartan Pharmacokinetics-A Comprehensive Pharmacogenomic Study.
  Hirvensalo, Clinical pharmacology and therapeutics 2020 (PubMed)
  • GeneRIF: UGT1A3 and Sex Are Major Determinants of Telmisartan Pharmacokinetics-A Comprehensive Pharmacogenomic Study.
• Combination of hesperetin and platinum enhances anticancer effect on lung adenocarcinoma.
  Wang, Biomedicine & pharmacotherapy = Biomedecine & pharmacotherapie 2019 (PubMed)
  • GeneRIF: our study demonstrated that UGT1A3 functioned as an oncogenic factor in lung adenocarcinoma progression
• Glucuronidation of icaritin by human liver microsomes, human intestine microsomes and expressed UDP-glucuronosyltransferase enzymes: identification of UGT1A3, 1A9 and 2B7 as the main contributing enzymes.
  Wang, Xenobiotica; the fate of foreign compounds in biological systems 2018
  • GeneRIF: Icaritin was subjected to significant glucuronidation, wherein UGT1A3, 1A7, 1A8, 1A9 and 2B7 were main contributing enzymes.
• Increased UGT1A3 and UGT1A7 expression is associated with pancreatic cancer.
  Yilmaz, Asian Pacific journal of cancer prevention : APJCP 2015 (PubMed)
  • GeneRIF: Increased UGT1A3 expression is associated with pancreatic cancer.
• Human UGT1A4 and UGT1A3 conjugate 25-hydroxyvitamin D3: metabolite structure, kinetics, inducibility, and interindividual variability.
  Wang, Endocrinology 2014
  • GeneRIF: Human UGT1A4 and UGT1A3 conjugate 25-hydroxyvitamin D3.
• Human UDP-glucuronosyltransferase (UGT) 2B10 in drug N-glucuronidation: substrate screening and comparison with UGT1A3 and UGT1A4.
  Kato, Drug metabolism and disposition: the biological fate of chemicals 2013 (PubMed)
  • GeneRIF: the substrate specificity of UGT2B10, highlighting its preference for tertiary amines with higher affinities and clearance values than those of UGT1A4 and UGT1A3.
• More
• Cytochrome P450 3A gene family and medication in childhood nephrotic syndrome: An update.
  Kochuthakidiyel, Global medical genetics 2025
  • “...Cytochrome P450 2C19 Steroid hydroxylase activity 18577768 UGT1A1 P22309 UDP-glucuronosyltransferase 11 Steroid binding 12181437 UGT1A3 P35503 UDP-glucuronosyltransferase 13 Retinoic acid binding 15472229 UGT1A10 Q9HAW8 UDP-glucuronosyltransferase 110 Protein kinase c binding 15258099 UGT2B7 P16662 UDP-glucuronosyltransferase 2B7 Glucuronosyltransferase activity 10702251 UGT2B17 O75795 UDP-glucuronosyltransferase 2B17 Glucuronosyltransferase activity 8798464 CYP2C8...”
  • “...Cytochrome P450 2B6 Steroid hydroxylase activity 21289075 UGT1A1 P22309 UDP-glucuronosyltransferase 11 Steroid binding 12181437 UGT1A3 P35503 UDP-glucuronosyltransferase 13 Retinoic acid binding 15472229 Fluvastatin DB01095 CYP1A1 P04798 Cytochrome P450 1A1 Vitamin d 24-hydroxylase activity 11555828 CYP3A4 P08684 Cytochrome P450 3A4 Vitamin d3 25-hydroxylase activity 11555828 CYP3A5 P20815...”
• KNIME workflow for retrieving causal drug and protein interactions, building networks, and performing topological enrichment analysis demonstrated by a DILI case study.
  Füzi, Journal of cheminformatics 2022
  • “...P05177 CYP1A2 6.0 Q9NPD5 SLCO1B3 6.0 Q9Y6L6 SLCO1B1 6.0 P11712 CYP2C9 5.8 P02763 ORM1 5.0 P35503 UGT1A3 5.0 Network Similarly to the causal target part, the network part of the workflow also provides the possibility for different types of analyses. Here we present a subsequential analysis...”
• Interpreting the Molecular Mechanisms of Yinchenhao Decoction on Hepatocellular Carcinoma through Absorbed Components Based on Network Pharmacology
  Sun, BioMed research international 2021
  • “...P25874 Tar094 UGT1A1 UDP-glucuronosyltransferase 1A1 P22309 Tar095 UGT1A10 UDP-glucuronosyltransferase 1A10 Q9HAW8 Tar096 UGT1A3 UDP-glucuronosyltransferase 1A3 P35503 Tar097 UGT1A6 UDP-glucuronosyltransferase 1-6 Q64435 Tar098 UGT1A7 UDP-glucuronosyltransferase 1A7 Q9HAW7 Tar099 UGT1A8 UDP-glucuronosyltransferase 1A8 Q9HAW9 Tar100 UGT1A9 UDP-glucuronosyltransferase 1A9 Q62452 Tar101 UGT2B15 UDP-glucuronosyltransferase 2B15 P54855 Tar102 UGT2B17 UDP-glucuronosyltransferase 2B17 O75795...”
• Uncovering the mechanism of the effects of Paeoniae Radix Alba on iron-deficiency anaemia through a network pharmacology-based strategy
  Ye, BMC complementary medicine and therapies 2020
  • “...LDLR low density lipoprotein receptor None 54 P11388 TOP2A DNA topoisomerase II alpha None 55 P35503 UGT1A3 UDP glucuronosyltransferase family 1 member A3 None 56 O60656 UGT1A9 UDP glucuronosyltransferase family 1 member A9 None 57 P04035 HMGCR 3-hydroxy-3-methylglutaryl -CoA reductase None 58 P10636 MAPT microtubule associated...”
• Network Pharmacology Identifies the Mechanisms of Action of Shaoyao Gancao Decoction in the Treatment of Osteoarthritis
  Zhu, Medical science monitor : international medical journal of experimental and clinical research 2019
  • “...Drugbank P22309 UGT1A1 UDP-glucuronosyltransferase 1-1 Homo sapiens Drugbank Q9HAW8 UGT1A10 UDP-glucuronosyltransferase 1-10 Homo sapiens Drugbank P35503 UGT1A3 UDP-glucuronosyltransferase 1-3 Homo sapiens Drugbank Q9HAW9 UGT1A8 UDP-glucuronosyltransferase 1-8 Homo sapiens Drugbank O60656 UGT1A9 UDP-glucuronosyltransferase 1-9 Homo sapiens Drugbank P06133 UGT2B4 UDP-glucuronosyltransferase 2B4 Homo sapiens Drugbank P16662 UGT2B7 UDP-glucuronosyltransferase...”
• Molecular Docking-Based Design and Development of a Highly Selective Probe Substrate for UDP-glucuronosyltransferase 1A10.
  Juvonen, Molecular pharmaceutics 2018
  • “...were: Q9HAW8 (1A10), O60656 (1A9), Q9HAW9 (1A8), Q9HAW7 (1A7), P19224 (1A6), P35504 (1A5), P22310 (1A4), P35503 (1A3), and P22039 (1A1). To identify template protein structures for homology modeling purposes, the retrieved UGT sequences were used in blast searches against the protein data bank (PDB) structures. Based...”
• Intrinsic Disorder in Transmembrane Proteins: Roles in Signaling and Topology Prediction
  Bürgi, PloS one 2016
  • “...calcium binding protein involved in synaptic vesicles fusion. (E) Disorder prediction of UDP-glucuronosyltranferase 13 (UniProtID: P35503), an enzyme involved in the addition of glucoronic acid moieties to various compounds and important in detoxification. For (D and E) the blue dots represent the average disorder score using...”
• Sorbitol dehydrogenase overexpression and other aspects of dysregulated protein expression in human precancerous colorectal neoplasms: a quantitative proteomics study.
  Uzozie, Molecular & cellular proteomics : MCP 2014
• More

AAB96668.1 glucuronosyltransferase (UGT1A) (EC 2.4.1.17) (see protein)
75% identity, 99% coverage

Q64637 glucuronosyltransferase (EC 2.4.1.17) from Rattus norvegicus (see 2 papers)
79% identity, 96% coverage

AAR95632.1 Glucuronosyltransferase 1.3 (EC 2.4.1.17) (see protein)
79% identity, 96% coverage

Q20CL5 glucuronosyltransferase (EC 2.4.1.17) from Papio anubis (see paper)
76% identity, 96% coverage

UGT1A4 / P22310 UDP-glucuronosyltransferase 1-4 (EC 2.4.1.17) from Homo sapiens (see 6 papers)
UD14_HUMAN / P22310 UDP-glucuronosyltransferase 1A4; UGT1A4; Bilirubin-specific UDPGT isozyme 2; hUG-BR2; UDP-glucuronosyltransferase 1-4; UDPGT 1-4; UGT1*4; UGT1-04; UGT1.4; UDP-glucuronosyltransferase 1-D; UGT-1D; UGT1D; EC 2.4.1.17 from Homo sapiens (Human) (see 9 papers)
P22310 glucuronosyltransferase (EC 2.4.1.17) from Homo sapiens (see 27 papers)
AAA63196.1 UDP-GlcA: glucuronosyltransferase 1A4 (Ugt1a4) (EC 2.4.1.17) (see protein)
NP_009051 UDP-glucuronosyltransferase 1A4 precursor from Homo sapiens
76% identity, 99% coverage

• function: [Isoform 1]: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile (PubMed:18177842, PubMed:24641623, PubMed:15231852). Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds (PubMed:18177842). Involved in the glucuronidation of calcidiol, which is the major circulating form of vitamin D3 essential for the regulation of calcium and phosphate homeostasis (PubMed:24641623). Also glucuronidates the biologically active form of vitamin D3, calcitriol, probably leading to its biliary transport and intestinal reabsorption (PubMed:18177842). Involved in the glucuronidation of arachidonic acid (AA) and AA-derived eicosanoids including 15-HETE, 20-HETE and PGB1 (PubMed:15231852).
  function: [Isoform 2]: Lacks UDP-glucuronosyltransferase (UGT) activity but acts as a negative regulator of isoform 1.
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
  catalytic activity: calcidiol + UDP-alpha-D-glucuronate = calcidiol 25-O-(beta-D- glucuronide) + UDP + H(+) (RHEA:55840)
  catalytic activity: calcidiol + UDP-alpha-D-glucuronate = calcidiol 3-O-(beta-D- glucuronide) + UDP + H(+) (RHEA:55844)
  catalytic activity: calcitriol + UDP-alpha-D-glucuronate = calcitriol 25-O-(beta- D-glucuronide) + UDP + H(+) (RHEA:55836)
  catalytic activity: (5Z,8Z,11Z,14Z)-eicosatetraenoate + UDP-alpha-D-glucuronate = O-[(5Z),(8Z),(11Z),(14Z)-eicosatetraenoyl]-beta-D-glucuronate + UDP (RHEA:79915)
  catalytic activity: 15-hydroxy-(5Z,8Z,11Z,13E)-eicosatetraenoate + UDP-alpha-D- glucuronate = 15-O-(beta-D-glucuronosyl)-(5Z,8Z,11Z,14Z)- eicosatetraenoate + UDP + H(+) (RHEA:79919)
  catalytic activity: 20-hydroxy-(5Z,8Z,11Z,14Z)-eicosatetraenoate + UDP-alpha-D- glucuronate = 20-O-(beta-D-glucuronosyl)-(5Z,8Z,11Z,14Z)- eicosatetraenoate + UDP + H(+) (RHEA:79927)
  subunit: Homodimer (PubMed:17179145). Homooligomer (Probable). Interacts with UGT1A1, UGT1A3, UGT1A6, UGT1A7, UGT1A8, UGT1A9 and UGT1A10 to form heterodimers (PubMed:17179145). Isoform 1 interacts with isoform 2/i2 suggesting that oligomerization is involved in negative regulation of transferase activity by isoform 2. Isoform 1 also interacts with respective i2 isoforms of UGT1A1, UGT1A3, UGT1A6, UGT1A7, UGT1A8, UGT1A9 and UGT1A10 (PubMed:20610558).
• Characterization and Proteomic Profiling of Hepatocyte-like Cells Derived from Human Wharton's Jelly Mesenchymal Stromal Cells: De Novo Expression of Liver-Specific Enzymes
  Lo, Biology 2025 (no snippet)
• Evaluation of tea (Camellia sinensis L.) phytochemicals as multi-disease modulators, a multidimensional in silico strategy with the combinations of network pharmacology, pharmacophore analysis, statistics and molecular docking.
  Nag, Molecular diversity 2023
  • “...Hyperbilirubinemia (H00208), Bilirubin, serum level of, quantitative trait locus 1; biliqtl1 (#601,816) Adenine (DB00173) 19 P22310 Homologous model UDP-glucuronosyltransferase 14 Gilbert syndrome (#143,500) Idelalisib (DB09054) 20 P22748 1ZNC [ 72 ] Carbonic anhydrase 4 Retinitis pigmentosa (H00527) Topiramate (DB00273) 21 P24385 2W9Z [ 67 ] G1/S-specific...”
  • “...homology modeling of two proteins (UDP-glucuronosyltransferase 11: UniProt id P22309 and UDP-glucuronosyltransferase 14: UniProt id P22310) were performed by SWISS-Model server, based on the templates of PDB id 6KVJ.1.A and 6O86.1.A. The quality analysis was done by the parameters MolProbity score, QMEAN and GMQE (Global Model...”
• Abnormal ECA-Binding Membrane Glycans and Galactosylated CAT and P4HB in Lesion Tissues as Potential Biomarkers for Hepatocellular Carcinoma Diagnosis.
  Kong, Frontiers in oncology 2022
  • “...36.106 17 7.35 P22695 UQCRC2 Cytochrome b-c1 complex subunit 2, mitochondrial 453 48.443 18 6.67 P22310 UGT1A4 UDP-glucuronosyltransferase 1-4 534 60.025 19 6.53 P11509 CYP2A6 Cytochrome P450 2A6 494 56.501 20 6.45 Q8NBX0 SCCPDH Saccharopine dehydrogenase-like oxidoreductase 429 47.151 20 proteins with the highest Unuesd scores....”
• Molecular Docking-Based Design and Development of a Highly Selective Probe Substrate for UDP-glucuronosyltransferase 1A10.
  Juvonen, Molecular pharmaceutics 2018
  • “...retrieved UGT1As were: Q9HAW8 (1A10), O60656 (1A9), Q9HAW9 (1A8), Q9HAW7 (1A7), P19224 (1A6), P35504 (1A5), P22310 (1A4), P35503 (1A3), and P22039 (1A1). To identify template protein structures for homology modeling purposes, the retrieved UGT sequences were used in blast searches against the protein data bank (PDB)...”
• A nanoparticle formula for delivering siRNA or miRNAs to tumor cells in cell culture and in vivo.
  Choi, Nature protocols 2014
  • “...see Table 1 for RNA sequences) Paclitaxel, Oregon Green 488 conjugate (OG-PTX; Invitrogen, cat. no. P22310) pcDNA3.1 (Invitrogen, cat. no. V790-20) Potassium carbonate (K 2 CO 3 ; Sigma-Aldrich, cat. no. 209619) 1-Propanol (Sigma-Aldrich, cat. no. 402893) ! CAUTION It is volatile and flammable. RNA annealing/dilution...”
• Sorbitol dehydrogenase overexpression and other aspects of dysregulated protein expression in human precancerous colorectal neoplasms: a quantitative proteomics study.
  Uzozie, Molecular & cellular proteomics : MCP 2014
• Protein targets of reactive electrophiles in human liver microsomes.
  Shin, Chemical research in toxicology 2007
• Impact of UGT1A4 and UGT2B7 polymorphisms on lamotrigine plasma concentration in patients with bipolar disorder.
  Zhao, Pharmacogenetics and genomics 2024 (PubMed)
  • GeneRIF: Impact of UGT1A4 and UGT2B7 polymorphisms on lamotrigine plasma concentration in patients with bipolar disorder.
• Hepatotoxicity with High-Dose Green Tea Extract: Effect of Catechol-O-Methyltransferase and Uridine 5'-Diphospho-glucuronosyltransferase 1A4 Genotypes.
  Acosta, Journal of dietary supplements 2023
  • GeneRIF: Hepatotoxicity with High-Dose Green Tea Extract: Effect of Catechol-O-Methyltransferase and Uridine 5'-Diphospho-glucuronosyltransferase 1A4 Genotypes.
• Bearing variant alleles at uridine glucuronosyltransferase polymorphisms UGT2B7 -161C > T (rs7668258) or UGT1A4*3 c.142 T > G (rs2011425) has no relevant consequences for lamotrigine troughs in adults with epilepsy.
  Božina, European journal of clinical pharmacology 2023 (PubMed)
  • GeneRIF: Bearing variant alleles at uridine glucuronosyltransferase polymorphisms UGT2B7 -161C > T (rs7668258) or UGT1A4*3 c.142 T > G (rs2011425) has no relevant consequences for lamotrigine troughs in adults with epilepsy.
• A validation study of the UGT1A4 rs2011404 variant and the risk of anti-tuberculosis drug-induced hepatotoxicity in an Eastern Chinese Han population.
  Zhu, Journal of clinical pharmacy and therapeutics 2021 (PubMed)
  • GeneRIF: A validation study of the UGT1A4 rs2011404 variant and the risk of anti-tuberculosis drug-induced hepatotoxicity in an Eastern Chinese Han population.
• Association of CYP2C19 and UGT1A4 polymorphisms with voriconazole-induced liver injury.
  Song, Personalized medicine 2020 (PubMed)
  • GeneRIF: Association of CYP2C19 and UGT1A4 polymorphisms with voriconazole-induced liver injury.
• The association of genetic polymorphisms in CYP1A2, UGT1A4, and ABCB1 with autonomic nervous system dysfunction in schizophrenia patients treated with olanzapine.
  Hattori, BMC psychiatry 2020
  • GeneRIF: The association of genetic polymorphisms in CYP1A2, UGT1A4, and ABCB1 with autonomic nervous system dysfunction in schizophrenia patients treated with olanzapine.
• Representation of CYP3A4, CYP3A5 and UGT1A4 Polymorphisms within Croatian Breast Cancer Patients' Population.
  Bojanic, International journal of environmental research and public health 2020
  • GeneRIF: Representation of CYP3A4, CYP3A5 and UGT1A4 Polymorphisms within Croatian Breast Cancer Patients' Population.
• The Effect of Polymorphism in UGT1A4 on Clinical Outcomes of Adjuvant Tamoxifen Therapy for Patients With Breast Cancer in China.
  Lan, Clinical breast cancer 2019 (PubMed)
  • GeneRIF: Chinese patients with A/A or G/A genotype in the promoter region of bilirubin glucuronoside glucuronosyltransferase (UGT1A4) have a lower 5-year disease-free survival (DFS) rate than those with the wild-type G/G genotype when treated with adjuvant tamoxifen. The rs869283 genotype remains an independent prognostic marker for DFS in multivariate analysis.
• More

Q20CL4 glucuronosyltransferase (EC 2.4.1.17) from Papio anubis (see paper)
76% identity, 96% coverage

Q20CL3 glucuronosyltransferase (EC 2.4.1.17) from Papio anubis (see paper)
76% identity, 96% coverage

F7GW14 glucuronosyltransferase from Macaca mulatta
75% identity, 98% coverage

• Proteomic Evaluation of the Natural History of the Acute Radiation Syndrome of the Gastrointestinal Tract in a Non-human Primate Model of Partial-body Irradiation with Minimal Bone Marrow Sparing Includes Dysregulation of the Retinoid Pathway
  Huang, Health physics 2020
  • “...DHDH 0.61 0.00016 A0A1D5RDA4 NAT8 0.61 0.00019 A0A1D5QYQ4 A0A1D5QYQ4 0.6 0.00024 F7HAW1 UGT2B15 0.59 0.00033 F7GW14 UGT1A1 0.55 0.00089 Table 4. Proteins that were observed as changed by radiation in both the NHP and murine small intestine. Murine data from Huang et al. 2019 . Genes...”

UD15_HUMAN / P35504 UDP-glucuronosyltransferase 1A5; UGT1A5; UDP-glucuronosyltransferase 1-5; UDPGT 1-5; UGT1*5; UGT1-05; UGT1.5; UDP-glucuronosyltransferase 1-E; UGT-1E; UGT1E; EC 2.4.1.17 from Homo sapiens (Human) (see 2 papers)
P35504 glucuronosyltransferase (EC 2.4.1.17) from Homo sapiens (see 4 papers)
AAG30421.1 glucuronosyltransferase 1A5 (Ugt1a5) (EC 2.4.1.17) (see protein)
NP_061951 UDP-glucuronosyltransferase 1A5 precursor from Homo sapiens
74% identity, 99% coverage

• function: [Isoform 1]: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile (PubMed:18674515). Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds (PubMed:18674515). Involved in the glucuronidation of the AGTR1 angiotensin receptor antagonist zolarsatan, a drug which can inhibit the effect of angiotensin II (PubMed:18674515).
  function: [Isoform 2]: Lacks UGT glucuronidation activity but acts as a negative regulator of isoform 1.
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
  catalytic activity: zolasartan + UDP-alpha-D-glucuronate = zolarsartan-1-N-beta-D- glucuronide + UDP (RHEA:63744)
  subunit: Homodimer (By similarity). Homooligomer (By similarity). Interacts with UGT1A1, UGT1A3, UGT1A4, UGT1A6, UGT1A7, UGT1A8, UGT1A9 and UGT1A10 to form heterodimers (By similarity). Isoform 1 interacts with isoform 2/i2 suggesting that oligomerization is involved in negative regulation of transferase activity by isoform 2. Isoform 1 also interacts with respective i2 isoforms of UGT1A1, UGT1A3, UGT1A4, UGT1A6, UGT1A7, UGT1A8, UGT1A9 and UGT1A10 (By similarity).
• A common polymorphic variant of UGT1A5 displays increased activity due to optimized cofactor binding.
  Yang, FEBS letters 2018 (PubMed)
  • GeneRIF: Extensive molecular dynamics simulations revealed that the Gly259Arg mutation stabilizes helix Q through a newly formed hydrogen bonding network, which places the cofactor in a much more favorable geometry in UGT1A5*8 as compared to the wild-type.
• Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
  Bailey, Diabetes care 2010
  • GeneRIF: Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
• Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
  Ross, Nature genetics 2009 (PubMed)
  • GeneRIF: Observational study of gene-disease association. (HuGE Navigator)
• Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
  Talmud, American journal of human genetics 2009
  • GeneRIF: Observational study of gene-disease association. (HuGE Navigator)
• Genetic variations and haplotypes of UDP-glucuronosyltransferase 1A locus in a Korean population.
  Yea, Therapeutic drug monitoring 2008 (PubMed)
  • GeneRIF: Observational study of genotype prevalence. (HuGE Navigator)
• Molecular Docking-Based Design and Development of a Highly Selective Probe Substrate for UDP-glucuronosyltransferase 1A10.
  Juvonen, Molecular pharmaceutics 2018
  • “...for the retrieved UGT1As were: Q9HAW8 (1A10), O60656 (1A9), Q9HAW9 (1A8), Q9HAW7 (1A7), P19224 (1A6), P35504 (1A5), P22310 (1A4), P35503 (1A3), and P22039 (1A1). To identify template protein structures for homology modeling purposes, the retrieved UGT sequences were used in blast searches against the protein data...”
• Sorbitol dehydrogenase overexpression and other aspects of dysregulated protein expression in human precancerous colorectal neoplasms: a quantitative proteomics study.
  Uzozie, Molecular & cellular proteomics : MCP 2014

Q20CL2 glucuronosyltransferase (EC 2.4.1.17) from Papio anubis (see paper)
76% identity, 96% coverage

AAA51868.1 glucuronosyltransferase (UGT1;UGT1*4;UGT1-04;UGT1.4;UGT1A4) (EC 2.4.1.17) (see protein)
75% identity, 96% coverage

UD11_MOUSE / Q63886 UDP-glucuronosyltransferase 1A1; UGT1A1; UDP-glucuronosyltransferase 1-1; UDPGT 1-1; UGT1*1; UGT1-01; UGT1.1; UGTBR1; EC 2.4.1.17 from Mus musculus (Mouse) (see paper)
Q63886 glucuronosyltransferase (EC 2.4.1.17) from Mus musculus (see paper)
AAH93516.1 glucuronosyltransferase 1A1 (Ugt1a1) (EC 2.4.1.17) (see protein)
NP_964007 UDP-glucuronosyltransferase 1A1 precursor from Mus musculus
72% identity, 94% coverage

• function: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile. Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds. Catalyzes the glucuronidation of endogenous estrogen hormones such as estradiol, estrone and estriol. Involved in the glucuronidation of bilirubin, a degradation product occurring in the normal catabolic pathway that breaks down heme in vertebrates. Involved in the glucuronidation of arachidonic acid (AA) and AA-derived eicosanoids including 15-HETE, 20-HETE, PGB1 and F2- isoprostane (8-iso-PGF2alpha). Involved in the glucuronidation of the phytochemical ferulic acid at the phenolic or the carboxylic acid group. Also catalyzes the glucuronidation the isoflavones genistein, daidzein, glycitein, formononetin, biochanin A and prunetin, which are phytoestrogens with anticancer and cardiovascular properties. Involved in the glucuronidation of the AGTR1 angiotensin receptor antagonist losartan, a drug which can inhibit the effect of angiotensin II. Involved in the biotransformation of 7-ethyl-10-hydroxycamptothecin (SN-38), the pharmacologically active metabolite of the anticancer drug irinotecan.
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
  catalytic activity: 17beta-estradiol + UDP-alpha-D-glucuronate = 17beta-estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52460)
  catalytic activity: 2-hydroxyestrone + UDP-alpha-D-glucuronate = 2-hydroxyestrone 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53048)
  catalytic activity: 2-hydroxy-17beta-estradiol + UDP-alpha-D-glucuronate = 2- hydroxy-17beta-estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53004)
  catalytic activity: 2-methoxy-17beta-estradiol + UDP-alpha-D-glucuronate = 2- methoxy-17beta-estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53072)
  catalytic activity: 17alpha-estradiol + UDP-alpha-D-glucuronate = 17alpha- estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52868)
  catalytic activity: 16beta,17beta-estriol + UDP-alpha-D-glucuronate = 16beta,17beta-estriol 16-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52880)
  catalytic activity: losartan + UDP-alpha-D-glucuronate = losartan-2-N-beta-D- glucuronide + UDP (RHEA:63720)
  catalytic activity: prunetin + UDP-alpha-D-glucuronate = prunetin-4'-O-beta-D- glucuronide + UDP (RHEA:63588)
  catalytic activity: SN-38 + UDP-alpha-D-glucuronate = SN-38 O-beta-D-glucuronide + UDP + H(+) (RHEA:63696)
  catalytic activity: (4Z,15Z)-bilirubin IXalpha + UDP-alpha-D-glucuronate = (4Z,15Z)-bilirubin IXalpha C12-beta-D-glucuronoside + UDP (RHEA:75099)
  catalytic activity: (4Z,15Z)-bilirubin IXalpha + UDP-alpha-D-glucuronate = (4Z,15Z)-bilirubin IXalpha C8-beta-D-glucuronoside + UDP (RHEA:79067)
  catalytic activity: (4Z,15Z)-bilirubin IXalpha C8-beta-D-glucuronoside + UDP- alpha-D-glucuronate = (4Z,15Z)-bilirubin IXalpha C8,C12-beta-D- bisglucuronoside + UDP (RHEA:79071)
  catalytic activity: (4Z,15Z)-bilirubin IXalpha C12-beta-D-glucuronoside + UDP- alpha-D-glucuronate = (4Z,15Z)-bilirubin IXalpha C8,C12-beta-D- bisglucuronoside + UDP (RHEA:79075)
  catalytic activity: 8-iso-prostaglandin F2alpha + UDP-alpha-D-glucuronate = 8-iso- prostaglandin F2alpha-glucuronide + UDP + H(+) (RHEA:79907)
  catalytic activity: (5Z,8Z,11Z,14Z)-eicosatetraenoate + UDP-alpha-D-glucuronate = O-[(5Z),(8Z),(11Z),(14Z)-eicosatetraenoyl]-beta-D-glucuronate + UDP (RHEA:79915)
  catalytic activity: 15-hydroxy-(5Z,8Z,11Z,13E)-eicosatetraenoate + UDP-alpha-D- glucuronate = 15-O-(beta-D-glucuronosyl)-(5Z,8Z,11Z,14Z)- eicosatetraenoate + UDP + H(+) (RHEA:79919)
  catalytic activity: 20-hydroxy-(5Z,8Z,11Z,14Z)-eicosatetraenoate + UDP-alpha-D- glucuronate = 20-O-(beta-D-glucuronosyl)-(5Z,8Z,11Z,14Z)- eicosatetraenoate + UDP + H(+) (RHEA:79927)
  catalytic activity: prostaglandin B1 + UDP-alpha-D-glucuronate = 15-O-(beta-D- glucuronosyl)-prostaglandin B1 + UDP + H(+) (RHEA:79935)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-4-O-(beta-D- glucuronosyl)-ferulate + UDP + H(+) (RHEA:79951)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-ferulic acid beta-D-glucuronate ester + UDP (RHEA:79955)
  subunit: Homodimers. Homooligomer. Interacts with UGT1A3, UGT1A4, UGT1A6, UGT1A7, UGT1A8, UGT1A9 and UGT1A10 to form heterodimers.
• Uridine diphosphate glucuronosyltransferase 1A1 prevents the progression of liver injury.
  Jiang, World journal of gastroenterology 2024
  • GeneRIF: Uridine diphosphate glucuronosyltransferase 1A1 prevents the progression of liver injury.
• Oral arsenic administration to humanizedUDP-glucuronosyltransferase1 neonatal mice induces UGT1A1 through a dependence on Nrf2 and PXR.
  Yang, The Journal of biological chemistry 2023
  • GeneRIF: Oral arsenic administration to humanizedUDP-glucuronosyltransferase1 neonatal mice induces UGT1A1 through a dependence on Nrf2 and PXR.
• Suppressing Hepatic UGT1A1 Increases Plasma Bilirubin, Lowers Plasma Urobilin, Reorganizes Kinase Signaling Pathways and Lipid Species and Improves Fatty Liver Disease.
  Bates, Biomolecules 2023
  • GeneRIF: Suppressing Hepatic UGT1A1 Increases Plasma Bilirubin, Lowers Plasma Urobilin, Reorganizes Kinase Signaling Pathways and Lipid Species and Improves Fatty Liver Disease.
• UGT1A1 dysfunction increases liver burden and aggravates hepatocyte damage caused by long-term bilirubin metabolism disorder.
  Liu, Biochemical pharmacology 2021 (PubMed)
  • GeneRIF: UGT1A1 dysfunction increases liver burden and aggravates hepatocyte damage caused by long-term bilirubin metabolism disorder.
• Hetero-oligomer formation of mouse UDP-glucuronosyltransferase (UGT) 2b1 and 1a1 results in the gain of glucuronidation activity towards morphine, an activity which is absent in homo-oligomers of either UGT.
  Miyauchi, Biochemical and biophysical research communications 2020 (PubMed)
  • GeneRIF: Hetero-oligomer formation of mouse UDP-glucuronosyltransferase (UGT) 2b1 and 1a1 results in the gain of glucuronidation activity towards morphine, an activity which is absent in homo-oligomers of either UGT.
• Coupling AAV-mediated promoterless gene targeting to SaCas9 nuclease to efficiently correct liver metabolic diseases.
  De, JCI insight 2019
  • GeneRIF: Coupling AAV-mediated promoterless gene targeting to SaCas9 nuclease to efficiently correct liver metabolic diseases.
• AAV8 Gene Therapy Rescues the Newborn Phenotype of a Mouse Model of Crigler-Najjar.
  Greig, Human gene therapy 2018 (PubMed)
  • GeneRIF: An AAV8 vector was developed expressing a codon-optimized human version of UGT1A1 from a liver-specific promoter. High doses of the vector rescued neonatal lethality in newborn UGT1 knockout (KO) mice, which serve as a model of Crigler-Najjar syndrome, and significantly increased survival from 5 to 270 days.
• UDP-glucuronosyltransferase 1a enzymes are present and active in the mouse blastocyst.
  Collier, Drug metabolism and disposition: the biological fate of chemicals 2014
  • GeneRIF: data confirm that Ugt1a proteins are present and active in preimplantation murine embryos and point to a potential role for these proteins in implantation and early embryonic and fetal development
• More
• Development of a Global Metabo-Lipid-Prote-omics Workflow to Compare Healthy Proximal and Distal Colonic Epithelium in Mice
  Hemmati, Journal of proteome research 2024
  • “...GO-term GO:0015020_F:glucuronosyltransferase activity was increased in PC tissue which represents 5 UDP-glucuronosyltransferases [Ugt2b17 (P17717), Ugt1a1 (Q63886), Ugt1a6 (Q64435), Ugt1a7c (Q6ZQM8), and Ugt2a3 (Q8BWQ1, 2.4.1.17)]. Higher levels of the substrate UDP-glucuronide and its precursor UDP-glucose were observed in the DC tissue, indicating the usage of the UDP-glucuronide...”
• Comparative and integrative metabolomics reveal that S-nitrosation inhibits physiologically relevant metabolic enzymes.
  Bruegger, The Journal of biological chemistry 2018
• Sortilin 1 Loss-of-Function Protects Against Cholestatic Liver Injury by Attenuating Hepatic Bile Acid Accumulation in Bile Duct Ligated Mice.
  Li, Toxicological sciences : an official journal of the Society of Toxicology 2018
• Re-adaption on Earth after Spaceflights Affects the Mouse Liver Proteome.
  Anselm, International journal of molecular sciences 2017
  • “...Q3UEP4 - 2.1 0.0167 0.0132 Cytochrome P450 3A13 Q3UW87 - 0.4 0.0121 0.0279 UDP-glucuronosyltransferase 1-1 Q63886 - 1.2 0.0420 0.0185 UDP-glucuronosyltransferase 1-6 Q64435 - 2.0 0.0179 0.0410 Cytochrome P450 2C54 Q6XVG2 * >0.05 0.0476 UDP-glucuronosyltransferase 2A3 Q8BWQ1 - 1.9 0.0109 0.0132 UDP-glucuronosyltransferase Q8K154 - 1.9 0.0172...”
• Gene expression profiling to identify eggshell proteins involved in physical defense of the chicken egg.
  Jonchère, BMC genomics 2010
  • “...Contains CD80-like C2-set immunoglobulin domain, B302 (SPRY) domain and Ig-like V-type (immunoglobulin-like) domain UDP-glucuronosyltransferase 1-1 (Q63886) UDP-glucoronosyl and UDP-glucosyl transferase family. Involved in detoxication and elimination of toxics Mannose-binding protein C (Q66S61) Binds mannose and N-acetylglucosamine in a calcium-dependent manner. Is capable of host defense. Contains...”
  • “...6.5 2.8 6.9 Glioma pathogenesis-related protein 1 P48060 8.7 5.7 2 4.1 6.1 UDP-glucuronosyltransferase 1-1 Q63886 8.87 3.8 5.1 4.3 6.3 Glutamate [NMDA] receptor subunit zeta-1 Q5R1P0 8.92 4.8 6.1 6.1 6.1 Avian Beta defensin-9 Q6QLR1 8.94 4.8 0 7.1 7.1 Glycine receptor subunit beta P48167...”

UD11_RAT / Q64550 UDP-glucuronosyltransferase 1A1; UGT1A1; B1; UDP-glucuronosyltransferase 1-1; UDPGT 1-1; UGT1*1; UGT1-01; UGT1.1; EC 2.4.1.17 from Rattus norvegicus (Rat) (see paper)
Q64550 glucuronosyltransferase (EC 2.4.1.17) from Rattus norvegicus (see 4 papers)
AAC52219.1 glucuronosyltransferase 1.1 (Ugt1a1;Ugt1.1) (EC 2.4.1.17) (see protein)
NP_036815 UDP-glucuronosyltransferase 1A1 precursor from Rattus norvegicus
72% identity, 95% coverage

• function: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile (PubMed:8554318). Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds (PubMed:8554318). Catalyzes the glucuronidation of endogenous estrogen hormones such as estradiol, estrone and estriol (By similarity). Involved in the glucuronidation of bilirubin, a degradation product occurring in the normal catabolic pathway that breaks down heme in vertebrates (By similarity). Involved in the glucuronidation of arachidonic acid (AA) and AA-derived eicosanoids including 15-HETE, 20-HETE, PGB1 and F2- isoprostane (8-iso-PGF2alpha). Involved in the glucuronidation of the phytochemical ferulic acid at the phenolic or the carboxylic acid group (By similarity). Also catalyzes the glucuronidation the isoflavones genistein, daidzein, glycitein, formononetin, biochanin A and prunetin, which are phytoestrogens with anticancer and cardiovascular properties (By similarity). Involved in the glucuronidation of the AGTR1 angiotensin receptor antagonist losartan, a drug which can inhibit the effect of angiotensin II (By similarity). Involved in the biotransformation of 7-ethyl-10-hydroxycamptothecin (SN-38), the pharmacologically active metabolite of the anticancer drug irinotecan (By similarity).
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
  catalytic activity: 17beta-estradiol + UDP-alpha-D-glucuronate = 17beta-estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52460)
  catalytic activity: 2-hydroxyestrone + UDP-alpha-D-glucuronate = 2-hydroxyestrone 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53048)
  catalytic activity: 2-hydroxy-17beta-estradiol + UDP-alpha-D-glucuronate = 2- hydroxy-17beta-estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53004)
  catalytic activity: 2-methoxy-17beta-estradiol + UDP-alpha-D-glucuronate = 2- methoxy-17beta-estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53072)
  catalytic activity: 17alpha-estradiol + UDP-alpha-D-glucuronate = 17alpha- estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52868)
  catalytic activity: 16beta,17beta-estriol + UDP-alpha-D-glucuronate = 16beta,17beta-estriol 16-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52880)
  catalytic activity: losartan + UDP-alpha-D-glucuronate = losartan-2-N-beta-D- glucuronide + UDP (RHEA:63720)
  catalytic activity: prunetin + UDP-alpha-D-glucuronate = prunetin-4'-O-beta-D- glucuronide + UDP (RHEA:63588)
  catalytic activity: SN-38 + UDP-alpha-D-glucuronate = SN-38 O-beta-D-glucuronide + UDP + H(+) (RHEA:63696)
  catalytic activity: (4Z,15Z)-bilirubin IXalpha + UDP-alpha-D-glucuronate = (4Z,15Z)-bilirubin IXalpha C12-beta-D-glucuronoside + UDP (RHEA:75099)
  catalytic activity: (4Z,15Z)-bilirubin IXalpha + UDP-alpha-D-glucuronate = (4Z,15Z)-bilirubin IXalpha C8-beta-D-glucuronoside + UDP (RHEA:79067)
  catalytic activity: (4Z,15Z)-bilirubin IXalpha C8-beta-D-glucuronoside + UDP- alpha-D-glucuronate = (4Z,15Z)-bilirubin IXalpha C8,C12-beta-D- bisglucuronoside + UDP (RHEA:79071)
  catalytic activity: (4Z,15Z)-bilirubin IXalpha C12-beta-D-glucuronoside + UDP- alpha-D-glucuronate = (4Z,15Z)-bilirubin IXalpha C8,C12-beta-D- bisglucuronoside + UDP (RHEA:79075)
  catalytic activity: 8-iso-prostaglandin F2alpha + UDP-alpha-D-glucuronate = 8-iso- prostaglandin F2alpha-glucuronide + UDP + H(+) (RHEA:79907)
  catalytic activity: (5Z,8Z,11Z,14Z)-eicosatetraenoate + UDP-alpha-D-glucuronate = O-[(5Z),(8Z),(11Z),(14Z)-eicosatetraenoyl]-beta-D-glucuronate + UDP (RHEA:79915)
  catalytic activity: 15-hydroxy-(5Z,8Z,11Z,13E)-eicosatetraenoate + UDP-alpha-D- glucuronate = 15-O-(beta-D-glucuronosyl)-(5Z,8Z,11Z,14Z)- eicosatetraenoate + UDP + H(+) (RHEA:79919)
  catalytic activity: 20-hydroxy-(5Z,8Z,11Z,14Z)-eicosatetraenoate + UDP-alpha-D- glucuronate = 20-O-(beta-D-glucuronosyl)-(5Z,8Z,11Z,14Z)- eicosatetraenoate + UDP + H(+) (RHEA:79927)
  catalytic activity: prostaglandin B1 + UDP-alpha-D-glucuronate = 15-O-(beta-D- glucuronosyl)-prostaglandin B1 + UDP + H(+) (RHEA:79935)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-4-O-(beta-D- glucuronosyl)-ferulate + UDP + H(+) (RHEA:79951)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-ferulic acid beta-D-glucuronate ester + UDP (RHEA:79955)
  subunit: Homodimers. Homooligomer. Interacts with UGT1A3, UGT1A4, UGT1A6, UGT1A7, UGT1A8, UGT1A9 and UGT1A10 to form heterodimers.
• Investigation into potential mechanisms of metabolic syndrome by integrative analysis of metabolomics and proteomics.
  Chen, PloS one 2022
  • “...Retinol metabolic process 0.832 0.0024 Sdhd Q6PCT8 Succinate dehydrogenase [ubiquinone] Carbohydrate metabolism 0.797 0.0424 Ugt1a1 Q64550 UDP-glucuronosyltransferase 11 Glycosyltransferase 0.722 0 Ugt1a5 Q64638 UDP-glucuronosyltransferase 15 Glycosyltransferase 0.694 0.0246 Ugt2b7 Q62789 UDP-glucuronosyltransferase 2B7 Lipid metabolism 0.623 0.0038 As shown in Table 1 , all impact values of...”
• Functional proteomic analysis of corticosteroid pharmacodynamics in rat liver: Relationship to hepatic stress, signaling, energy regulation, and drug metabolism.
  Ayyar, Journal of proteomics 2017
  • “...MPL-regulated Phase-II enzymes related to drug/xenobiotic/endogenous substrate metabolism. UProt_ID Gene Name Protein Name Function Regulation Q64550 Ugt1a1 UDP-glucuronosyltransferase 1A1 Drugs = opioids, SN-38 (irinotecan); endogenous substrates = bilirubin, ethinylestradiol; polymorphic enzyme DOWN/UP Q62452 Ugt1a9 UDP-glucuronosyltransferase 1A9 Drugs = R-oxepam, mycophenolic acid, SN-38 (irinotecan); halogenated phenols; polymorphic...”
• Improved detection of quantitative differences using a combination of spectral counting and MS/MS total ion current
  Freund, Journal of proteome research 2013
  • “...2B15 P36511 0.00022 6.4 1.8 (1.0) 17.0 (0.7) 1.9E+05 (1.7E+05) 7.0E+04 (2.2E+04) UDP-glucuronosyltransferase 11 (UGT1A1) Q64550 0.00086 4.6 11.0 (1.8) 54.1 (4.5) 6.3E+04 (2.0E+04) 6.8E+04 (4.6E+03) Peroxisomal multifunctional enzyme type 2 (HSD17B4) P97852 0.0018 2.0 48.1 (3.6) 96.3 (6.3) 1.8E+06 (2.8E+04) 1.6E+06 (1.6E+04) Dimethylglycine dehydrogenase. mitochondrial...”
• Response of the mitochondrial proteome of rat renal proximal convoluted tubules to chronic metabolic acidosis
  Freund, American journal of physiology. Renal physiology 2013
  • “...Protein Name Gene Mass, kDa P36511 Ugt2b15 61 Q66HG6 Q64240 Q64550 Ca5b Ambp Ugt1a1 37 39 60 G3V7V6 Q6AXT5 D4A0Y1 Retsat Rab21 Cfb 67 24 141 P13264 Gls Q3MIE0...”
• Differential permeabilization effects of Ca2+ and valinomycin on the inner and outer mitochondrial membranes as revealed by proteomics analysis of proteins released from mitochondria
  Yamada, Molecular & cellular proteomics : MCP 2009
  • “...IM M Q9JM53 NP_579829e P10860 P63039 P15999 P04762 Q64550 P19643 P07633 Q6P799 Q64565 Q02253 P11884 P22791 P04785 P50554 O35827 P10719 Q6P6R2 P14408 O08816...”
• The phagosome proteome: insight into phagosome functions.
  Garin, The Journal of cell biology 2001
  • “...54700 4.8 Microtubule proteins. 14% Tubulin -5 P05218 49670.8 4.78 49500 4.5 13/24 38% UDPGT Q64550 59662.7 8.77 27000 ND UDP-glucuronosyltransferase. E.R. protein. 22% VAP33 Q9QY77 27271.5 7.66 83000 ND Vesicle-associated membrane protein, associated protein A. Associated with ER and microtubules. 40% Mol Wt pI Mr...”
• Effect of status epilepticus on expression of brain UDP-glucuronosyltransferase 1a in rats.
  Asai, Biopharmaceutics & drug disposition 2018 (PubMed)
  • GeneRIF: study indicated that Status Epilepticus altered the expression of brain Ugt1a1 and Ugt1a7, which could alter glucuronidation in the brain.
• Disturbance of Mammary UDP-Glucuronosyltransferase Represses Estrogen Metabolism and Exacerbates Experimental Breast Cancer.
  Zhou, Journal of pharmaceutical sciences 2017 (PubMed)
  • GeneRIF: UGT1A1 controls estrogen metabolism.
• Enhanced phase II detoxification contributes to beneficial effects of dietary restriction as revealed by multi-platform metabolomics studies.
  Wen, Molecular & cellular proteomics : MCP 2013
  • GeneRIF: Data indicate that the up-regulation of phase II detoxification in the DR group was confirmed by mRNA and protein expression levels of uridinediphospho-glucuronosyltransferase and glycine-N-acyltransferase in actual liver tissues.
• CYP450-dependent biotransformation of the insecticide fipronil into fipronil sulfone can mediate fipronil-induced thyroid disruption in rats.
  Roques, Toxicological sciences : an official journal of the Society of Toxicology 2012 (PubMed)
  • GeneRIF: Both fipronil and fipronil sulfone treatments induced a 2.5-fold increase in Ugt1a1 and Sult1b1 messenger RNA (mRNA) expressions.
• Ontogenic isoform switching of UDP-glucuronosyltransferase family 1 in rat liver.
  Kishi, Biochemical and biophysical research communications 2008 (PubMed)
  • GeneRIF: Developmental stage-specific switching of regulation of the rat UGT1 gene complex was found.
• Induction of UDP-glucuronosyltransferase 1 (UDP-GT1) gene complex by green tea in male F344 rats.
  Embola, Food and chemical toxicology : an international journal published for the British Industrial Biological Research Association 2002 (PubMed)
  • GeneRIF: UDP-glucuronosyltransferase (UDP-GT) activities towards p-nitrophenol were markedly increased in rats that consumed tea.Induction of UDP-glucuronosyltransferase activity by tea may involve the UDP-GT1 (UGT1A) gene complex of the UDP-GT multigene family
• Vitamin A modulates the effects of thyroid hormone on UDP-glucuronosyltransferase expression and activity in rat liver.
  Haberkorn, Molecular and cellular endocrinology 2002 (PubMed)
  • GeneRIF: Data suggest that thyroid hormones and vitamin A are co-regulators of UDP-glucuronosyltransferase (UGT) 1 expression, without affecting the UGT2 family
• Effects on extrahepatic UDP-glucuronosyltransferases in hypophysectomized rat.
  Yokota, Journal of biochemistry 2002 (PubMed)
  • GeneRIF: These results indicate that the expression of extrahepatic UDP-glucuronosyltransferases UGT1a1 and UGT1a6 is isoform-specific and regulated differentially in tissues by the pituitary gland.
• More

UD11_HUMAN / P22309 UDP-glucuronosyltransferase 1A1; UGT1A1; Bilirubin-specific UDPGT isozyme 1; hUG-BR1; UDP-glucuronosyltransferase 1-1; UDPGT 1-1; UGT1*1; UGT1-01; UGT1.1; UDP-glucuronosyltransferase 1A isoform 1; EC 2.4.1.17 from Homo sapiens (Human) (see 44 papers)
P22309 glucuronosyltransferase (EC 2.4.1.17) from Homo sapiens (see 44 papers)
AAA63195.1 UDP-GlcA: glucuronosyltransferase 1A1 (Ugt1a1;Ugt1;Gnt1) (EC 2.4.1.17) (see protein)
NP_000454 UDP-glucuronosyltransferase 1A1 precursor from Homo sapiens
Q5DT03 UDP-glucuronosyltransferase from Homo sapiens
69% identity, 95% coverage

• function: [Isoform 1]: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile (PubMed:12181437, PubMed:15472229, PubMed:18004206, PubMed:18004212, PubMed:18719240, PubMed:19830808, PubMed:23288867, PubMed:15231852, PubMed:21422672, PubMed:38211441). Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds (PubMed:12181437, PubMed:18004206, PubMed:18004212). Catalyzes the glucuronidation of endogenous estrogen hormones such as estradiol, estrone and estriol (PubMed:15472229, PubMed:18719240, PubMed:23288867). Involved in the glucuronidation of bilirubin, a degradation product occurring in the normal catabolic pathway that breaks down heme in vertebrates (PubMed:17187418, PubMed:18004206, PubMed:19830808, PubMed:24525562). Involved in the glucuronidation of arachidonic acid (AA) and AA-derived eicosanoids including 15-HETE, 20- HETE, PGB1 and F2-isoprostane (8-iso-PGF2alpha) (PubMed:15231852, PubMed:38211441). Involved in the glucuronidation of the phytochemical ferulic acid at the phenolic or the carboxylic acid group (PubMed:21422672). Also catalyzes the glucuronidation the isoflavones genistein, daidzein, glycitein, formononetin, biochanin A and prunetin, which are phytoestrogens with anticancer and cardiovascular properties (PubMed:18052087, PubMed:19545173). Involved in the glucuronidation of the AGTR1 angiotensin receptor antagonist losartan, a drug which can inhibit the effect of angiotensin II (PubMed:18674515). Involved in the biotransformation of 7-ethyl-10-hydroxycamptothecin (SN-38), the pharmacologically active metabolite of the anticancer drug irinotecan (PubMed:12181437, PubMed:18004212, PubMed:20610558).
  function: [Isoform 2]: Lacks UGT glucuronidation activity but acts as a negative regulator of isoform 1.
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
  catalytic activity: 17beta-estradiol + UDP-alpha-D-glucuronate = 17beta-estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52460)
  catalytic activity: 2-hydroxyestrone + UDP-alpha-D-glucuronate = 2-hydroxyestrone 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53048)
  catalytic activity: 2-hydroxy-17beta-estradiol + UDP-alpha-D-glucuronate = 2- hydroxy-17beta-estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53004)
  catalytic activity: 2-methoxy-17beta-estradiol + UDP-alpha-D-glucuronate = 2- methoxy-17beta-estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53072)
  catalytic activity: 17alpha-estradiol + UDP-alpha-D-glucuronate = 17alpha- estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52868)
  catalytic activity: 16beta,17beta-estriol + UDP-alpha-D-glucuronate = 16beta,17beta-estriol 16-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52880)
  catalytic activity: losartan + UDP-alpha-D-glucuronate = losartan-2-N-beta-D- glucuronide + UDP (RHEA:63720)
  catalytic activity: prunetin + UDP-alpha-D-glucuronate = prunetin-4'-O-beta-D- glucuronide + UDP (RHEA:63588)
  catalytic activity: SN-38 + UDP-alpha-D-glucuronate = SN-38 O-beta-D-glucuronide + UDP + H(+) (RHEA:63696)
  catalytic activity: (4Z,15Z)-bilirubin IXalpha + UDP-alpha-D-glucuronate = (4Z,15Z)-bilirubin IXalpha C12-beta-D-glucuronoside + UDP (RHEA:75099)
  catalytic activity: (4Z,15Z)-bilirubin IXalpha + UDP-alpha-D-glucuronate = (4Z,15Z)-bilirubin IXalpha C8-beta-D-glucuronoside + UDP (RHEA:79067)
  catalytic activity: (4Z,15Z)-bilirubin IXalpha C8-beta-D-glucuronoside + UDP- alpha-D-glucuronate = (4Z,15Z)-bilirubin IXalpha C8,C12-beta-D- bisglucuronoside + UDP (RHEA:79071)
  catalytic activity: (4Z,15Z)-bilirubin IXalpha C12-beta-D-glucuronoside + UDP- alpha-D-glucuronate = (4Z,15Z)-bilirubin IXalpha C8,C12-beta-D- bisglucuronoside + UDP (RHEA:79075)
  catalytic activity: 8-iso-prostaglandin F2alpha + UDP-alpha-D-glucuronate = 8-iso- prostaglandin F2alpha-glucuronide + UDP + H(+) (RHEA:79907)
  catalytic activity: (5Z,8Z,11Z,14Z)-eicosatetraenoate + UDP-alpha-D-glucuronate = O-[(5Z),(8Z),(11Z),(14Z)-eicosatetraenoyl]-beta-D-glucuronate + UDP (RHEA:79915)
  catalytic activity: 15-hydroxy-(5Z,8Z,11Z,13E)-eicosatetraenoate + UDP-alpha-D- glucuronate = 15-O-(beta-D-glucuronosyl)-(5Z,8Z,11Z,14Z)- eicosatetraenoate + UDP + H(+) (RHEA:79919)
  catalytic activity: 20-hydroxy-(5Z,8Z,11Z,14Z)-eicosatetraenoate + UDP-alpha-D- glucuronate = 20-O-(beta-D-glucuronosyl)-(5Z,8Z,11Z,14Z)- eicosatetraenoate + UDP + H(+) (RHEA:79927)
  catalytic activity: prostaglandin B1 + UDP-alpha-D-glucuronate = 15-O-(beta-D- glucuronosyl)-prostaglandin B1 + UDP + H(+) (RHEA:79935)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-4-O-(beta-D- glucuronosyl)-ferulate + UDP + H(+) (RHEA:79951)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-ferulic acid beta-D-glucuronate ester + UDP (RHEA:79955)
  subunit: Homodimer (PubMed:17179145). Homooligomer (Probable). Interacts with UGT1A3, UGT1A4, UGT1A6, UGT1A7, UGT1A8, UGT1A9 and UGT1A10 to form heterodimers (PubMed:17179145). Isoform 1 interacts with isoform 2/i2 suggesting that oligomerization is involved in negative regulation of transferase activity by isoform 2 (PubMed:17187418, PubMed:20610558). Isoform 1 also interacts with respective i2 isoforms of UGT1A3, UGT1A4, UGT1A6, UGT1A7, UGT1A8, UGT1A9 and UGT1A10 (PubMed:20610558).
• Cytochrome P450 3A gene family and medication in childhood nephrotic syndrome: An update.
  Kochuthakidiyel, Global medical genetics 2025
  • “...Q9HAW9 UDP-glucuronosyltransferase 18 Steroid binding 15472229 UGT1A9 O60656 UDP-glucuronosyltransferase 19 Retinoic acid binding 12181437 UGT1A1 P22309 UDP-glucuronosyltransferase 11 Steroid binding 12181437 UGT1A7 Q9HAW7 UDP-glucuronosyltransferase 17 Retinoic acid binding 12181437 UGT1A10 Q9HAW8 UDP-glucuronosyltransferase 110 Protein kinase c binding 15258099 CYP3A4 P08684 Cytochrome P450 3A4 Vitamin d3 25-hydroxylase...”
  • “...Vitamin d3 25-hydroxylase activity 10681376 CYP2C19 P33261 Cytochrome P450 2C19 Steroid hydroxylase activity 18577768 UGT1A1 P22309 UDP-glucuronosyltransferase 11 Steroid binding 12181437 UGT1A3 P35503 UDP-glucuronosyltransferase 13 Retinoic acid binding 15472229 UGT1A10 Q9HAW8 UDP-glucuronosyltransferase 110 Protein kinase c binding 15258099 UGT2B7 P16662 UDP-glucuronosyltransferase 2B7 Glucuronosyltransferase activity 10702251 UGT2B17...”
• Establishing the capacity to monitor proteins relevant to the study of drug exposure and response using liver-derived extracellular vesicles.
  Newman, British journal of clinical pharmacology 2024
  • “...17 beta 13 (HSD17B13) Q7Z5P4 Liver enriched Medium Low in many DME UDPglucuronosyltransferase 1A1 (UGT1A1) P22309 Liver enriched High Low in intestine Group 2: Enrichment in liver and 12 other tissues DME Cytochrome P450 3A5 (CYP3A5) P20815 Liver, intestine High High in intestine DME Carboxylesterase 1...”
• Similarities in Structure and Function of UDP-Glycosyltransferase Homologs from Human and Plants.
  Lethe, International journal of molecular sciences 2024
  • “...colon, and small intestine, corresponding to their role as catalysts in phase II metabolism (Uniprot P22309, 2023). The UGT1A and UGT2B subfamilies have vital roles in phenolic drug elimination, which are not limited to acetaminophen, SN38, morphine, and assorted cancer drugs like irinotecan [ 15 ]....”
  • “...UDP (tan, PDB#: 2ACW); UGT1A1 was predicted using the AI software AlphaFold2 (light blue; UniProt# P22309; AlphaFold Protein Structure Database# AF-P22309-F1). UGT1A1 has a helical transmembrane-spanning region that is cropped from the image. Figure 4 Size comparison of the acceptor-binding pocket of UGT71G1 with PaGT3. The...”
• ProtVar: mapping and contextualizing human missense variation.
  Stephenson, Nucleic acids research 2024
  • “...ref, alt (consequence) NM_000202.8:c.1327C>T NM_020975.6(RET):c.3105G>A (p.Glu1035Glu) Protein UniProt accession and position accession, position, (ref), (alt) P22309 71 Gly Arg HGVSp RefSeq, type, ref, position, alt NP_001305738.1:p.Pro267Ser Variant ID dbSNP Variant ID rs864622779 ClinVar RCV001270034, VCV002573141 COSMIC COSV64777467, COSM1667583 Input format is assessed for type and then...”
• Cuproptosis gene-related, neural network-based prognosis prediction and drug-target prediction for KIRC.
  Liu, Cancer medicine 2024
  • “...Protooncogene tyrosineprotein kinase receptor Ret DB08073 A443654 P07949 Protooncogene tyrosineprotein kinase receptor Ret DB06486 Enzastaurin P22309 UDPglucuronosyltransferase 1A1 DB00307 Bexarotene P22309 UDPglucuronosyltransferase 1A1 DB00544 5Fluorouracil O60656 UDPglucuronosyltransferase 1A9 DB08073 A443654 P21802 Fibroblast growth factor receptor 2 DB00544 5Fluorouracil P07949 Protooncogene tyrosineprotein kinase receptor Ret DB08073 A443654...”
• The Effect of Citrus aurantium on Non-Small-Cell Lung Cancer: A Research Based on Network and Experimental Pharmacology
  Yao, BioMed research international 2023
  • “...Cytochrome P450 19A1 CYP19A1 P11511 32 Glutathione S-transferase P GSTP1 P09211 33 UDP-glucuronosyltransferase 1-1 UGT1A1 P22309 34 Glutathione reductase, mitochondrial GSTO1 P78417 35 Adiponectin ADIPOQ Q15848 36 Aldo-keto reductase family 1 member C1 AKR1C2 P52895 37 Liver carboxylesterase 1 CES1 P23141 38 Nitric oxide synthase, inducible...”
• Evaluation of tea (Camellia sinensis L.) phytochemicals as multi-disease modulators, a multidimensional in silico strategy with the combinations of network pharmacology, pharmacophore analysis, statistics and molecular docking.
  Nag, Molecular diversity 2023
  • “...17 P22303 1B41 [ 71 ] Acetylcholinesterase Yt blood group antigen (#112,100) Pyridostigmine (DB00545) 18 P22309 Homologous model UDP-glucuronosyltransferase 11 Hyperbilirubinemia (H00208), Bilirubin, serum level of, quantitative trait locus 1; biliqtl1 (#601,816) Adenine (DB00173) 19 P22310 Homologous model UDP-glucuronosyltransferase 14 Gilbert syndrome (#143,500) Idelalisib (DB09054) 20...”
  • “...of the homology modeled proteins The homology modeling of two proteins (UDP-glucuronosyltransferase 11: UniProt id P22309 and UDP-glucuronosyltransferase 14: UniProt id P22310) were performed by SWISS-Model server, based on the templates of PDB id 6KVJ.1.A and 6O86.1.A. The quality analysis was done by the parameters MolProbity...”
• Characterizing common and rare variations in non-traditional glycemic biomarkers using multivariate approaches on multi-ancestry ARIC study.
  Ray, medRxiv : the preprint server for health sciences 2023
  • “...for proteins encoded by both UGT1A1 ( p = 2.0 10 278 , Uniprot ID P22309) and UGT1A6 ( p = 5.6 10 104 , Uniprot ID P19224) corresponding to isoforms of the UDP-glucuronosyltransferase 1A protein complex ( Figure 1 ). It was identified as cis...”
• More
• Associations between UGT1A1, SLCO1B1, SLCO1B3, BLVRA and HMOX1 polymorphisms and susceptibility to neonatal severe hyperbilirubinemia in Chinese Han population.
  Fan, BMC pediatrics 2024
  • GeneRIF: Associations between UGT1A1, SLCO1B1, SLCO1B3, BLVRA and HMOX1 polymorphisms and susceptibility to neonatal severe hyperbilirubinemia in Chinese Han population.
• [UGT1A1 gene mutation spectrum with indirect hyperbilirubinemia in children].
  Shen, Zhonghua gan zang bing za zhi = Zhonghua ganzangbing zazhi = Chinese journal of hepatology 2024 (PubMed)
  • GeneRIF: [UGT1A1 gene mutation spectrum with indirect hyperbilirubinemia in children].
• Activation of Cryptic Donor Splice Sites within the UDP-Glucuronosyltransferase (UGT)1A First-Exon Region Generates Variant Transcripts That Encode UGT1A Proteins with Truncated Aglycone-Binding Domains.
  Hu, Drug metabolism and disposition: the biological fate of chemicals 2024 (PubMed)
  • GeneRIF: Activation of Cryptic Donor Splice Sites within the UDP-Glucuronosyltransferase (UGT)1A First-Exon Region Generates Variant Transcripts That Encode UGT1A Proteins with Truncated Aglycone-Binding Domains.
• Uridine diphosphate glucuronosyltransferase 1A1 prevents the progression of liver injury.
  Jiang, World journal of gastroenterology 2024
  • GeneRIF: Uridine diphosphate glucuronosyltransferase 1A1 prevents the progression of liver injury.
• [Correlation between the mutation spectrum of the UGT1A1 gene and clinical phenotype in patients with inherited hyperunconjugated bilirubinemia].
  Xiong, Zhonghua gan zang bing za zhi = Zhonghua ganzangbing zazhi = Chinese journal of hepatology 2024 (PubMed)
  • GeneRIF: [Correlation between the mutation spectrum of the UGT1A1 gene and clinical phenotype in patients with inherited hyperunconjugated bilirubinemia].
• The Evaluation of the Genetic Variation Types of the Uridine Diphosphate Glucuronosyl Transferase 1A1 Gene by Next-Generation Sequencing and Their Effects on Bilirubin Levels in Obese Children.
  Aslantas, Genetic testing and molecular biomarkers 2024
  • GeneRIF: The Evaluation of the Genetic Variation Types of the Uridine Diphosphate Glucuronosyl Transferase 1A1 Gene by Next-Generation Sequencing and Their Effects on Bilirubin Levels in Obese Children.
• Analysis of UGT1A1 genotype-phenotype correlation in Chinese patients with gilbert and crigler-Najjar II syndrome.
  Wu, European journal of medical genetics 2024 (PubMed)
  • GeneRIF: Analysis of UGT1A1 genotype-phenotype correlation in Chinese patients with gilbert and crigler-Najjar II syndrome.
• Polycyclic aromatic hydrocarbon and its adducts in peripheral blood: Gene and environment interaction among Chinese population.
  Guo, Environment international 2024 (PubMed)
  • GeneRIF: Polycyclic aromatic hydrocarbon and its adducts in peripheral blood: Gene and environment interaction among Chinese population.
• More
• Regioselective sulfation and glucuronidation of phenolics: insights into the structural basis.
  Wu, Current drug metabolism 2011
  • “...for homology modeling. The aligned sequence identity is 13.7%. The full length UGT1A1 sequence (Accession: Q5DT03) was downloaded from the SwissProt database ( http://www.uniprot.org/ ). Approximately 450 amino acids long sequence of human 1A1 (excluding N-terminal signal peptide, C-terminal transmembrane domain and cytosolic tail) was aligned...”

Q20CL6 glucuronosyltransferase (EC 2.4.1.17) from Papio anubis (see paper)
70% identity, 95% coverage

Q9TSL7 glucuronosyltransferase (EC 2.4.1.17) from Macaca fascicularis (see 2 papers)
AAF15549.1 UDP-glucuronosyltransferase UGT1A01 (EC 2.4.1.17) (see protein)
70% identity, 95% coverage

AAK31597.1 UDP-glucuronosyltransferase UGT1A01 (EC 2.4.1.17) (see protein)
69% identity, 95% coverage

BAA24692.1 glucuronosyltransferase (UGT1A1) (EC 2.4.1.17) (see protein)
68% identity, 95% coverage

AAB96667.1 glucuronosyltransferase (UGT1A) (EC 2.4.1.17) (see protein)
68% identity, 95% coverage

UD16_MOUSE / Q64435 UDP-glucuronosyltransferase 1A6; UGT1A6; Phenol UDP-glucuronosyltransferase; UDP-glucuronosyltransferase 1-6; UDPGT 1-6; UGT1*6; UGT1-06; UGT1.6; UGP1A1; UGT1A7; EC 2.4.1.17 from Mus musculus (Mouse) (see 2 papers)
Q64435 glucuronosyltransferase (EC 2.4.1.17) from Mus musculus (see paper)
AAA65979.1 glucuronosyltransferase 1.6 (Ugt1a6;UGT1*06;UGT1A1) (EC 2.4.1.17) (see protein)
NP_659545 UDP-glucuronosyltransferase 1-6 precursor from Mus musculus
68% identity, 98% coverage

• function: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to facilitate their inactivation and excretion from the body (PubMed:8068691). Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds (PubMed:8068691). Involved in the glucuronidation of arachidonic acid (AA) and AA-derived eicosanoids including 15-HETE and 20-HETE (By similarity). Conjugates small planar phenolic molecules such as 4- nitrophenol, 1-naphthol, and 4-methylumbelliferone. The bulky phenol 4- hydroxybiphenyl, androgens and estrogens are not substrates. 2- hydroxybiphenyl is an excellent substrate (PubMed:8068691). Involved in the glucuronidation of the phytochemical ferulic acid at the phenolic or the carboxylic acid group (By similarity).
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
  catalytic activity: (5Z,8Z,11Z,14Z)-eicosatetraenoate + UDP-alpha-D-glucuronate = O-[(5Z),(8Z),(11Z),(14Z)-eicosatetraenoyl]-beta-D-glucuronate + UDP (RHEA:79915)
  catalytic activity: 15-hydroxy-(5Z,8Z,11Z,13E)-eicosatetraenoate + UDP-alpha-D- glucuronate = 15-O-(beta-D-glucuronosyl)-(5Z,8Z,11Z,14Z)- eicosatetraenoate + UDP + H(+) (RHEA:79919)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-4-O-(beta-D- glucuronosyl)-ferulate + UDP + H(+) (RHEA:79951)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-ferulic acid beta-D-glucuronate ester + UDP (RHEA:79955)
• Arsenic modifies serotonin metabolism through glucuronidation in pancreatic β-cells
  Carmean, American journal of physiology. Endocrinology and metabolism 2019
  • GeneRIF: This study provides evidence that UGT1A6A, acting on the serotonin pathway, regulates glucose induced insulin secretion under both normal and pathological conditions.
• Comparison of serotonin glucuronidation activity of UDP-glucuronosyltransferase 1a6a (Ugt1a6a) and Ugt1a6b: evidence for the preferential expression of Ugt1a6a in the mouse brain.
  Uchihashi, Drug metabolism and pharmacokinetics 2013 (PubMed)
  • GeneRIF: the difference in expression levels between Ugt1a6a and Ugt1a6b in the hippocampus led us to speculate that Ugt1a6a is likely the predominant catalyst of serotonin glucuronidation in the mouse brain.
• Development of a Global Metabo-Lipid-Prote-omics Workflow to Compare Healthy Proximal and Distal Colonic Epithelium in Mice
  Hemmati, Journal of proteome research 2024
  • “...activity was increased in PC tissue which represents 5 UDP-glucuronosyltransferases [Ugt2b17 (P17717), Ugt1a1 (Q63886), Ugt1a6 (Q64435), Ugt1a7c (Q6ZQM8), and Ugt2a3 (Q8BWQ1, 2.4.1.17)]. Higher levels of the substrate UDP-glucuronide and its precursor UDP-glucose were observed in the DC tissue, indicating the usage of the UDP-glucuronide pool in...”
• Interpreting the Molecular Mechanisms of Yinchenhao Decoction on Hepatocellular Carcinoma through Absorbed Components Based on Network Pharmacology.
  Sun, BioMed research international 2021
  • “...P22309 Tar095 UGT1A10 UDP-glucuronosyltransferase 1A10 Q9HAW8 Tar096 UGT1A3 UDP-glucuronosyltransferase 1A3 P35503 Tar097 UGT1A6 UDP-glucuronosyltransferase 1-6 Q64435 Tar098 UGT1A7 UDP-glucuronosyltransferase 1A7 Q9HAW7 Tar099 UGT1A8 UDP-glucuronosyltransferase 1A8 Q9HAW9 Tar100 UGT1A9 UDP-glucuronosyltransferase 1A9 Q62452 Tar101 UGT2B15 UDP-glucuronosyltransferase 2B15 P54855 Tar102 UGT2B17 UDP-glucuronosyltransferase 2B17 O75795 Tar103 VCAM1 Vascular cell adhesion...”
• Re-adaption on Earth after Spaceflights Affects the Mouse Liver Proteome.
  Anselm, International journal of molecular sciences 2017
  • “...3A13 Q3UW87 - 0.4 0.0121 0.0279 UDP-glucuronosyltransferase 1-1 Q63886 - 1.2 0.0420 0.0185 UDP-glucuronosyltransferase 1-6 Q64435 - 2.0 0.0179 0.0410 Cytochrome P450 2C54 Q6XVG2 * >0.05 0.0476 UDP-glucuronosyltransferase 2A3 Q8BWQ1 - 1.9 0.0109 0.0132 UDP-glucuronosyltransferase Q8K154 - 1.9 0.0172 0.0126 UDP-glucuronosyltransferase Q8R084 - 3.5 0.0118 0.0119...”
• Reduced mitochondrial mass and function add to age-related susceptibility toward diet-induced fatty liver in C57BL/6J mice.
  Lohr, Physiological reports 2016
• Proteomic analysis reveals down-regulation of surfactant protein B in murine type II pneumocytes infected with influenza A virus.
  Kebaabetswe, Virology 2015
  • “...Polysaccharides Metabolism Q8C166 Copine I 11 0.67 (0.029) P50405 Surfactant-associated protein B 8 0.37 (<0.001) Q64435 UDP glucuronosyltransferase 16 6 0.78 (0.05) Q80UM7 Mannosyl-oligosaccharide glucosidase 2 * (0.014) Other Metabolism P22437 Prostaglandin-endoperoxide synthase 1 2 0.44 (0.007) Miscellaneous Transmembrane Q9DBS1 Transmembrane protein 43 11 0.77 (0.037)...”

UD16_HUMAN / P19224 UDP-glucuronosyltransferase 1A6; UGT1A6; Phenol-metabolizing UDP-glucuronosyltransferase; UDP-glucuronosyltransferase 1-6; UDPGT 1-6; UGT1*6; UGT1-06; UGT1.6; UDP-glucuronosyltransferase 1-F; UGT-1F; UGT1F; EC 2.4.1.17 from Homo sapiens (Human) (see 7 papers)
P19224 glucuronosyltransferase (EC 2.4.1.17) from Homo sapiens (see 30 papers)
AAG30420.1 UDP-GlcA: glucuronosyltransferase 1A6 (Ugt1a6) (EC 2.4.1.17) (see protein)
66% identity, 97% coverage

• function: [Isoform 1]: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to facilitate their inactivation and excretion from the body (PubMed:15231852, PubMed:21422672). Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds (PubMed:15231852, PubMed:21422672). Involved in the glucuronidation of arachidonic acid (AA) and AA-derived eicosanoids including 15-HETE and 20-HETE (PubMed:15231852). Conjugates small planar phenolic molecules such as 4-nitrophenol, 1-naphthol, and 4- methylumbelliferone. The bulky phenol 4-hydroxybiphenyl, androgens and estrogens are not substrates. 2-hydroxybiphenyl is an excellent substrate (By similarity). Involved in the glucuronidation of the phytochemical ferulic acid at the phenolic or the carboxylic acid group (PubMed:21422672).
  function: [Isoform 3]: Isoform 3 lacks transferase activity but acts as a negative regulator of isoform 1.
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
  catalytic activity: (5Z,8Z,11Z,14Z)-eicosatetraenoate + UDP-alpha-D-glucuronate = O-[(5Z),(8Z),(11Z),(14Z)-eicosatetraenoyl]-beta-D-glucuronate + UDP (RHEA:79915)
  catalytic activity: 15-hydroxy-(5Z,8Z,11Z,13E)-eicosatetraenoate + UDP-alpha-D- glucuronate = 15-O-(beta-D-glucuronosyl)-(5Z,8Z,11Z,14Z)- eicosatetraenoate + UDP + H(+) (RHEA:79919)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-4-O-(beta-D- glucuronosyl)-ferulate + UDP + H(+) (RHEA:79951)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-ferulic acid beta-D-glucuronate ester + UDP (RHEA:79955)
  subunit: Isoform 1 interacts with isoform 3/i2 suggesting that oligomerization is involved in negative regulation of transferase activity by isoform 3. Isoform 1 also interacts with respective i2 isoforms of UGT1A1, UGT1A3, UGT1A4, UGT1A7, UGT1A8, UGT1A9 and UGT1A10.
• Exploring potential plasma drug targets for cholelithiasis through multiancestry Mendelian randomization.
  Liu, International journal of surgery (London, England) 2025
  • “...Wald ratio 0.865 (0.8450.886) 4.7010 32 1479.658 Ferkingstad et al . 7 European UGT 1A6 P19224 rs1976391 G Wald ratio 0.680 (0.4960.626) 9.5810 30 759.910 Ferkingstad et al . 7 European NOE1 Q99784 rs977371848 T Wald ratio 0.557 (0.4960.626) 4.2110 23 174.518 Ferkingstad et al ....”
  • “...FUT3 P21217 rs708686 0.806 (0.5861.107) Passed (1.4910 242 ) 1.000 Statistically significance European UGT 1A6 P19224 rs1976391 0.965 (0.8631.079) Passed (4.6510 118 ) 0.996 Statistically significance European NOE1 Q99784 rs977371848 1.015 (0.9861.045) Passed (8.3710 23 ) 0.993 Directional consistency European GCKR Q14397 rs1260326 1.029 (0.9821.078) Passed...”
• Establishing the capacity to monitor proteins relevant to the study of drug exposure and response using liver-derived extracellular vesicles.
  Newman, British journal of clinical pharmacology 2024
  • “...Ketohexokinase (KHK) P50053 Liver, intestine, kidney High High in intestine, kidney DME UDPglucuronosyltransferase 1A6 (UGT1A6) P19224 Liver, kidney Medium High in kidney, medium in intestine DME UDPglucuronosyltransferase 2B4 (UGT2B4) P06133 Liver, intestine, kidney Medium High in intestine, kidney DME UDPglucuronosyltransferase 2B7 (UGT2B7) P16662 Liver, kidney High...”
• Druggable proteins influencing cardiac structure and function: Implications for heart failure therapies and cancer cardiotoxicity.
  Schmidt, Science advances 2023
  • “...Inhibitor ISK2 (P20155) LYAM2 (P16581) Indirectly druggable None None Harmful 3 3 Antagonist, inhibitor UD16 (P19224) Currently not druggable Left Harmful Harmful 0 0 CD33 (P20138) Directly drugged Left Harmful Beneficial 4 6 Binding agent, other CAH6 (P23280) Directly drugged Right Harmful Harmful 4 1 Inhibitor...”
• Characterizing common and rare variations in non-traditional glycemic biomarkers using multivariate approaches on multi-ancestry ARIC study.
  Ray, medRxiv : the preprint server for health sciences 2023
  • “..., Uniprot ID P22309) and UGT1A6 ( p = 5.6 10 104 , Uniprot ID P19224) corresponding to isoforms of the UDP-glucuronosyltransferase 1A protein complex ( Figure 1 ). It was identified as cis -eQTL for UGT1A3 and UGT1A8 in the same complex of alternatively spliced...”
• IgGFc-binding protein and MUC2 mucin produced by colonic goblet-like cells spatially interact non-covalently and regulate wound healing.
  Gorman, Frontiers in immunology 2023
  • “...P12277 0.719577745 RBM39 RNA-binding protein 39 Q14498 0.735175542 INF2 Inverted formin-2 Q27J81 0.752149128 UGT1A6 UDP-glucuronosyltransferases P19224 0.763751492 EPB41L2 Band 4.1-like protein 2 O43491 0.777451278 HSP90AB2P Putative heat shock protein HSP 90-beta 2 Q58FF8 0.789186704 ATP1A1 Sodium/potassium-transporting ATPase subunit alpha-1 P05023 0.801241448 BSG Basigin P35613 0.809002775 CD9...”
• Intra- and Inter-individual Differences in the Human Intestinal Microbial Conversion of (-)-Epicatechin and Bioactivity of Its Major Colonic Metabolite 5-(3',4'-Dihydroxy-Phenyl)-γ-Valerolactone in Regulating Nrf2-Mediated Gene Expression.
  Liu, Frontiers in nutrition 2022
  • “...glutathione peroxidase 8 GPX8 2.11 (0.376) 0.97 (0.979) Q13162 Peroxiredoxin-4 PRDX4 1.57 (0.034) 1.24 (0.410) P19224 UDP-glucuronosyltransferase UGT1A6 1.10 (0.749) 1.31 (0.344) P34913 Bifunctional epoxide hydrolase 2 EPHX2 1.14 (0.440) 1.40 (0.043) Q13501 Sequestosome-1 SQSTM1 1.05 (0.969) 1.21 (0.874) O75027 ABCB7 ABCB7 0.49 (0.526) 2.31 (0.297)...”
• Homology Modeling of Human Uridine-5'-diphosphate-glucuronosyltransferase 1A6 Reveals Insights into Factors Influencing Substrate and Cosubstrate Binding
  Smith, ACS omega 2020
  • “...Modeling of UGT1A6 Homology models of the human UGT1A6 protein (GenBank accession #: NP_001063.2, Uniprot: P19224) were produced using the I-TASSER server. 64 66 UGT1A6 possesses a 26-amino acid N-terminal signal peptide which acts to target the immature protein to the ER. 40 Once inserted into...”
• Molecular Docking-Based Design and Development of a Highly Selective Probe Substrate for UDP-glucuronosyltransferase 1A10.
  Juvonen, Molecular pharmaceutics 2018
  • “...accession codes for the retrieved UGT1As were: Q9HAW8 (1A10), O60656 (1A9), Q9HAW9 (1A8), Q9HAW7 (1A7), P19224 (1A6), P35504 (1A5), P22310 (1A4), P35503 (1A3), and P22039 (1A1). To identify template protein structures for homology modeling purposes, the retrieved UGT sequences were used in blast searches against the...”
• More

NP_001034780 UDP-glucuronosyltransferase 1-6 precursor from Rattus norvegicus
Q6T5E9 UDP-glucuronosyltransferase from Rattus norvegicus
68% identity, 98% coverage

• Bile duct ligation elevates 5-HT levels in cerebral cortex of rats partly due to impairment of brain UGT1A6 expression and activity via ammonia accumulation.
  Yang, Redox biology 2024
  • GeneRIF: Bile duct ligation elevates 5-HT levels in cerebral cortex of rats partly due to impairment of brain UGT1A6 expression and activity via ammonia accumulation.
• Effect of status epilepticus on expression of brain UDP-glucuronosyltransferase 1a in rats.
  Asai, Biopharmaceutics & drug disposition 2018 (PubMed)
  • GeneRIF: study indicated that Status Epilepticus altered the expression of brain Ugt1a1 and Ugt1a7, which could alter glucuronidation in the brain.
• Effects of β-Naphthoflavone on Ugt1a6 and Ugt1a7 Expression in Rat Brain.
  Sakakibara, Biological & pharmaceutical bulletin 2016 (PubMed)
  • GeneRIF: This study clarified that Ugt1a6 and Ugt1a7 mRNA expression and their enzyme activities were altered by beta-naphthoflavone, suggesting that these changes may lead to alteration in the pharmacokinetics of UGT substrate in rat brain.
• Effect of adrenalectomy on expression and induction of UDP-glucuronosyltransferase 1A6 and 1A7 in rats.
  Sakakibara, Biological & pharmaceutical bulletin 2014 (PubMed)
  • GeneRIF: results indicate that adrenal-dependent factors such as glucocorticoids are partially involved in the basal regulation of UGT1A6 and UGT1A7 transcription.
• Effect of oxidative stress on UDP-glucuronosyltransferases in rat astrocytes.
  Gradinaru, Toxicology letters 2012 (PubMed)
  • GeneRIF: Catalytic properties/expression of UGT1A6/7 are influenced by the pro-oxidant environment in astrocytes.
• Drug metabolizing enzyme expression in rat choroid plexus: effects of in vivo xenobiotics treatment.
  Gradinaru, Archives of toxicology 2009 (PubMed)
  • GeneRIF: We present for the first time evidences that the choroids plexus express transcripts for both UGT1A6 and NADPH-cytochrome P450 reductase
• Vitamin A modulates the effects of thyroid hormone on UDP-glucuronosyltransferase expression and activity in rat liver.
  Haberkorn, Molecular and cellular endocrinology 2002 (PubMed)
  • GeneRIF: Data suggest that thyroid hormones and vitamin A are co-regulators of UDP-glucuronosyltransferase (UGT) 1 expression, without affecting the UGT2 family.
• Effects on extrahepatic UDP-glucuronosyltransferases in hypophysectomized rat.
  Yokota, Journal of biochemistry 2002 (PubMed)
  • GeneRIF: These results indicate that the expression of extrahepatic UDP-glucuronosyltransferases UGT1a1 and UGT1a6 is isoform-specific and regulated differentially in tissues by the pituitary gland.
• More
• High throughput metabolomics-proteomics investigation on metabolic phenotype changes in rats caused by Radix Scrophulariae using ultra-performance liquid chromatography with mass spectrometry.
  Lu, RSC advances 2019
  • “...Olr796 Olfactory receptor 1.5880 Up* 0.0484 L70 D3ZMQ0 Mga Protein Mga 1.6374 Up* 0.0312 L71 Q6T5E9 Ugt1a6 UDP-glucuronosyltransferase 1.7279 Up** 0.0003 L72 A1XF83 Ugt2b UDP-glucuronosyltransferase 1.8256 Up** 0.0001 L73 D3ZXC8 Ebpl Emopamil binding protein-like (predicted), isoform CRA_a 1.8324 Up** 0.0018 L74 F1LM22 Ugt2b UDP-glucuronosyltransferase 1.8894 Up**...”

AAL67853.1 Glucuronosyltransferase 1A6 (Ugt1a6) (EC 2.4.1.17) (see protein)
68% identity, 98% coverage

Q9TSL9 glucuronosyltransferase (EC 2.4.1.17) from Macaca fascicularis (see paper)
AAF15547.1 UDP-glucuronosyltransferase UGT1A06 (EC 2.4.1.17) (see protein)
66% identity, 97% coverage

Q20CL1 glucuronosyltransferase (EC 2.4.1.17) from Papio anubis (see paper)
66% identity, 97% coverage

P08430 glucuronosyltransferase (EC 2.4.1.17) from Rattus norvegicus (see 2 papers)
68% identity, 98% coverage

• Molecular Insights into the Copper-Sensitive Operon Repressor in Acidithiobacillus caldus.
  Hou, Applied and environmental microbiology 2021
• Proteomic analysis of acetaminophen-induced hepatotoxicity and identification of heme oxygenase 1 as a potential plasma biomarker of liver injury.
  Gao, Proteomics. Clinical applications 2017
  • “...necrosis factor receptor superfamily member 6 FAS 1.41 4.30 10 2 Diagnosis, disease progression, efficacy P08430 UDP-glucuronosyltransferase 16 UGT1A6 1.44 3.33 10 2 Q5I034 Uncharacterized protein C12orf43 homolog RGD1311899 2.04 4.17 10 3 a) Fold change listed was from dataset Dataset 5 (24 h, 1250 mg/kg...”

AAP48599.1 Glucuronosyltransferase 1.7 (EC 2.4.1.17) (see protein)
68% identity, 98% coverage

UD19_MOUSE / Q62452 UDP-glucuronosyltransferase 1A9; UGT1A9; UDP-glucuronosyltransferase 1-7; UDPGT; UDP-glucuronosyltransferase 1-9; UDPGT 1-9; UGT1*9; UGT1-09; UGT1.9; UGT1A12; UGTP4; EC 2.4.1.17 from Mus musculus (Mouse) (see paper)
NP_964006 UDP-glucuronosyltransferase 1A9 precursor from Mus musculus
68% identity, 98% coverage

• function: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile. Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds. Catalyzes the glucuronidation of endogenous estrogen hormones such as estradiol and estrone. Involved in the glucuronidation of arachidonic acid (AA) and AA-derived eicosanoids including 15-HETE, PGB1 and F2-isoprostanes (8-iso-PGF2alpha and 5-epi- 5-F2t-IsoP). Glucuronates the phytochemical ferulic acid efficently at both the phenolic or the carboxylic acid group. Also catalyzes the glucuronidation of the isoflavones genistein, daidzein, glycitein, formononetin, biochanin A and prunetin, which are phytoestrogens with anticancer and cardiovascular properties. Involved in the glucuronidation of the AGTR1 angiotensin receptor antagonist caderastan, a drug which can inhibit the effect of angiotensin II. Involved in the biotransformation of 7-ethyl-10-hydroxycamptothecin (SN-38), the pharmacologically active metabolite of the anticancer drug irinotecan. Also metabolizes mycophenolate, an immunosuppressive agent.
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
  catalytic activity: 2-hydroxy-17beta-estradiol + UDP-alpha-D-glucuronate = 2- hydroxy-17beta-estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53004)
  catalytic activity: 4-hydroxy-17beta-estradiol + UDP-alpha-D-glucuronate = 17beta- estradiol 4-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53040)
  catalytic activity: 2-hydroxyestrone + UDP-alpha-D-glucuronate = 2-hydroxyestrone 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53048)
  catalytic activity: 4-hydroxyestrone + UDP-alpha-D-glucuronate = estrone 4-O- (beta-D-glucuronate) + UDP + H(+) (RHEA:53060)
  catalytic activity: prunetin + UDP-alpha-D-glucuronate = prunetin-5-O-beta-D- glucuronide + UDP (RHEA:63612)
  catalytic activity: 8-iso-prostaglandin F2alpha + UDP-alpha-D-glucuronate = 8-iso- prostaglandin F2alpha-glucuronide + UDP + H(+) (RHEA:79907)
  catalytic activity: 5-epi-5-F2t-IsoP + UDP-alpha-D-glucuronate = 5-epi-5-F2t-IsoP- glucuronide + UDP + H(+) (RHEA:79911)
  catalytic activity: (5Z,8Z,11Z,14Z)-eicosatetraenoate + UDP-alpha-D-glucuronate = O-[(5Z),(8Z),(11Z),(14Z)-eicosatetraenoyl]-beta-D-glucuronate + UDP (RHEA:79915)
  catalytic activity: 15-hydroxy-(5Z,8Z,11Z,13E)-eicosatetraenoate + UDP-alpha-D- glucuronate = 15-O-(beta-D-glucuronosyl)-(5Z,8Z,11Z,14Z)- eicosatetraenoate + UDP + H(+) (RHEA:79919)
  catalytic activity: prostaglandin B1 + UDP-alpha-D-glucuronate = 15-O-(beta-D- glucuronosyl)-prostaglandin B1 + UDP + H(+) (RHEA:79935)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-4-O-(beta-D- glucuronosyl)-ferulate + UDP + H(+) (RHEA:79951)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-ferulic acid beta-D-glucuronate ester + UDP (RHEA:79955)
  catalytic activity: candesartan + UDP-alpha-D-glucuronate = candesartan O-beta-D- glucuronoside + UDP (RHEA:63724)
  catalytic activity: SN-38 + UDP-alpha-D-glucuronate = SN-38 O-beta-D-glucuronide + UDP + H(+) (RHEA:63696)
  catalytic activity: mycophenolate + UDP-alpha-D-glucuronate = mycophenolate 7-O- beta-D-glucuronide + UDP + H(+) (RHEA:63704)
  subunit: Homodimer. Homooligomer. Interacts with UGT1A1, UGT1A3, UGT1A4, UGT1A6, UGT1A7, UGT1A8 and UGT1A10 to form heterodimers.
• Circadian Clock Component Rev-erbα Regulates Diurnal Rhythm of UDP-Glucuronosyltransferase 1a9 and Drug Glucuronidation in Mice.
  Xu, Drug metabolism and disposition: the biological fate of chemicals 2020 (PubMed)
  • GeneRIF: Circadian Clock Component Rev-erbalpha Regulates Diurnal Rhythm of UDP-Glucuronosyltransferase 1a9 and Drug Glucuronidation in Mice.
• Cyp3a11-mediated testosterone-6β-hydroxylation decreased, while UGT1a9-mediated propofol O-glucuronidation increased, in mice with diabetes mellitus.
  Shi, Biopharmaceutics & drug disposition 2016 (PubMed)
  • GeneRIF: Diabetes mellitus caused a decrease in the activity of Cyp3a11-mediated testosterone-6beta-hydroxylation, but no change in the activity of Cyp3a11-mediated midazolam 1-hydroxylation and an increase in the activity of UGT1a9-mediated propofol O-glucuronidation in db/db mice
• Tandem mass tag-based proteomics analysis of type 2 diabetes mellitus with non-alcoholic fatty liver disease in mice treated with acupuncture
  Wang, Bioscience reports 2022
  • “...synthase Fasn 0.698 0.00244 down P97311 DNA replication licensing factor MCM6 Mcm6 0.682 0.00278 down Q62452 UDP-glucuronosyltransferase 1-9 Ugt1a9 0.676 0.00134 down P10648 Glutathione S-transferase A2 Gsta2 0.674 0.000537 down P56655 Cytochrome P450 2C38 Cyp2c38 0.669 0.0061 down Q8BUE4 Apoptosis-inducing factor 2 Aifm2 0.669 0.000524 down...”
• Interpreting the Molecular Mechanisms of Yinchenhao Decoction on Hepatocellular Carcinoma through Absorbed Components Based on Network Pharmacology.
  Sun, BioMed research international 2021
  • “...Q64435 Tar098 UGT1A7 UDP-glucuronosyltransferase 1A7 Q9HAW7 Tar099 UGT1A8 UDP-glucuronosyltransferase 1A8 Q9HAW9 Tar100 UGT1A9 UDP-glucuronosyltransferase 1A9 Q62452 Tar101 UGT2B15 UDP-glucuronosyltransferase 2B15 P54855 Tar102 UGT2B17 UDP-glucuronosyltransferase 2B17 O75795 Tar103 VCAM1 Vascular cell adhesion protein 1 P19320 Tar104 VEGFA Vascular endothelial growth factor A P15692 Tar105 XDH Xanthine dehydrogenase/oxidase...”
• Sortilin 1 Loss-of-Function Protects Against Cholestatic Liver Injury by Attenuating Hepatic Bile Acid Accumulation in Bile Duct Ligated Mice.
  Li, Toxicological sciences : an official journal of the Society of Toxicology 2018
• Functional proteomic analysis of corticosteroid pharmacodynamics in rat liver: Relationship to hepatic stress, signaling, energy regulation, and drug metabolism.
  Ayyar, Journal of proteomics 2017
  • “...UDP-glucuronosyltransferase 1A1 Drugs = opioids, SN-38 (irinotecan); endogenous substrates = bilirubin, ethinylestradiol; polymorphic enzyme DOWN/UP Q62452 Ugt1a9 UDP-glucuronosyltransferase 1A9 Drugs = R-oxepam, mycophenolic acid, SN-38 (irinotecan); halogenated phenols; polymorphic enzyme DOWN P09875 Ugt2b1 UDP-glucuronosyltransferase 2B1 Drug = diclofenac ; bisphenol A (environmental chemical) UP P36511 Ugt2b15...”
• The invertebrate Caenorhabditis elegans biosynthesizes ascorbate
  Patananan, Archives of biochemistry and biophysics 2015
  • “...67% 0 Yes UDP-glucose dehydrogenase * O70475 UDP-glucoseUDP-glucuronate F29F11.1 * 66% 0 Yes UDP-glucuronosyltransferase * Q62452 UDP-glucuronateacceptor-beta-D-glucuronoside C08F11.8 *** 27% 710 56 2 nd -glucuronidase ** P12265 a beta-D-glucuronosideD-glucuronate Y105E8B.9 **** 40% 9310 154 Yes Glucuronate reductase ** Q540D7 D-glucuronateL-gulonate Y39G8B.1 **** 47% 410 97 2...”
• Proteomic analysis of Nrf2 deficient transgenic mice reveals cellular defence and lipid metabolism as primary Nrf2-dependent pathways in the liver.
  Kitteringham, Journal of proteomics 2010
  • “...0.58 0.80 0.72 0.021 O70475 UDP-glucose 6-dehydrogenase 1.09 0.97 1.23 0.79 0.63 0.99 0.73 0.183 Q62452 UDP-glucuronosyltransferase 1-9 0.99 0.93 1.06 0.73 0.58 0.92 0.74 0.183 Q91VA0 Acyl-coenzyme A synthetase ACSM1, mitochondrial 0.97 0.91 1.04 0.79 0.74 0.84 0.81 0.001 Q64442 Sorbitol dehydrogenase 1.02 0.92 1.13...”

NP_787040 UDP-glucuronosyltransferase 1A8 precursor from Rattus norvegicus
67% identity, 97% coverage

• Analysis of substrate specificities and tissue expression of rat UDP-glucuronosyltransferases UGT1A7 and UGT1A8.
  Webb, Drug metabolism and disposition: the biological fate of chemicals 2005 (PubMed)
  • GeneRIF: Studies of their activities and tissue expression suggest complementary functions of UGT1A8 and UGT1A7 isoforms in xenobiotic metabolism.

UD17_MOUSE / Q6ZQM8 UDP-glucuronosyltransferase 1A7; UGT1A7; UDP-glucuronosyltransferase 1-7C; UDPGT 1-7C; UGT1*7C; UGT1-07C; UGT1.7C; UDP-glucuronosyltransferase 1A7C; EC 2.4.1.17 from Mus musculus (Mouse) (see paper)
67% identity, 97% coverage

• function: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile. Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds. Catalyzes the glucuronidation of endogenous estrogen hormone epiestradiol. Involved in the glucuronidation of F2-isoprostane (5-epi-5-F2t-IsoP). Involved in the glucuronidation of the phytochemical ferulic acid at the carboxylic acid group. Also catalyzes the glucuronidation of the isoflavones genistein, daidzein, glycitein, formononetin, biochanin A and prunetin, which are phytoestrogens with anticancer and cardiovascular properties. Involved in the glucuronidation of the AGTR1 angiotensin receptor antagonist caderastan, a drug which can inhibit the effect of angiotensin II. Involved in the biotransformation of 7-ethyl-10- hydroxycamptothecin (SN-38), the pharmacologically active metabolite of the anticancer drug irinotecan. Also metabolizes mycophenolate, an immunosuppressive agent.
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
  catalytic activity: 17alpha-estradiol + UDP-alpha-D-glucuronate = 17alpha- estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52868)
  catalytic activity: prunetin + UDP-alpha-D-glucuronate = prunetin-5-O-beta-D- glucuronide + UDP (RHEA:63612)
  catalytic activity: 5-epi-5-F2t-IsoP + UDP-alpha-D-glucuronate = 5-epi-5-F2t-IsoP- glucuronide + UDP + H(+) (RHEA:79911)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-ferulic acid beta-D-glucuronate ester + UDP (RHEA:79955)
  catalytic activity: candesartan + UDP-alpha-D-glucuronate = candesartan O-beta-D- glucuronoside + UDP (RHEA:63724)
  catalytic activity: SN-38 + UDP-alpha-D-glucuronate = SN-38 O-beta-D-glucuronide + UDP + H(+) (RHEA:63696)
  catalytic activity: mycophenolate + UDP-alpha-D-glucuronate = mycophenolate 7-O- beta-D-glucuronide + UDP + H(+) (RHEA:63704)
  subunit: Homodimer. Homooligomer. Interacts with UGT1A1, UGT1A3, UGT1A4, UGT1A6, UGT1A8, UGT1A9 and UGT1A10 to form heterodimers.
• Development of a Global Metabo-Lipid-Prote-omics Workflow to Compare Healthy Proximal and Distal Colonic Epithelium in Mice
  Hemmati, Journal of proteome research 2024
  • “...increased in PC tissue which represents 5 UDP-glucuronosyltransferases [Ugt2b17 (P17717), Ugt1a1 (Q63886), Ugt1a6 (Q64435), Ugt1a7c (Q6ZQM8), and Ugt2a3 (Q8BWQ1, 2.4.1.17)]. Higher levels of the substrate UDP-glucuronide and its precursor UDP-glucose were observed in the DC tissue, indicating the usage of the UDP-glucuronide pool in PC tissue....”
• Proteomic Analysis Identifies Multiple Mechanisms of 5-Fluorouracil-Induced Gut Mucositis in Mice.
  Ivanov, Cancers 2024
  • “...Aldh1a1 2.2 Sulfide:quinone oxidoreductase, mitochondrial Q9R112 Sqor 5.2 UDP-glucose 6-dehydrogenase O70475 Ugdh 12.5 UDP-glucuronosyltransferase 1-7C Q6ZQM8 Ugt1a7 2.4 Proteins up-regulated in the ileum 4-aminobutyrate aminotransferase, mitochondrial P61922 Abat 4.7 Amiloride-sensitive amine oxidase [copper-containing] Q8JZQ5 Aoc1 7.8 Glucose-6-phosphate isomerase P06745 Gpi 12.0 Glutathione peroxidase 1 P11352 Gpx1...”
• Integrated transcriptomic and proteomic analyses uncover regulatory roles of Nrf2 in the kidney.
  Shelton, Kidney international 2015
  • “...03 Q148B6 N.D. N.D. N.D. N.D. Ugt1a10 446962 NM_201641 0.58 9.04 04 1.45 2.12 02 Q6ZQM8 0.25 6.18 05 1.09 5.50 01...”
• Characterization of the proteome of cytoplasmic lipid droplets in mouse enterocytes after a dietary fat challenge.
  D'Aquila, PloS one 2015
  • “...46 ] 19.562 Sulfotransferase family cytosolic 1B member 1 Sult1b1 Q9QWG7 21.097 UDP-glucuronosyltransferase 1-7C Ugt1a7c Q6ZQM8 18.177 Transitional endoplasmic reticulum ATPase Vcp Q8BNF8 [ 45 47 ] Thirty seven proteins associated with known lipid metabolism pathways were identified, of which twenty three proteins have been previously...”

AAL67851.1 Glucuronosyltransferase 1.8 (EC 2.4.1.17) (see protein)
67% identity, 97% coverage

Q64634 glucuronosyltransferase (EC 2.4.1.17) from Rattus norvegicus (see 3 papers)
66% identity, 97% coverage

Q95M37 glucuronosyltransferase (EC 2.4.1.17) from Canis lupus familiaris (see paper)
65% identity, 96% coverage

NP_569091 UDP-glucuronosyltransferase 1A7 precursor from Rattus norvegicus
68% identity, 95% coverage

• Effect of adrenalectomy on expression and induction of UDP-glucuronosyltransferase 1A6 and 1A7 in rats.
  Sakakibara, Biological & pharmaceutical bulletin 2014 (PubMed)
  • GeneRIF: results indicate that adrenal-dependent factors such as glucocorticoids are partially involved in the basal regulation of UGT1A6 and UGT1A7 transcription.
• Effect of oxidative stress on UDP-glucuronosyltransferases in rat astrocytes.
  Gradinaru, Toxicology letters 2012 (PubMed)
  • GeneRIF: Catalytic properties/expression of UGT1A6/7 are influenced by the pro-oxidant environment in astrocytes.
• Analysis of substrate specificities and tissue expression of rat UDP-glucuronosyltransferases UGT1A7 and UGT1A8.
  Webb, Drug metabolism and disposition: the biological fate of chemicals 2005 (PubMed)
  • GeneRIF: Studies of their activities and tissue expression suggest complementary functions of UGT1A7 and UGT1A8 isoforms in xenobiotic metabolism.

AAH78732.1 Glucuronosyltransferase 1.7 (EC 2.4.1.17) (see protein)
68% identity, 93% coverage

BAA23359.1 UDP-glucuronosyltransferase UGT1A4 (EC 2.4.1.17) (see protein)
63% identity, 98% coverage

Q64633 glucuronosyltransferase (EC 2.4.1.17) from Rattus norvegicus (see 2 papers)
68% identity, 95% coverage

UGT1A8 / Q9HAW9 UDP-glucuronosyltransferase 1-8 (EC 2.4.1.17) from Homo sapiens (see 4 papers)
UD18_HUMAN / Q9HAW9 UDP-glucuronosyltransferase 1A8; UGT1A8; UDP-glucuronosyltransferase 1-8; UDPGT 1-8; UGT1*8; UGT1-08; UGT1.8; UDP-glucuronosyltransferase 1-H; UGT-1H; UGT1H; EC 2.4.1.17 from Homo sapiens (Human) (see 13 papers)
Q9HAW9 glucuronosyltransferase (EC 2.4.1.17) from Homo sapiens (see 20 papers)
NP_061949 UDP-glucuronosyltransferase 1A8 precursor from Homo sapiens
62% identity, 100% coverage

• function: [Isoform 1]: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile (PubMed:15472229, PubMed:16595710, PubMed:18004212, PubMed:18052087, PubMed:18674515, PubMed:18719240, PubMed:19545173, PubMed:23288867, PubMed:21422672). Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds (PubMed:15472229, PubMed:16595710, PubMed:23288867). Catalyzes the glucuronidation of endogenous steroid hormones such as androgens and estrogens (PubMed:15472229, PubMed:16595710, PubMed:18719240, PubMed:23288867). Produces dihydrotestosterone (DHT) diglucuronide from the DHT after two subsequent glucoronidation steps (PubMed:16595710). Involved in the glucuronidation of the phytochemical ferulic acid at the phenolic or the carboxylic acid group (PubMed:21422672). Also catalyzes the glucuronidation of the isoflavones genistein, daidzein, glycitein, formononetin, biochanin A and prunetin, which are phytoestrogens with anticancer and cardiovascular properties (PubMed:18052087, PubMed:19545173). Involved in the glucuronidation of the AGTR1 angiotensin receptor antagonist caderastan, a drug which can inhibit the effect of angiotensin II (PubMed:18674515). Also metabolizes mycophenolate, an immunosuppressive agent (PubMed:15470161, PubMed:18004212).
  function: [Isoform 2]: Lacks UGT glucuronidation activity but acts as a negative regulator of isoform 1.
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
  catalytic activity: 17beta-estradiol + UDP-alpha-D-glucuronate = 17beta-estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52460)
  catalytic activity: 17alpha-estradiol + UDP-alpha-D-glucuronate = 17alpha- estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52868)
  catalytic activity: estrone + UDP-alpha-D-glucuronate = estrone 3-O-(beta-D- glucuronate) + UDP + H(+) (RHEA:52476)
  catalytic activity: 16alpha,17alpha-estriol + UDP-alpha-D-glucuronate = 16alpha,17alpha-estriol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52924)
  catalytic activity: 2-hydroxy-17beta-estradiol + UDP-alpha-D-glucuronate = 2- hydroxy-17beta-estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53004)
  catalytic activity: 2-hydroxy-17beta-estradiol + UDP-alpha-D-glucuronate = 17beta- estradiol 2-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53032)
  catalytic activity: 2-hydroxyestrone + UDP-alpha-D-glucuronate = 2-hydroxyestrone 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53048)
  catalytic activity: 4-hydroxy-17beta-estradiol + UDP-alpha-D-glucuronate = 4- hydroxy-17beta-estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53036)
  catalytic activity: 4-hydroxy-17beta-estradiol + UDP-alpha-D-glucuronate = 17beta- estradiol 4-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53040)
  catalytic activity: 4-hydroxyestrone + UDP-alpha-D-glucuronate = 4-hydroxyestrone 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53052)
  catalytic activity: 4-hydroxyestrone + UDP-alpha-D-glucuronate = estrone 4-O- (beta-D-glucuronate) + UDP + H(+) (RHEA:53060)
  catalytic activity: 2-methoxy-17beta-estradiol + UDP-alpha-D-glucuronate = 2- methoxy-17beta-estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53072)
  catalytic activity: 2-methoxyestrone + UDP-alpha-D-glucuronate = 2-methoxyestrone 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53064)
  catalytic activity: 4-methoxy-17beta-estradiol + UDP-alpha-D-glucuronate = 4- methoxy-17beta-estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53080)
  catalytic activity: 4-methoxyestrone + UDP-alpha-D-glucuronate = 4-methoxyestrone 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53068)
  catalytic activity: 17beta-hydroxy-5alpha-androstan-3-one + UDP-alpha-D- glucuronate = 5alpha-dihydrotestosterone 17-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53000)
  catalytic activity: 5alpha-dihydrotestosterone 17-O-(beta-D-glucuronate) + UDP- alpha-D-glucuronate = 5alpha-dihydrotestosterone 17-O-[beta-D- glucuronosyl-(1->2)-glucuronate] + UDP + H(+) (RHEA:53388)
  catalytic activity: prunetin + UDP-alpha-D-glucuronate = prunetin-4'-O-beta-D- glucuronide + UDP (RHEA:63588)
  catalytic activity: prunetin + UDP-alpha-D-glucuronate = prunetin-5-O-beta-D- glucuronide + UDP (RHEA:63612)
  catalytic activity: candesartan + UDP-alpha-D-glucuronate = candesartan O-beta-D- glucuronoside + UDP (RHEA:63724)
  catalytic activity: mycophenolate + UDP-alpha-D-glucuronate = mycophenolate 7-O- beta-D-glucuronide + UDP + H(+) (RHEA:63704)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-4-O-(beta-D- glucuronosyl)-ferulate + UDP + H(+) (RHEA:79951)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-ferulic acid beta-D-glucuronate ester + UDP (RHEA:79955)
  subunit: Homodimer (PubMed:17179145). Homooligomer (Probable). Interacts with UGT1A1, UGT1A3, UGT1A4, UGT1A6, UGT1A7, UGT1A9 and UGT1A10 to form heterodimers (PubMed:17179145). Isoform 1 interacts with isoform 2/i2 suggesting that oligomerization is involved in negative regulation of transferase activity by isoform 2. Isoform 1 also interacts with respective i2 isoforms of UGT1A1, UGT1A3, UGT1A4, UGT1A6, UGT1A7, UGT1A9 and UGT1A10 (PubMed:20610558).
• Cytochrome P450 3A gene family and medication in childhood nephrotic syndrome: An update.
  Kochuthakidiyel, Global medical genetics 2025
  • “...P450 3A5 Oxygen binding 2732228 Mycophenolate DB01024 UGT2B7 P16662 UDP-glucuronosyltransferase 2B7 Glucuronosyltransferase activity 10702251 UGT1A8 Q9HAW9 UDP-glucuronosyltransferase 18 Steroid binding 15472229 UGT1A9 O60656 UDP-glucuronosyltransferase 19 Retinoic acid binding 12181437 UGT1A1 P22309 UDP-glucuronosyltransferase 11 Steroid binding 12181437 UGT1A7 Q9HAW7 UDP-glucuronosyltransferase 17 Retinoic acid binding 12181437 UGT1A10 Q9HAW8...”
• Complete Reaction Phenotyping of Propranolol and 4-Hydroxypropranolol with the 19 Enzymes of the Human UGT1 and UGT2 Families.
  Yang, International journal of molecular sciences 2022
  • “...an input of the human UGT1A7, UGT1A8, UGT1A9, UGT1A10 and UGT2A1 sequence (UniProt, Identifiers: Q9HAW7, Q9HAW9, O60656, Q9HAW8 and P0DTE4), respectively. The crystal structure of sterol 3-beta-glucosyltransferase in complex with its cofactor UDP-glucose (PDB code: 5GL5 [ 45 ]) was chosen as the template, for all...”
• Interpreting the Molecular Mechanisms of Yinchenhao Decoction on Hepatocellular Carcinoma through Absorbed Components Based on Network Pharmacology
  Sun, BioMed research international 2021
  • “...P35503 Tar097 UGT1A6 UDP-glucuronosyltransferase 1-6 Q64435 Tar098 UGT1A7 UDP-glucuronosyltransferase 1A7 Q9HAW7 Tar099 UGT1A8 UDP-glucuronosyltransferase 1A8 Q9HAW9 Tar100 UGT1A9 UDP-glucuronosyltransferase 1A9 Q62452 Tar101 UGT2B15 UDP-glucuronosyltransferase 2B15 P54855 Tar102 UGT2B17 UDP-glucuronosyltransferase 2B17 O75795 Tar103 VCAM1 Vascular cell adhesion protein 1 P19320 Tar104 VEGFA Vascular endothelial growth factor A...”
• Proteome biology of primary colorectal carcinoma and corresponding liver metastases.
  Fahrner, Neoplasia (New York, N.Y.) 2021
  • “...0.645 1.79E-03 3.00E-02 TRA2A Transformer-2 protein homolog alpha Q3LXA3 0.784 1.64E-03 2.88E-02 TKFC Triokinase/FMN cyclase Q9HAW9 1.288 4.08E-05 2.57E-03 UGT1A8 UDP-glucuronosyltransferase 1A8 P02774 0.79 3.06E-05 2.02E-03 GC Vitamin D-binding protein P04004 0.76 2.59E-03 3.97E-02 VTN Vitronectin Significantly depleted proteins in liver metastases P62736 -1.065 6.90E-06 6.60E-04...”
• Exploring active ingredients and function mechanisms of Ephedra-bitter almond for prevention and treatment of Corona virus disease 2019 (COVID-19) based on network pharmacology
  Gao, BioData mining 2020
  • “...P05177 CYP1A2 113 P08581 MET 173 P14679 TYR 54 Q16678 CYP1B1 114 O43451 MGAM 174 Q9HAW9 UGT1A8 55 P08684 CYP3A4 115 P03956 MMP1 175 P19320 VCAM1 56 Q96PD7 DGAT2 116 P08253 MMP2 176 P15692 VEGFA 57 P27487 DPP4 117 P08254 MMP3 177 P47989 XDH 58 P21728...”
• Uncovering the mechanism of the effects of Paeoniae Radix Alba on iron-deficiency anaemia through a network pharmacology-based strategy
  Ye, BMC complementary medicine and therapies 2020
  • “...P08700 IL3 interleukin 3 None 67 P19320 VCAM1 vascular cell adhesion molecule 1 None 68 Q9HAW9 UGT1A8 UDP glucuronosyl transferase family 1member A8 None 69 P29474 NOS3 nitric oxide synthase 3 None 70 Q16790 CA9 carbonic anhydrase 9 None 71 P83111 LACTB lactamase beta None 72...”
• Molecular Insight into Stereoselective ADME Characteristics of C20-24 Epimeric Epoxides of Protopanaxadiol by Docking Analysis.
  Guo, Biomolecules 2020
  • “...cytochrome P450 (CYP) isoform 3A4 (PDB ID: 1W0F) and UDP-glucuronosyltransferase (UGT) isoform 1A8 (accession ID: Q9HAW9). According to the available results from both in vitro and in vivo experiments [ 14 , 17 , 18 ], the three target proteins are mainly involved in disposition of...”
  • “...sequence was retrieved as a target from the NCBI database with an accession number of Q9HAW9 and downloaded as a FAST ALL format file. Then BLAST (the program Basic Local Alignment Search Tool) was performed to find the best homologous sequence with known 3-D structure as...”
• Network Pharmacology Identifies the Mechanisms of Action of Shaoyao Gancao Decoction in the Treatment of Osteoarthritis
  Zhu, Medical science monitor : international medical journal of experimental and clinical research 2019
  • “...Drugbank Q9HAW8 UGT1A10 UDP-glucuronosyltransferase 1-10 Homo sapiens Drugbank P35503 UGT1A3 UDP-glucuronosyltransferase 1-3 Homo sapiens Drugbank Q9HAW9 UGT1A8 UDP-glucuronosyltransferase 1-8 Homo sapiens Drugbank O60656 UGT1A9 UDP-glucuronosyltransferase 1-9 Homo sapiens Drugbank P06133 UGT2B4 UDP-glucuronosyltransferase 2B4 Homo sapiens Drugbank P16662 UGT2B7 UDP-glucuronosyltransferase 2B7 Homo sapiens Drugbank P02768 ALB Serum...”
• More
• The function of uterine UDP-glucuronosyltransferase 1A8 (UGT1A8) and UDP-glucuronosyltransferase 2B7 (UGT2B7) is involved in endometrial cancer based on estrogen metabolism regulation.
  Zhao, Hormones (Athens, Greece) 2020 (PubMed)
  • GeneRIF: The function of uterine UDP-glucuronosyltransferase 1A8 (UGT1A8) and UDP-glucuronosyltransferase 2B7 (UGT2B7) is involved in endometrial cancer based on estrogen metabolism regulation.
• In Vitro Study on Influences of UGT1A8 Gene Polymorphisms on Mycophenolate Mofetil Metabolism.
  Zhou, Experimental and clinical transplantation : official journal of the Middle East Society for Organ Transplantation 2018 (PubMed)
  • GeneRIF: UGT1A8 gene polymorphisms can affect the activity of UDP glucuronosyltransferase enzyme, which may influence the elimination of mycophenolate mofetil in different patients.
• Cooperative Regulation of Intestinal UDP-Glucuronosyltransferases 1A8, -1A9, and 1A10 by CDX2 and HNF4α Is Mediated by a Novel Composite Regulatory Element.
  Mubarokah, Molecular pharmacology 2018 (PubMed)
  • GeneRIF: studies lead to a model for the developmental patterning of UGT1A8, UGT1A9, and UGT1A10 in hepatic and/or extrahepatic tissues involving discrete regulatory modules that may function (independently and cooperatively) in a context-dependent manner
• Common variants in glucuronidation enzymes and membrane transporters as potential risk factors for colorectal cancer: a case control study.
  Falkowski, BMC cancer 2017
  • GeneRIF: Polymorphism of UGT1A8 rs1042597-G variant allele is associated with colorectal cancer.
• Raloxifene glucuronidation in liver and intestinal microsomes of humans and monkeys: contribution of UGT1A1, UGT1A8 and UGT1A9.
  Kishi, Xenobiotica; the fate of foreign compounds in biological systems 2016 (PubMed)
  • GeneRIF: the in vitro glucuronidation of raloxifene in humans and monkeys was examined using liver and intestinal microsomes and recombinant UGT enzymes (UGT1A1, UGT1A8 and UGT1A9).
• Species- and gender-dependent differences in the glucuronidation of a flavonoid glucoside and its aglycone determined using expressed UGT enzymes and microsomes.
  Dai, Biopharmaceutics & drug disposition 2015 (PubMed)
  • GeneRIF: Data suggest UGT1A8 is involved in differential metabolism of dietary flavonoids (glucosides and aglycones); glucuronidation of flavonoid glucosides is considerably slower than glucuronidation of flavonoid aglycones in microsomes of intestine/liver.
• Characterization of raloxifene glucuronidation: potential role of UGT1A8 genotype on raloxifene metabolism in vivo.
  Sun, Cancer prevention research (Philadelphia, Pa.) 2013
  • GeneRIF: UGT1A8 Polymorphism is associated with response to raloxifene in breast cancer.
• Genetic polymorphisms of UGT1A8, UGT1A9, UGT2B7 and ABCC2 in Chinese renal transplant recipients and a comparison with other ethnic populations.
  Deng, Die Pharmazie 2013 (PubMed)
  • GeneRIF: A much higher frequency of UGT1A8*2 variant allele was found in Chinese than in Caucasians and Africans
• More

AAA51867.1 glucuronosyltransferase (UGT1;UGT1*6;UGT1-06;UGT1.6;UGT1A6) (EC 2.4.1.17) (see protein)
64% identity, 98% coverage

Q9TSM0 glucuronosyltransferase (EC 2.4.1.17) from Macaca fascicularis (see paper)
AAF15546.1 UDP-glucuronosyltransferase UGT1A09 (EC 2.4.1.17) (see protein)
64% identity, 97% coverage

UD19_HUMAN / O60656 UDP-glucuronosyltransferase 1A9; UGT1A9; UDP-glucuronosyltransferase 1-9; UDPGT 1-9; UGT1*9; UGT1-09; UGT1.9; UDP-glucuronosyltransferase 1-I; UGT-1I; UGT1I; lugP4; EC 2.4.1.17 from Homo sapiens (Human) (see 14 papers)
O60656 glucuronosyltransferase (EC 2.4.1.17) from Homo sapiens (see 37 papers)
AAC31425.1 UDP-GlcA: glucuronosyltransferase 1A9 (Ugt1a9) (EC 2.4.1.17) (see protein)
NP_066307 UDP-glucuronosyltransferase 1A9 precursor from Homo sapiens
63% identity, 96% coverage

• function: [Isoform 1]: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile (PubMed:12181437, PubMed:15470161, PubMed:15472229, PubMed:18004212, PubMed:18052087, PubMed:18674515, PubMed:19545173, PubMed:15231852, PubMed:21422672, PubMed:38211441). Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds (PubMed:12181437, PubMed:18004212). Catalyzes the glucuronidation of endogenous estrogen hormones such as estradiol and estrone (PubMed:15472229). Involved in the glucuronidation of arachidonic acid (AA) and AA-derived eicosanoids including 15-HETE, PGB1 and F2-isoprostanes (8-iso-PGF2alpha and 5-epi-5-F2t-IsoP) (PubMed:15231852, PubMed:38211441). Glucuronates the phytochemical ferulic acid efficently at both the phenolic or the carboxylic acid group (PubMed:21422672). Also catalyzes the glucuronidation of the isoflavones genistein, daidzein, glycitein, formononetin, biochanin A and prunetin, which are phytoestrogens with anticancer and cardiovascular properties (PubMed:18052087, PubMed:19545173). Involved in the glucuronidation of the AGTR1 angiotensin receptor antagonist caderastan, a drug which can inhibit the effect of angiotensin II (PubMed:18674515). Involved in the biotransformation of 7-ethyl-10- hydroxycamptothecin (SN-38), the pharmacologically active metabolite of the anticancer drug irinotecan (PubMed:12181437, PubMed:20610558). Also metabolizes mycophenolate, an immunosuppressive agent (PubMed:15470161, PubMed:18004212).
  function: [Isoform 2]: Lacks UGT glucuronidation activity but acts as a negative regulator of isoform 1.
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
  catalytic activity: 2-hydroxy-17beta-estradiol + UDP-alpha-D-glucuronate = 2- hydroxy-17beta-estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53004)
  catalytic activity: 4-hydroxy-17beta-estradiol + UDP-alpha-D-glucuronate = 17beta- estradiol 4-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53040)
  catalytic activity: 2-hydroxyestrone + UDP-alpha-D-glucuronate = 2-hydroxyestrone 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53048)
  catalytic activity: 4-hydroxyestrone + UDP-alpha-D-glucuronate = estrone 4-O- (beta-D-glucuronate) + UDP + H(+) (RHEA:53060)
  catalytic activity: prunetin + UDP-alpha-D-glucuronate = prunetin-5-O-beta-D- glucuronide + UDP (RHEA:63612)
  catalytic activity: 8-iso-prostaglandin F2alpha + UDP-alpha-D-glucuronate = 8-iso- prostaglandin F2alpha-glucuronide + UDP + H(+) (RHEA:79907)
  catalytic activity: 5-epi-5-F2t-IsoP + UDP-alpha-D-glucuronate = 5-epi-5-F2t-IsoP- glucuronide + UDP + H(+) (RHEA:79911)
  catalytic activity: (5Z,8Z,11Z,14Z)-eicosatetraenoate + UDP-alpha-D-glucuronate = O-[(5Z),(8Z),(11Z),(14Z)-eicosatetraenoyl]-beta-D-glucuronate + UDP (RHEA:79915)
  catalytic activity: 15-hydroxy-(5Z,8Z,11Z,13E)-eicosatetraenoate + UDP-alpha-D- glucuronate = 15-O-(beta-D-glucuronosyl)-(5Z,8Z,11Z,14Z)- eicosatetraenoate + UDP + H(+) (RHEA:79919)
  catalytic activity: prostaglandin B1 + UDP-alpha-D-glucuronate = 15-O-(beta-D- glucuronosyl)-prostaglandin B1 + UDP + H(+) (RHEA:79935)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-4-O-(beta-D- glucuronosyl)-ferulate + UDP + H(+) (RHEA:79951)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-ferulic acid beta-D-glucuronate ester + UDP (RHEA:79955)
  catalytic activity: candesartan + UDP-alpha-D-glucuronate = candesartan O-beta-D- glucuronoside + UDP (RHEA:63724)
  catalytic activity: SN-38 + UDP-alpha-D-glucuronate = SN-38 O-beta-D-glucuronide + UDP + H(+) (RHEA:63696)
  catalytic activity: mycophenolate + UDP-alpha-D-glucuronate = mycophenolate 7-O- beta-D-glucuronide + UDP + H(+) (RHEA:63704)
  subunit: Homodimer (PubMed:17179145). Homooligomer (Probable). Interacts with UGT1A1, UGT1A3, UGT1A4, UGT1A6, UGT1A7, UGT1A8 and UGT1A10 to form heterodimers (PubMed:17179145). Isoform 1 interacts with isoform 2/i2 suggesting that oligomerization is involved in negative regulation of transferase activity by isoform 2. Isoform 1 also interacts with respective i2 isoforms of UGT1A1, UGT1A3, UGT1A4, UGT1A6, UGT1A7, UGT1A8 and UGT1A10 (PubMed:20610558).
• Cytochrome P450 2B6 and UDP-Glucuronosyltransferase Enzyme-Mediated Clearance of Ciprofol (HSK3486) in Humans: The Role of Hepatic and Extrahepatic Metabolism.
  Zhou, Drug metabolism and disposition: the biological fate of chemicals 2024 (PubMed)
  • GeneRIF: Cytochrome P450 2B6 and UDP-Glucuronosyltransferase Enzyme-Mediated Clearance of Ciprofol (HSK3486) in Humans: The Role of Hepatic and Extrahepatic Metabolism.
• Significance of UGT1A6, UGT1A9, and UGT2B7 genetic variants and their mRNA expression in the clinical outcome of renal cell carcinoma.
  Matsumoto, Molecular and cellular biochemistry 2023 (PubMed)
  • GeneRIF: Significance of UGT1A6, UGT1A9, and UGT2B7 genetic variants and their mRNA expression in the clinical outcome of renal cell carcinoma.
• UGT1A1 and UGT1A9 Are Responsible for Phase II Metabolism of Tectorigenin and Irigenin In Vitro.
  Li, Molecules (Basel, Switzerland) 2022
  • GeneRIF: UGT1A1 and UGT1A9 Are Responsible for Phase II Metabolism of Tectorigenin and Irigenin In Vitro.
• Genetic variants in CYP2A6 and UGT1A9 genes associated with urinary nicotine metabolites in young Mexican smokers.
  Borrego-Soto, The pharmacogenomics journal 2020
  • GeneRIF: Genetic variants in CYP2A6 and UGT1A9 genes associated with urinary nicotine metabolites in young Mexican smokers.
• Worsening of Kidney Transplant Function During 2-Year Follow-up Is Associated With the Genetic Variants of CYP3A4, MDR1, and UGT1A9.
  Hryniewiecka, Transplantation proceedings 2020 (PubMed)
  • GeneRIF: Worsening of Kidney Transplant Function During 2-Year Follow-up Is Associated With the Genetic Variants of CYP3A4, MDR1, and UGT1A9.
• Intestinal UDP-glucuronosyltransferase as a potential target for the treatment and prevention of lymphatic filariasis
  Flynn, PLoS neglected tropical diseases 2019
  • “...against the Bm-UGT peptide sequence. The following are the orthologs selected for analyses: Homo sapiens (NP_066307), Canis lupus familiaris (XP_005635657), and Felis catus (BAA2492). Structural analysis of Bm-UGT The Bm-UGT sequence was initially analyzed for properties including signal peptide sequence, and potential transmembrane sequence using InterPro,...”
• Epigenetic regulation of UDP-Glucuronosyltransferase by microRNA-200a/-183: implications for responses to sorafenib treatment in patients with hepatocellular carcinoma.
  Ge, Cancer letters 2019 (PubMed)
  • GeneRIF: Direct binding was further demonstrated by luciferase reporter gene vector carrying wild-type or binding site truncated UGT1A9 3'-UTR. MicroRNA-200a/-183 downregulated UGT1A9 expression in a dose-dependent manner and significantly reduced sorafenib beta-D-glucuronide formation in HCC cells.
• Novel analytical methods to interpret large sequencing data from small sample sizes.
  Lichou, Human genomics 2019
  • GeneRIF: Using a graphical representation, from 708 identified polymorphisms, a reduced list of 115 candidates was obtained. Then, by analyzing each gene and the distribution of variant alleles, several candidates were highlighted such as UGT1A9, PTPN22, and ERCC5. These genes were already associated with the transport, the metabolism, and even the sensitivity to imatinib in previous studies.
• More
• Cytochrome P450 3A gene family and medication in childhood nephrotic syndrome: An update.
  Kochuthakidiyel, Global medical genetics 2025
  • “...UGT2B7 P16662 UDP-glucuronosyltransferase 2B7 Glucuronosyltransferase activity 10702251 UGT1A8 Q9HAW9 UDP-glucuronosyltransferase 18 Steroid binding 15472229 UGT1A9 O60656 UDP-glucuronosyltransferase 19 Retinoic acid binding 12181437 UGT1A1 P22309 UDP-glucuronosyltransferase 11 Steroid binding 12181437 UGT1A7 Q9HAW7 UDP-glucuronosyltransferase 17 Retinoic acid binding 12181437 UGT1A10 Q9HAW8 UDP-glucuronosyltransferase 110 Protein kinase c binding 15258099...”
• Bioinformatic characterization of ENPEP, the gene encoding a potential cofactor for SARS-CoV-2 infection.
  Arppo, PloS one 2024
  • “...cysteine protease Kidney cortex UGT2A3 0.8434 28528 Q6UWM9 UDP-glucuronosyltransferase 2A3 Kidney cortex UGT1A9 0.8335 12541 O60656 UDP-glucuronosyltransferase 1A9 glycosyltransferase Kidney cortex ANPEP 0.8259 500 P15144 Aminopeptidase N metalloprotease Kidney cortex SLC4A4 0.8179 11030 Q9Y6R1 Electrogenic sodium bicarbonate cotransporter 1 secondary carrier transporter Kidney cortex TCN2 0.8102...”
• Cuproptosis gene-related, neural network-based prognosis prediction and drug-target prediction for KIRC.
  Liu, Cancer medicine 2024
  • “...2D6 DB06486 Enzastaurin P10635 Cytochrome P450 2D6 DB08073 A443654 P10635 Cytochrome P450 2D6 DB00307 Bexarotene O60656 UDPglucuronosyltransferase 1A9 DB06486 Enzastaurin O60656 UDPglucuronosyltransferase 1A9 DB08073 A443654 O60656 UDPglucuronosyltransferase 1A9 DB00307 Bexarotene P07949 Protooncogene tyrosineprotein kinase receptor Ret DB08073 A443654 P07949 Protooncogene tyrosineprotein kinase receptor Ret DB06486 Enzastaurin...”
• KNIME workflow for retrieving causal drug and protein interactions, building networks, and performing topological enrichment analysis demonstrated by a DILI case study.
  Füzi, Journal of cheminformatics 2022
  • “...often downregulated by the mostDILI than the noDILI group Uniprot_ID Gene_name Significance_score P23219 PTGS1 16.0 O60656 UGT1A9 14.0 O94956 SLCO2B1 11.0 Q92887 ABCC2 9.0 P11509 CYP2A6 9.0 P22309 UGT1A1 7.5 Q9Y694 SLC22A7 7.0 P05177 CYP1A2 6.0 Q9NPD5 SLCO1B3 6.0 Q9Y6L6 SLCO1B1 6.0 P11712 CYP2C9 5.8 P02763...”
  • “...Table 7 Example of a causal network output row target_uniprot_id typeA Interactor_uniprot_id typeB Effect moi O60656 protein P20823 protein up-regulates quantity by expression 1 Table 8 Upregulated proteins by the downregulated proteins significantly connected to the mostDILI group target_uniprot_id Interactor_uniprot_id O60656 P20823 P22309 P35869 P22309 P20823...”
• Complete Reaction Phenotyping of Propranolol and 4-Hydroxypropranolol with the 19 Enzymes of the Human UGT1 and UGT2 Families.
  Yang, International journal of molecular sciences 2022
  • “...input of the human UGT1A7, UGT1A8, UGT1A9, UGT1A10 and UGT2A1 sequence (UniProt, Identifiers: Q9HAW7, Q9HAW9, O60656, Q9HAW8 and P0DTE4), respectively. The crystal structure of sterol 3-beta-glucosyltransferase in complex with its cofactor UDP-glucose (PDB code: 5GL5 [ 45 ]) was chosen as the template, for all the...”
• Uncovering the mechanism of the effects of Paeoniae Radix Alba on iron-deficiency anaemia through a network pharmacology-based strategy
  Ye, BMC complementary medicine and therapies 2020
  • “...topoisomerase II alpha None 55 P35503 UGT1A3 UDP glucuronosyltransferase family 1 member A3 None 56 O60656 UGT1A9 UDP glucuronosyltransferase family 1 member A9 None 57 P04035 HMGCR 3-hydroxy-3-methylglutaryl -CoA reductase None 58 P10636 MAPT microtubule associated protein tau None 59 P26358 DNMT1 DNA methyltransferase 1 None...”
• Identification of HO-1 as a novel biomarker for graft acute cellular rejection and prognosis prediction after liver transplantation
  Jia, Annals of translational medicine 2020
  • “...O43175 D-3-phosphoglycerate dehydrogenase PHGDH 0.604 Q15493 Regucalcin RGN 0.604 Q6NVY1 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial HIBCH 0.605 O60656 UDP-glucuronosyltransferase 1-9 UGT1A9 0.607 P49326 Dimethylaniline monooxygenase [N-oxide-forming] 5 FMO5 0.609 Q7Z4W1 L-xylulose reductase DCXR 0.609 Q14353 Guanidinoacetate N-methyltransferase GAMT 0.615 P08684 Cytochrome P450 3A4 CYP3A4 0.619 Q02252 Methylmalonate-semialdehyde dehydrogenase...”
• Network Pharmacology Identifies the Mechanisms of Action of Shaoyao Gancao Decoction in the Treatment of Osteoarthritis
  Zhu, Medical science monitor : international medical journal of experimental and clinical research 2019
  • “...Drugbank P35503 UGT1A3 UDP-glucuronosyltransferase 1-3 Homo sapiens Drugbank Q9HAW9 UGT1A8 UDP-glucuronosyltransferase 1-8 Homo sapiens Drugbank O60656 UGT1A9 UDP-glucuronosyltransferase 1-9 Homo sapiens Drugbank P06133 UGT2B4 UDP-glucuronosyltransferase 2B4 Homo sapiens Drugbank P16662 UGT2B7 UDP-glucuronosyltransferase 2B7 Homo sapiens Drugbank P02768 ALB Serum albumin Homo sapiens Drugbank, Genecards P23219 PTGS1...”
• More

AAB84259.1 Glucuronosyltransferase 1A8 (Ugt1a8) (EC 2.4.1.17) (see protein)
62% identity, 100% coverage

UD110_HUMAN / Q9HAW8 UDP-glucuronosyltransferase 1A10; UGT1A10; UDP-glucuronosyltransferase 1-10; UDPGT 1-10; UGT1*10; UGT1-10; UGT1.10; UDP-glucuronosyltransferase 1-J; UGT-1J; UGT1J; EC 2.4.1.17 from Homo sapiens (Human) (see 14 papers)
Q9HAW8 glucuronosyltransferase (EC 2.4.1.17) from Homo sapiens (see 18 papers)
NP_061948 UDP-glucuronosyltransferase 1A10 precursor from Homo sapiens
63% identity, 100% coverage

• function: [Isoform 1]: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile (PubMed:12181437, PubMed:18004212, PubMed:18052087, PubMed:18674515, PubMed:18719240, PubMed:19545173, PubMed:23288867, PubMed:26220143, PubMed:15231852, PubMed:21422672). Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds (PubMed:12181437, PubMed:18004212). Catalyzes the glucuronidation of endogenous estrogen hormones such as estradiol, estrone and estriol (PubMed:18719240, PubMed:23288867, PubMed:26220143). Involved in the glucuronidation of arachidonic acid (AA) and AA-derived eicosanoids including 15-HETE and PGB1 (PubMed:15231852). Involved in the glucuronidation of the phytochemical ferulic acid at the phenolic or the carboxylic acid group (PubMed:21422672). Also catalyzes the glucuronidation of the isoflavones genistein, daidzein, glycitein, formononetin, biochanin A and prunetin, which are phytoestrogens with anticancer and cardiovascular properties (PubMed:18052087, PubMed:19545173). Involved in the glucuronidation of the AGTR1 angiotensin receptor antagonist losartan, caderastan and zolarsatan, drugs which can inhibit the effect of angiotensin II (PubMed:18674515).
  function: [Isoform 2]: Lacks UGT glucuronidation activity but acts as a negative regulator of isoform 1.
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
  catalytic activity: 17beta-estradiol + UDP-alpha-D-glucuronate = 17beta-estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52460)
  catalytic activity: 17beta-estradiol + UDP-alpha-D-glucuronate = 17beta-estradiol 17-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52464)
  catalytic activity: 17alpha-estradiol + UDP-alpha-D-glucuronate = 17alpha- estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52868)
  catalytic activity: 16alpha,17beta-estriol + UDP-alpha-D-glucuronate = 16alpha,17beta-estriol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52468)
  catalytic activity: 16beta,17beta-estriol + UDP-alpha-D-glucuronate = 16beta,17beta-estriol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52876)
  catalytic activity: 16alpha,17alpha-estriol + UDP-alpha-D-glucuronate = 16alpha,17alpha-estriol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52924)
  catalytic activity: 16alpha-hydroxyestrone + UDP-alpha-D-glucuronate = 16alpha- hydroxyestrone 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52448)
  catalytic activity: estrone + UDP-alpha-D-glucuronate = estrone 3-O-(beta-D- glucuronate) + UDP + H(+) (RHEA:52476)
  catalytic activity: prunetin + UDP-alpha-D-glucuronate = prunetin-4'-O-beta-D- glucuronide + UDP (RHEA:63588)
  catalytic activity: (5Z,8Z,11Z,14Z)-eicosatetraenoate + UDP-alpha-D-glucuronate = O-[(5Z),(8Z),(11Z),(14Z)-eicosatetraenoyl]-beta-D-glucuronate + UDP (RHEA:79915)
  catalytic activity: 15-hydroxy-(5Z,8Z,11Z,13E)-eicosatetraenoate + UDP-alpha-D- glucuronate = 15-O-(beta-D-glucuronosyl)-(5Z,8Z,11Z,14Z)- eicosatetraenoate + UDP + H(+) (RHEA:79919)
  catalytic activity: prostaglandin B1 + UDP-alpha-D-glucuronate = 15-O-(beta-D- glucuronosyl)-prostaglandin B1 + UDP + H(+) (RHEA:79935)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-4-O-(beta-D- glucuronosyl)-ferulate + UDP + H(+) (RHEA:79951)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-ferulic acid beta-D-glucuronate ester + UDP (RHEA:79955)
  catalytic activity: losartan + UDP-alpha-D-glucuronate = losartan-2-N-beta-D- glucuronide + UDP (RHEA:63720)
  catalytic activity: candesartan + UDP-alpha-D-glucuronate = candesartan O-beta-D- glucuronoside + UDP (RHEA:63724)
  catalytic activity: candesartan + UDP-alpha-D-glucuronate = candesartan-2-N-beta- D-glucuronide + UDP (RHEA:63728)
  catalytic activity: zolasartan + UDP-alpha-D-glucuronate = zolarsartan-1-N-beta-D- glucuronide + UDP (RHEA:63744)
  subunit: Homodimer (PubMed:17179145). Homooligomer (Probable). Interacts with UGT1A1, UGT1A3, UGT1A4, UGT1A6, UGT1A7, UGT1A8 and UGT1A9 to form heterodimers (PubMed:17179145). Isoform 1 interacts with isoform 2/i2 suggesting that oligomerization is involved in negative regulation of transferase activity by isoform 2. Isoform 1 also interacts with respective i2 isoforms of UGT1A1, UGT1A3, UGT1A4, UGT1A6, UGT1A7, UGT1A8 and UGT1A9 (PubMed:20610558).
• Cooperative Regulation of Intestinal UDP-Glucuronosyltransferases 1A8, -1A9, and 1A10 by CDX2 and HNF4α Is Mediated by a Novel Composite Regulatory Element.
  Mubarokah, Molecular pharmacology 2018 (PubMed)
  • GeneRIF: studies lead to a model for the developmental patterning of UGT1A8, UGT1A9, and UGT1A10 in hepatic and/or extrahepatic tissues involving discrete regulatory modules that may function (independently and cooperatively) in a context-dependent manner
• Differences in the glucuronidation of bisphenols F and S between two homologous human UGT enzymes, 1A9 and 1A10.
  Gramec, Xenobiotica; the fate of foreign compounds in biological systems 2015 (PubMed)
  • GeneRIF: UGT1A10 exhibited somewhat higher BPA glucuronidation activity than UGT1A9, but it was lower than UGT2A1 and UGT2B15. 4.
• Glucuronidation of estrone and 16α-hydroxyestrone by human UGT enzymes: The key roles of UGT1A10 and UGT2B7.
  Kallionpää, The Journal of steroid biochemistry and molecular biology 2015 (PubMed)
  • GeneRIF: In further studies with UGT1A10, mutant F93G exhibited increased glucuronidation rates of 16alpha-hydroxyestrone, but not estrone
• Epigenetic regulation of the tissue-specific expression of human UDP-glucuronosyltransferase (UGT) 1A10.
  Oda, Biochemical pharmacology 2014 (PubMed)
  • GeneRIF: DNA hypermethylation results in defective expression of UGT1A10 in the liver.
• Electrochemically driven drug metabolism via a CYP1A2-UGT1A10 bienzyme confined in a graphene nano-cage.
  Lu, Chemical communications (Cambridge, England) 2014 (PubMed)
  • GeneRIF: A graphene nanocage with regulatable space for the assembly of a CYP1A2-UGT1A10 bienzyme complex has been constructed via a click reaction, and used to study drug sequential metabolism using an electrochemically-driven method.
• Metabolic transformation of antitumor acridinone C-1305 but not C-1311 via selective cellular expression of UGT1A10 increases cytotoxic response: implications for clinical use.
  Pawlowska, Drug metabolism and disposition: the biological fate of chemicals 2013
  • GeneRIF: Suggest that extrahepatic UGT1A10 plays an important role in the metabolism and the bioactivation of the antitumor agent C-1305.
• Identification of UDP-glucuronosyltransferases responsible for the glucuronidation of darexaban, an oral factor Xa inhibitor, in human liver and intestine.
  Shiraga, Drug metabolism and disposition: the biological fate of chemicals 2012 (PubMed)
  • GeneRIF: Data suggest that darexaban glucuronidation in jejunum microsomes is mainly catalyzed by UGT1A10; studies include kinetics of recombinant UGT proteins, liver microsomes, and jejunal microsomes (and UGT isoform-specific inhibitors/substrates).
• Role of human UDP-glucuronosyltransferases in the biotransformation of the triazoloacridinone and imidazoacridinone antitumor agents C-1305 and C-1311: highly selective substrates for UGT1A10.
  Fedejko-Kap, Drug metabolism and disposition: the biological fate of chemicals 2012
  • GeneRIF: Triazoloacridinone and imidazoacridinone antitumor agents C-1305 and C-1311 are glucuronidated in human liver and intestine.
• More
• Cytochrome P450 3A gene family and medication in childhood nephrotic syndrome: An update.
  Kochuthakidiyel, Global medical genetics 2025
  • “...P22309 UDP-glucuronosyltransferase 11 Steroid binding 12181437 UGT1A7 Q9HAW7 UDP-glucuronosyltransferase 17 Retinoic acid binding 12181437 UGT1A10 Q9HAW8 UDP-glucuronosyltransferase 110 Protein kinase c binding 15258099 CYP3A4 P08684 Cytochrome P450 3A4 Vitamin d3 25-hydroxylase activity 10681376 CYP3A5 P20815 Cytochrome P450 3A5 Oxygen binding 2732228 CYP2C8 CYP2C8 Cytochrome P450 2C8...”
  • “...P22309 UDP-glucuronosyltransferase 11 Steroid binding 12181437 UGT1A3 P35503 UDP-glucuronosyltransferase 13 Retinoic acid binding 15472229 UGT1A10 Q9HAW8 UDP-glucuronosyltransferase 110 Protein kinase c binding 15258099 UGT2B7 P16662 UDP-glucuronosyltransferase 2B7 Glucuronosyltransferase activity 10702251 UGT2B17 O75795 UDP-glucuronosyltransferase 2B17 Glucuronosyltransferase activity 8798464 CYP2C8 P10632 Cytochrome P450 2C8 Steroid hydroxylase activity 7574697...”
• Complete Reaction Phenotyping of Propranolol and 4-Hydroxypropranolol with the 19 Enzymes of the Human UGT1 and UGT2 Families.
  Yang, International journal of molecular sciences 2022
  • “...of the human UGT1A7, UGT1A8, UGT1A9, UGT1A10 and UGT2A1 sequence (UniProt, Identifiers: Q9HAW7, Q9HAW9, O60656, Q9HAW8 and P0DTE4), respectively. The crystal structure of sterol 3-beta-glucosyltransferase in complex with its cofactor UDP-glucose (PDB code: 5GL5 [ 45 ]) was chosen as the template, for all the homology...”
• Interpreting the Molecular Mechanisms of Yinchenhao Decoction on Hepatocellular Carcinoma through Absorbed Components Based on Network Pharmacology
  Sun, BioMed research international 2021
  • “...brown fat uncoupling protein 1 P25874 Tar094 UGT1A1 UDP-glucuronosyltransferase 1A1 P22309 Tar095 UGT1A10 UDP-glucuronosyltransferase 1A10 Q9HAW8 Tar096 UGT1A3 UDP-glucuronosyltransferase 1A3 P35503 Tar097 UGT1A6 UDP-glucuronosyltransferase 1-6 Q64435 Tar098 UGT1A7 UDP-glucuronosyltransferase 1A7 Q9HAW7 Tar099 UGT1A8 UDP-glucuronosyltransferase 1A8 Q9HAW9 Tar100 UGT1A9 UDP-glucuronosyltransferase 1A9 Q62452 Tar101 UGT2B15 UDP-glucuronosyltransferase 2B15 P54855...”
• Network Pharmacology Identifies the Mechanisms of Action of Shaoyao Gancao Decoction in the Treatment of Osteoarthritis
  Zhu, Medical science monitor : international medical journal of experimental and clinical research 2019
  • “...Drugbank P48775 TDO2 Tryptophan 2,3-dioxygenase Homo sapiens Drugbank P22309 UGT1A1 UDP-glucuronosyltransferase 1-1 Homo sapiens Drugbank Q9HAW8 UGT1A10 UDP-glucuronosyltransferase 1-10 Homo sapiens Drugbank P35503 UGT1A3 UDP-glucuronosyltransferase 1-3 Homo sapiens Drugbank Q9HAW9 UGT1A8 UDP-glucuronosyltransferase 1-8 Homo sapiens Drugbank O60656 UGT1A9 UDP-glucuronosyltransferase 1-9 Homo sapiens Drugbank P06133 UGT2B4 UDP-glucuronosyltransferase...”
• Molecular Docking-Based Design and Development of a Highly Selective Probe Substrate for UDP-glucuronosyltransferase 1A10.
  Juvonen, Molecular pharmaceutics 2018
  • “...UniProt Knowledgebase at www.uniprot.org (UniProt Consortium, 2015). The accession codes for the retrieved UGT1As were: Q9HAW8 (1A10), O60656 (1A9), Q9HAW9 (1A8), Q9HAW7 (1A7), P19224 (1A6), P35504 (1A5), P22310 (1A4), P35503 (1A3), and P22039 (1A1). To identify template protein structures for homology modeling purposes, the retrieved UGT...”
• Sorbitol dehydrogenase overexpression and other aspects of dysregulated protein expression in human precancerous colorectal neoplasms: a quantitative proteomics study.
  Uzozie, Molecular & cellular proteomics : MCP 2014

Q20CK9 glucuronosyltransferase (EC 2.4.1.17) from Papio anubis (see paper)
64% identity, 97% coverage

XP_013840053 UDP glucuronosyltransferase 1 family, polypeptide A6 isoform X3 from Sus scrofa
64% identity, 97% coverage

• Molecular cloning and functional analysis of minipig UDP-glucuronosyltransferase 1A6.
  Miyake, Xenobiotica; the fate of foreign compounds in biological systems 2016 (PubMed)
  • GeneRIF: Minipig UGT1A6 was cloned and compared to human UGT1A6. The results suggest that the enzymatic properties of UGT1A6 enzymes are moderately different between humans and minipigs.

NP_001336952 UDP glucuronosyltransferase 1 family, polypeptide A8 precursor from Macaca fascicularis
63% identity, 99% coverage

• Raloxifene glucuronidation in liver and intestinal microsomes of humans and monkeys: contribution of UGT1A1, UGT1A8 and UGT1A9.
  Kishi, Xenobiotica; the fate of foreign compounds in biological systems 2016 (PubMed)
  • GeneRIF: the in vitro glucuronidation of raloxifene in humans and monkeys was examined using liver and intestinal microsomes and recombinant UGT enzymes (UGT1A1, UGT1A8 and UGT1A9).

AAF15548.1 UDP-glucuronosyltransferase UGT1A08 (EC 2.4.1.17) (see protein)
63% identity, 99% coverage

AAB81537.1 glucuronosyltransferase 1A10 (Ugt1a10) (EC 2.4.1.17) (see protein)
64% identity, 96% coverage

Q20CK6 glucuronosyltransferase (EC 2.4.1.17) from Papio anubis (see paper)
64% identity, 96% coverage

Q20CK7 glucuronosyltransferase (EC 2.4.1.17) from Papio anubis (see paper)
63% identity, 99% coverage

Q20CL0 glucuronosyltransferase (EC 2.4.1.17) from Papio anubis (see paper)
64% identity, 96% coverage

AAB65795.1 glucuronosyltransferase (UGT1A7) (EC 2.4.1.17) (see protein)
64% identity, 96% coverage

UD17_HUMAN / Q9HAW7 UDP-glucuronosyltransferase 1A7; UGT1A7; UDP-glucuronosyltransferase 1-7; UDPGT 1-7; UGT1*7; UGT1-07; UGT1.7; UDP-glucuronosyltransferase 1-G; UGT-1G; UGT1G; EC 2.4.1.17 from Homo sapiens (Human) (see 13 papers)
Q9HAW7 glucuronosyltransferase (EC 2.4.1.17) from Homo sapiens (see 20 papers)
NP_061950 UDP-glucuronosyltransferase 1A7 precursor from Homo sapiens
63% identity, 96% coverage

• function: [Isoform 1]: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile (PubMed:12181437, PubMed:15470161, PubMed:18004212, PubMed:18052087, PubMed:18674515, PubMed:18719240, PubMed:20610558, PubMed:23360619, PubMed:21422672, PubMed:38211441). Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds (PubMed:12181437, PubMed:18004212). Catalyzes the glucuronidation of endogenous estrogen hormone epiestradiol (PubMed:18719240). Involved in the glucuronidation of F2-isoprostane (5-epi-5-F2t-IsoP) (PubMed:38211441). Involved in the glucuronidation of the phytochemical ferulic acid at the carboxylic acid group (PubMed:21422672). Also catalyzes the glucuronidation of the isoflavones genistein, daidzein, glycitein, formononetin, biochanin A and prunetin, which are phytoestrogens with anticancer and cardiovascular properties (PubMed:18052087). Involved in the glucuronidation of the AGTR1 angiotensin receptor antagonist caderastan, a drug which can inhibit the effect of angiotensin II (PubMed:18674515). Involved in the biotransformation of 7-ethyl-10- hydroxycamptothecin (SN-38), the pharmacologically active metabolite of the anticancer drug irinotecan (PubMed:12181437, PubMed:18004212, PubMed:20610558, PubMed:23360619). Also metabolizes mycophenolate, an immunosuppressive agent (PubMed:15470161).
  function: [Isoform 2]: Lacks UGT glucuronidation activity but acts as a negative regulator of isoform 1.
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
  catalytic activity: 17alpha-estradiol + UDP-alpha-D-glucuronate = 17alpha- estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52868)
  catalytic activity: prunetin + UDP-alpha-D-glucuronate = prunetin-5-O-beta-D- glucuronide + UDP (RHEA:63612)
  catalytic activity: 5-epi-5-F2t-IsoP + UDP-alpha-D-glucuronate = 5-epi-5-F2t-IsoP- glucuronide + UDP + H(+) (RHEA:79911)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-ferulic acid beta-D-glucuronate ester + UDP (RHEA:79955)
  catalytic activity: candesartan + UDP-alpha-D-glucuronate = candesartan O-beta-D- glucuronoside + UDP (RHEA:63724)
  catalytic activity: SN-38 + UDP-alpha-D-glucuronate = SN-38 O-beta-D-glucuronide + UDP + H(+) (RHEA:63696)
  catalytic activity: mycophenolate + UDP-alpha-D-glucuronate = mycophenolate 7-O- beta-D-glucuronide + UDP + H(+) (RHEA:63704)
  subunit: Homodimer (PubMed:17179145). Homooligomer (Probable). Interacts with UGT1A1, UGT1A3, UGT1A4, UGT1A6, UGT1A8, UGT1A9 and UGT1A10 to form heterodimers (PubMed:17179145). Isoform 1 interacts with isoform 2/i2 suggesting that oligomerization is involved in negative regulation of transferase activity by isoform 2. Isoform 1 also interacts with respective i2 isoforms of UGT1A1, UGT1A3, UGT1A4, UGT1A6, UGT1A8, UGT1A9 and UGT1A10 (PubMed:20610558).
• [Gene mutation pattern of Gilbert's syndrome combined with viral hepatitis and its relationship with the exploration of clinical data].
  Ning, Zhonghua gan zang bing za zhi = Zhonghua ganzangbing zazhi = Chinese journal of hepatology 2020 (PubMed)
  • GeneRIF: [Gene mutation pattern of Gilbert's syndrome combined with viral hepatitis and its relationship with the exploration of clinical data].
• Interethnic Variations of UGT1A1 and UGT1A7 Polymorphisms in the Jordanian Population.
  Abudahab, Current drug metabolism 2019 (PubMed)
  • GeneRIF: We found that Circassians and Chechens have significantly higher allele frequencies of UGT1A7*2, UGT1A7*3 and UGT1A7*4 than the Jordanian-Arab population, but all three populations have similar frequencies of UGT1A1*28. Therefore, Circassians and Chechens are expected to have significantly lower levels of the UGT1A7 enzyme with almost 90% of these populations having genes that encode low or intermediate enzyme activity.
• Genetic polymorphisms in UDP-glucuronosyltransferase 1A6 and 1A7 and the risk for benign Warthin's tumors of the parotid gland.
  Lacko, Head & neck 2016 (PubMed)
  • GeneRIF: high activity UGT1A7 genotype is associated with an increased risk for Warthin's tumor.
• Increased UGT1A3 and UGT1A7 expression is associated with pancreatic cancer.
  Yilmaz, Asian Pacific journal of cancer prevention : APJCP 2015 (PubMed)
  • GeneRIF: Increased UGT1A7 expression is associated with pancreatic cancer.
• Alteration of the function of the UDP-glucuronosyltransferase 1A subfamily by cytochrome P450 3A4: different susceptibility for UGT isoforms and UGT1A1/7 variants.
  Ishii, Drug metabolism and disposition: the biological fate of chemicals 2014 (PubMed)
  • GeneRIF: Results suggest that CYP3A4 changes the catalytic function of the UGT1A subfamily in a UGT isoform-specific manner.
• Differences in UGT1A1, UGT1A7, and UGT1A9 polymorphisms between Uzbek and Japanese populations.
  Maeda, Molecular diagnosis & therapy 2014
  • GeneRIF: The rate of Results show that UGT1A7*12 allele frequency was not significantly different between the Uzbek and Japanese populations.
• The association between UGT1A7 polymorphism and cancer risk: a meta-analysis.
  Han, Cancer epidemiology 2012 (PubMed)
  • GeneRIF: the UGT1A7*3 allele is a risk factor for cancer among Asians, especially for hepatocellular carcinoma (Meta-Analysis)
• Association between polymorphisms in UDP-glucuronosyltransferase 1A6 and 1A7 and colorectal cancer risk.
  Osawa, Asian Pacific journal of cancer prevention : APJCP 2012 (PubMed)
  • GeneRIF: Polymorphism in UDP-glucuronosyltransferase 1A7 is associated with colorectal cancer.
• More
• Cytochrome P450 3A gene family and medication in childhood nephrotic syndrome: An update.
  Kochuthakidiyel, Global medical genetics 2025
  • “...O60656 UDP-glucuronosyltransferase 19 Retinoic acid binding 12181437 UGT1A1 P22309 UDP-glucuronosyltransferase 11 Steroid binding 12181437 UGT1A7 Q9HAW7 UDP-glucuronosyltransferase 17 Retinoic acid binding 12181437 UGT1A10 Q9HAW8 UDP-glucuronosyltransferase 110 Protein kinase c binding 15258099 CYP3A4 P08684 Cytochrome P450 3A4 Vitamin d3 25-hydroxylase activity 10681376 CYP3A5 P20815 Cytochrome P450 3A5...”
• Complete Reaction Phenotyping of Propranolol and 4-Hydroxypropranolol with the 19 Enzymes of the Human UGT1 and UGT2 Families.
  Yang, International journal of molecular sciences 2022
  • “...with an input of the human UGT1A7, UGT1A8, UGT1A9, UGT1A10 and UGT2A1 sequence (UniProt, Identifiers: Q9HAW7, Q9HAW9, O60656, Q9HAW8 and P0DTE4), respectively. The crystal structure of sterol 3-beta-glucosyltransferase in complex with its cofactor UDP-glucose (PDB code: 5GL5 [ 45 ]) was chosen as the template, for...”
• Interpreting the Molecular Mechanisms of Yinchenhao Decoction on Hepatocellular Carcinoma through Absorbed Components Based on Network Pharmacology
  Sun, BioMed research international 2021
  • “...Q9HAW8 Tar096 UGT1A3 UDP-glucuronosyltransferase 1A3 P35503 Tar097 UGT1A6 UDP-glucuronosyltransferase 1-6 Q64435 Tar098 UGT1A7 UDP-glucuronosyltransferase 1A7 Q9HAW7 Tar099 UGT1A8 UDP-glucuronosyltransferase 1A8 Q9HAW9 Tar100 UGT1A9 UDP-glucuronosyltransferase 1A9 Q62452 Tar101 UGT2B15 UDP-glucuronosyltransferase 2B15 P54855 Tar102 UGT2B17 UDP-glucuronosyltransferase 2B17 O75795 Tar103 VCAM1 Vascular cell adhesion protein 1 P19320 Tar104 VEGFA...”
• Molecular Docking-Based Design and Development of a Highly Selective Probe Substrate for UDP-glucuronosyltransferase 1A10.
  Juvonen, Molecular pharmaceutics 2018
  • “...2015). The accession codes for the retrieved UGT1As were: Q9HAW8 (1A10), O60656 (1A9), Q9HAW9 (1A8), Q9HAW7 (1A7), P19224 (1A6), P35504 (1A5), P22310 (1A4), P35503 (1A3), and P22039 (1A1). To identify template protein structures for homology modeling purposes, the retrieved UGT sequences were used in blast searches...”
• Sorbitol dehydrogenase overexpression and other aspects of dysregulated protein expression in human precancerous colorectal neoplasms: a quantitative proteomics study.
  Uzozie, Molecular & cellular proteomics : MCP 2014

Q20CK8 glucuronosyltransferase (EC 2.4.1.17) from Papio anubis (see paper)
63% identity, 96% coverage

AAB81536.1 Glucuronosyltransferase 1A7 (Ugt1a7) (EC 2.4.1.17) (see protein)
63% identity, 96% coverage

AAB19791.1 Glucuronosyltransferase 1A2 (Ugt1a2) (EC 2.4.1.17) (see protein)
61% identity, 96% coverage

P70624 glucuronosyltransferase (EC 2.4.1.17) from Rattus norvegicus (see paper)
58% identity, 95% coverage

NP_995584 UDP-glucuronosyltransferase 1-6 isoform 2 from Homo sapiens
90% identity, 50% coverage

• Distribution pattern of UGT1A6 and UGT2B7 gene polymorphism and its impact on the pharmacokinetics of valproic acid and carbamazepine: Prospective genetic association study conducted in Pakistani patients with epilepsy.
  Saleh, Gene 2024 (PubMed)
  • GeneRIF: Distribution pattern of UGT1A6 and UGT2B7 gene polymorphism and its impact on the pharmacokinetics of valproic acid and carbamazepine: Prospective genetic association study conducted in Pakistani patients with epilepsy.
• The Role of RARG rs2229774, SLC28A3 rs7853758, and UGT1A6*4 rs17863783 Single-nucleotide Polymorphisms in the Doxorubicin-induced Cardiotoxicity in Solid Childhood Tumors.
  Gündüz, Journal of pediatric hematology/oncology 2024 (PubMed)
  • GeneRIF: The Role of RARG rs2229774, SLC28A3 rs7853758, and UGT1A6*4 rs17863783 Single-nucleotide Polymorphisms in the Doxorubicin-induced Cardiotoxicity in Solid Childhood Tumors.
• Molecular biology of glucose-6-phosphate dehydrogenase and UDP-glucuronosyltransferase 1A1 in the development of neonatal unconjugated hyperbilirubinemia.
  Hung, Pediatrics and neonatology 2024 (PubMed)
  • GeneRIF: Molecular biology of glucose-6-phosphate dehydrogenase and UDP-glucuronosyltransferase 1A1 in the development of neonatal unconjugated hyperbilirubinemia.
• Association of UGT1A6 gene polymorphisms with sodium valproate-induced tremor in patients with epilepsy.
  Yin, Seizure 2024 (PubMed)
  • GeneRIF: Association of UGT1A6 gene polymorphisms with sodium valproate-induced tremor in patients with epilepsy.
• Significance of UGT1A6, UGT1A9, and UGT2B7 genetic variants and their mRNA expression in the clinical outcome of renal cell carcinoma.
  Matsumoto, Molecular and cellular biochemistry 2023 (PubMed)
  • GeneRIF: Significance of UGT1A6, UGT1A9, and UGT2B7 genetic variants and their mRNA expression in the clinical outcome of renal cell carcinoma.
• Effects of UGT1A, CYP2C9/19 and ABAT polymorphisms on plasma concentration of valproic acid in Chinese epilepsy patients.
  Zheng, Pharmacogenomics 2023 (PubMed)
  • GeneRIF: Effects of UGT1A, CYP2C9/19 and ABAT polymorphisms on plasma concentration of valproic acid in Chinese epilepsy patients.
• Impact of MDR1 and UGT Gene Polymorphisms on Sodium Valproate Plasma Concentration in Patients with Epilepsy.
  Song, Clinical laboratory 2022 (PubMed)
  • GeneRIF: Impact of MDR1 and UGT Gene Polymorphisms on Sodium Valproate Plasma Concentration in Patients with Epilepsy.
• UGT1A6 and UGT2B7 Gene Polymorphism and its Effect in Pediatric Epileptic Patients on Sodium Valproate Monotherapy.
  Nandith, Indian journal of pediatrics 2021 (PubMed)
  • GeneRIF: UGT1A6 and UGT2B7 Gene Polymorphism and its Effect in Pediatric Epileptic Patients on Sodium Valproate Monotherapy.
• More

CAB51368.1 UDP-GlcA: 1-naphthol glucuronosyltransferase 1B (UGT1B) (EC 2.4.1.17) (see protein)
46% identity, 95% coverage

W5PH14 UDP-glucuronosyltransferase from Ovis aries
47% identity, 92% coverage

• A Combined Metabolomic and Proteomic Study Revealed the Difference in Metabolite and Protein Expression Profiles in Ruminal Tissue From Goats Fed Hay or High-Grain Diets.
  Guo, Frontiers in physiology 2019
  • “...mutase family member 1 0.57 0.041 Oxidative stress and detoxification L0CSP6 PRDX5 Peroxiredoxin-5 2.35 0.038 W5PH14 LOC101117764 UDP-glucuronosyltransferase 2.06 0.037 W5NZJ1 SULT1A1 Sulfotransferase 1.55 0.036 W5PJJ7 LOC101109421 Uncharacterized protein 2.71 0.017 W5P382 ZADH2 Uncharacterized protein 0.02 0.050 W5PHN8 LOC101107119 Uncharacterized protein 3.56 0.014 Protein metabolic processes...”

LOC100623504 LOW QUALITY PROTEIN: UDP-glucuronosyltransferase 2B31-like from Sus scrofa
48% identity, 92% coverage

• Genomic and transcriptomic insights into vitamin A-induced thermogenesis and gene reuse as a cold adaptation strategy in wild boars
  Zhang, Communications biology 2025
  • “...4.4810 8 13 UGT2B31 , LOC100626199 , ALDH1A3 , CYP3A22 , HSD17B6 , LOC106510546 , LOC100623504 , LOC100624788 , LOC100512656 , RDH16 , LOC100516628 , LOC100624700 , LOC100515394 ssc00040 Pentose and glucuronate interconversions 1.6110 6 8 UGT2B31 , SORD , CRPPA , LOC100623504 , LOC100624788 ,...”
  • “...other enzymes 2.1310 6 11 UGT2B31 , GSTA4 , UPB1 , LOC100510917 , DUT , LOC100623504 , LOC100624788 , LOC100516628 , LOC100624700 , LOC100526118 , LOC100515394 ssc00980 Metabolism of xenobiotics by cytochrome P450 4.0410 6 10 UGT2B31 , GSTA4 , LOC100510917 , LOC106510546 , LOC100623504 ,...”
• Whole-genome sequencing of European autochthonous and commercial pig breeds allows the detection of signatures of selection for adaptation of genetic resources to different breeding and production systems
  Bovo, Genetics, selection, evolution : GSE 2020
  • “...LOC100515741 d , LOC100516628 b , LOC100624891 d , LOC110262115 d , LOC110262116 d , LOC100623504 d , LOC100515394 d , UGT2B31 b 8:66,900,00167,000,001 Bsara, Sarda LOC110262013 d , CABS1 d , LOC110262014 d , ODAM d , LOC100624541 d , PRR27 d , CSN1S2 b...”

AAG21378.1 UDP-Glucuronosyltransferase UGT2B33 (EC 2.4.1.17) (see protein)
46% identity, 94% coverage

LOC101118189 UDP-glucuronosyltransferase 2B4-like from Ovis aries
46% identity, 93% coverage

• Whole-genome resequencing of the native sheep provides insights into the microevolution and identifies genes associated with reproduction traits
  Zhu, BMC genomics 2023
  • “...reported (e.g., GDP9, CYP19A1, 3-HSD, PLCB1, MED12L, PER1, FSHR, WNT4, NOTCH2, RXRG, LHR, HTR5A, PIK3R3, LOC101118189, LOC101122280, et al.). And the PAK1, GNAQ, TSHR genes were also associated with reproductive traits by selective signature analysis. They were mainly enriched in ovarian steroidogenesis, steroid biosynthesis, cAMP signaling...”

AAB50249.1 Glucuronosyltransferase 2B9 (EC 2.4.1.17) (see protein)
46% identity, 94% coverage

Q8K154 glucuronosyltransferase (EC 2.4.1.17) from Mus musculus (see paper)
47% identity, 93% coverage

• Re-adaption on Earth after Spaceflights Affects the Mouse Liver Proteome.
  Anselm, International journal of molecular sciences 2017
  • “...Cytochrome P450 2C54 Q6XVG2 * >0.05 0.0476 UDP-glucuronosyltransferase 2A3 Q8BWQ1 - 1.9 0.0109 0.0132 UDP-glucuronosyltransferase Q8K154 - 1.9 0.0172 0.0126 UDP-glucuronosyltransferase Q8R084 - 3.5 0.0118 0.0119 Cytochrome P450 2C70 Q91W64 * >0.05 0.0340 Cytochrome P450 4A12A Q91WL5 - 5.0 0.0113 0.0128 Dehydrogenase/reductase SDR family member 4...”

AAG21377.1 UDP-Glucuronosyltransferase UGT2B9*2 (EC 2.4.1.17) (see protein)
46% identity, 94% coverage

UDB18_MACFA / O97951 UDP-glucuronosyltransferase 2B18; UDPGT 2B18; EC 2.4.1.17 from Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) (see paper)
46% identity, 94% coverage

• function: UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. This isozyme displays activity toward 3-hydroxyandrogens. It is principally active on C19 steroids having a hydroxyl group at position 3-alpha of the steroid molecule and also active on planar phenols and bile acids
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)

D4A132 UDP-glucuronosyltransferase from Rattus norvegicus
46% identity, 94% coverage

• Hyperoside attenuates non-alcoholic fatty liver disease in rats via cholesterol metabolism and bile acid metabolism.
  Wang, Journal of advanced research 2021
  • “...anion transporter), member 7 1.30 0.0344 Q68G19 Ugt2b35 19 2 2 43.2 UDP-glucuronosyltransferase 1.66 0.0067 D4A132 Ugt2b10 14 2 2 28.6 Glucuronosyltransferase [EC:2.4.1.17] 1.24 0.0287 Q5FVR5 Acnat2 11 11 11 36.1 Bile acid-CoA:amino acid N-acyltransferase [EC:2.3.1.65 3.1.2.2] 0.59 0.0259 A0A2P1EA62 Abcb11 38 38 37 38.1 Bile...”

UDB23_MACFA / Q9TSL6 UDP-glucuronosyltransferase 2B23; UDPGT 2B23; EC 2.4.1.17 from Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) (see paper)
AAF14353.1 UDP-glucuronosyltransferase 2B23 (EC 2.4.1.17) (see protein)
46% identity, 94% coverage

• function: UDPGTs are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. This isozyme has glucuronidating capacity on 6 steroids and the bile acid, hyodeoxycholic acid. May potentially play an important role in estrogen and androgen catabolism in peripheral steroid target tissues
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)

CAB41974.1 Glucuronosyltransferase 2A1 (Ugt2a1) (olfactory) (EC 2.4.1.17) (see protein)
44% identity, 93% coverage

UD2B4_HUMAN / P06133 UDP-glucuronosyltransferase 2B4; UDPGT 2B4; UGT2B4; HLUG25; Hyodeoxycholic acid-specific UDPGT; UDPGTh-1; EC 2.4.1.17 from Homo sapiens (Human) (see 3 papers)
P06133 glucuronosyltransferase (EC 2.4.1.17) from Homo sapiens (see 8 papers)
AAF78145.1 UDP-GlcA: glucuronosyltransferase 2B4 (Ugt2b4) (EC 2.4.1.17) (see protein)
45% identity, 97% coverage

• function: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile (PubMed:18719240, PubMed:23288867). Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds (PubMed:18719240, PubMed:23288867). Catalyzes the glucuronidation of the endogenous estrogen hormones such as estradiol and estriol (PubMed:18719240, PubMed:23288867).
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
  catalytic activity: 17alpha-estradiol + UDP-alpha-D-glucuronate = 17alpha- estradiol 17-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52872)
  catalytic activity: 16alpha,17alpha-estriol + UDP-alpha-D-glucuronate = 16alpha,17alpha-estriol 17-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52916)
• Establishing the capacity to monitor proteins relevant to the study of drug exposure and response using liver-derived extracellular vesicles.
  Newman, British journal of clinical pharmacology 2024
  • “...(UGT1A6) P19224 Liver, kidney Medium High in kidney, medium in intestine DME UDPglucuronosyltransferase 2B4 (UGT2B4) P06133 Liver, intestine, kidney Medium High in intestine, kidney DME UDPglucuronosyltransferase 2B7 (UGT2B7) P16662 Liver, kidney High High in kidney, medium in intestine Group 3: Extrahepatic tissue enrichment or ubiquitous expression...”
• AOPM: Application of Antioxidant Protein Classification Model in Predicting the Composition of Antioxidant Drugs.
  Zhai, Frontiers in pharmacology 2021
  • “...of 36 protein sequences. UniProt ID Drug Type P47989 Carvedilol, Allopurinol enzyme P16662 Carvedilol enzyme P06133 Carvedilol enzyme P22309 Carvedilol, Silibinin enzyme Q16881 Ascorbic acid, Selenium enzyme P00441 Vitamin E, alpha-Tocopherol succinate enzyme Q96I15 Selenium enzyme P16435 Lipoic acid enzyme P15559 Vitamin E, alpha-Tocopherol succinate enzyme...”
• Identification of HO-1 as a novel biomarker for graft acute cellular rejection and prognosis prediction after liver transplantation
  Jia, Annals of translational medicine 2020
  • “...carrier 2 MPC2 0.559 Q9UBQ7 Glyoxylate reductase/hydroxypyruvate reductase GRHPR 0.561 P07108 Acyl-CoA-binding protein DBI 0.564 P06133 UDP-glucuronosyltransferase 2B4 UGT2B4 0.574 P00167 Cytochrome b5 CYB5A 0.576 Q9UI17 Dimethylglycine dehydrogenase, mitochondrial DMGDH 0.591 P16930 Fumarylacetoacetase FAH 0.594 P27338 Amine oxidase [flavin-containing] B MAOB 0.594 P20813 Cytochrome P450 2B6...”
• Network Pharmacology Identifies the Mechanisms of Action of Shaoyao Gancao Decoction in the Treatment of Osteoarthritis
  Zhu, Medical science monitor : international medical journal of experimental and clinical research 2019
  • “...Drugbank Q9HAW9 UGT1A8 UDP-glucuronosyltransferase 1-8 Homo sapiens Drugbank O60656 UGT1A9 UDP-glucuronosyltransferase 1-9 Homo sapiens Drugbank P06133 UGT2B4 UDP-glucuronosyltransferase 2B4 Homo sapiens Drugbank P16662 UGT2B7 UDP-glucuronosyltransferase 2B7 Homo sapiens Drugbank P02768 ALB Serum albumin Homo sapiens Drugbank, Genecards P23219 PTGS1 Prostaglandin G/H synthase 1 Homo sapiens Drugbank,...”
• Effect of Inulin on Proteome Changes Induced by Pathogenic Lipopolysaccharide in Human Colon
  Guarino, PloS one 2017
  • “...Homo sapiens GN = UGT2B17 PE = 2 SV = 1 - [UDB17_HUMAN] 1,0 1,7 P06133 UDP-glucuronosyltransferase 2B4 OS = Homo sapiens GN = UGT2B4 PE = 1 SV = 2 - [UD2B4_HUMAN] 1,0 1,5 Q01995 Transgelin OS = Homo sapiens GN = TAGLN PE =...”

NP_006789 UDP-glucuronosyltransferase 2A1 isoform 1 precursor from Homo sapiens
44% identity, 93% coverage

• The UGT2A1/UGT2A2 locus is associated with COVID-19-related loss of smell or taste.
  Shelton, Nature genetics 2022 (PubMed)
  • GeneRIF: The UGT2A1/UGT2A2 locus is associated with COVID-19-related loss of smell or taste.
• Regulation of UGT2A1 by miR-196a-5p and miR-196b-5p.
  Sutliff, The Journal of pharmacology and experimental therapeutics 2019
  • GeneRIF: Regulation of UGT2A1 by miR-196a-5p and miR-196b-5p
• Study of the Association of PEAR1, P2Y12, and UGT2A1 Polymorphisms with Platelet Reactivity in Response to Dual Antiplatelet Therapy in Chinese Patients.
  Zhang, Cardiology 2018 (PubMed)
  • GeneRIF: association of SNPs of PEAR1, P2Y12, and UGT2A1 with platelet reactivity in 290 Chinese patients with acute coronary syndrome treated with aspirin and clopidogrel
• The Human UDP-glucuronosyltransferase UGT2A1 and UGT2A2 enzymes are highly active in bile acid glucuronidation.
  Perreault, Drug metabolism and disposition: the biological fate of chemicals 2013
  • GeneRIF: The Km values of UGT2A1 varied between 102.2 +/- 14.3 microM and 2.4 +/- 1.2 mM.
• Identification and functional characterization of a novel UDP-glucuronosyltransferase 2A1 splice variant: potential importance in tobacco-related cancer susceptibility.
  Bushey, The Journal of pharmacology and experimental therapeutics 2012
  • GeneRIF: Expression of novel UDP-glucuronosyltransferase 2A1 splice variant could play an important role in the detoxification of carcinogens within target tissues for tobacco carcinogenesis.
• Characterization of UDP-glucuronosyltransferase 2A1 (UGT2A1) variants and their potential role in tobacco carcinogenesis.
  Bushey, Pharmacogenetics and genomics 2011
  • GeneRIF: UGT2A1 is an important detoxification enzyme in the metabolism of polycyclic aromatic hydrocarbons.
• Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
  Saito, Journal of human genetics 2009 (PubMed)
  • GeneRIF: Observational study of gene-disease association. (HuGE Navigator)
• Human UDP-glucuronosyltransferase UGT2A2: cDNA construction, expression, and functional characterization in comparison with UGT2A1 and UGT2A3.
  Sneitz, Pharmacogenetics and genomics 2009
  • GeneRIF: Results show that UGT2A2 not only shares exons 2-6 with UGT2A1, it also shares with it a similar tissue expression pattern; both UGTs are primarily expressed in nasal epithelium. The 3rd member of UGT2A subfamily, UGT2A3 exhibited a different tissue expression pattern, found mainly in liver and small intestine.
• More

D2SMM6 glucuronosyltransferase (EC 2.4.1.17) from Papio anubis (see paper)
46% identity, 94% coverage

Q80X89 UDP-glucuronosyltransferase 2A1 from Mus musculus
45% identity, 94% coverage

• The Effect of Environmental Enrichment on Glutathione-Mediated Xenobiotic Metabolism and Antioxidation in Normal Adult Mice
  Seo, Frontiers in neurology 2018
  • “...Dimethylaniline monooxygenase [N-oxide-forming] 5 Fmo5 2.9 0.0001 P33267 CP2F2_MOUSE Cytochrome P450 2F2 Cyp2f2 2.9 0.0001 Q80X89 UD2A1_MOUSE UDP-glucuronosyltransferase 2A1 Ugt2a1 2.8 0.0001 Q91X75 Q91X75_MOUSE Cyp2a4 protein Cyp2a5 2.7 0.0001 P05784 K1C18_MOUSE Keratin, type I cytoskeletal 18 Krt18 2.7 0.0001 Q8K157 GALM_MOUSE Aldose 1-epimerase Galm 2.6 0.0001...”

D2SMM4 glucuronosyltransferase (EC 2.4.1.17) from Papio anubis (see paper)
46% identity, 94% coverage

AAG17003.1 Glucuronosyltransferase 2A1 (Ugt2a1) (olfactory) (EC 2.4.1.17) (see protein)
45% identity, 94% coverage

A0A4Y1KAF7 glucuronosyltransferase (EC 2.4.1.17) from Macaca fascicularis (see paper)
44% identity, 93% coverage

Q6K1J1 glucuronosyltransferase (EC 2.4.1.17) from Canis lupus familiaris (see paper)
44% identity, 97% coverage

LOC100515741 LOW QUALITY PROTEIN: UDP-glucuronosyltransferase 2B31 from Sus scrofa
45% identity, 93% coverage

• Whole-genome sequencing of European autochthonous and commercial pig breeds allows the detection of signatures of selection for adaptation of genetic resources to different breeding and production systems
  Bovo, Genetics, selection, evolution : GSE 2020
  • “...Schwein 8:66,300,00166,400,001 Lithuanian White old type, Lithuanian Indigenous Wattle LOC100515222 d , YTHDC1 d , LOC100515741 d , LOC100516628 b , LOC100624891 d , LOC110262115 d , LOC110262116 d , LOC100623504 d , LOC100515394 d , UGT2B31 b 8:66,900,00167,000,001 Bsara, Sarda LOC110262013 d , CABS1 d...”
• Cell type-specific analysis of transcriptome changes in the porcine endometrium on Day 12 of pregnancy
  Zeng, BMC genomics 2018
  • “...UGT1A6 ) in GE, UDP-glucuronosyltransferase 2B31 ( UGT2B31 ) in LE, and UDP-glucuronosyltransferase 2B31-like ( LOC100515741 ) in complete endometria. As UGT enzymes are involved in glucuronidation of E2 [ 78 ], this indicates increased UGT-mediated estrogen metabolism on Day 12 of pregnancy. Cytochrome P450 family...”

D2SMM3 glucuronosyltransferase (EC 2.4.1.17) from Papio anubis (see paper)
45% identity, 97% coverage

Q8R084 UDP-glucuronosyltransferase from Mus musculus
NP_690024 UDP-glucuronosyltransferase 2B4 precursor from Mus musculus
46% identity, 94% coverage

• Re-adaption on Earth after Spaceflights Affects the Mouse Liver Proteome.
  Anselm, International journal of molecular sciences 2017
  • “...0.0476 UDP-glucuronosyltransferase 2A3 Q8BWQ1 - 1.9 0.0109 0.0132 UDP-glucuronosyltransferase Q8K154 - 1.9 0.0172 0.0126 UDP-glucuronosyltransferase Q8R084 - 3.5 0.0118 0.0119 Cytochrome P450 2C70 Q91W64 * >0.05 0.0340 Cytochrome P450 4A12A Q91WL5 - 5.0 0.0113 0.0128 Dehydrogenase/reductase SDR family member 4 Q99LB2 - 1.7 0.0108 0.0131 Cytochromes...”
• Hetero-oligomer formation of mouse UDP-glucuronosyltransferase (UGT) 2b1 and 1a1 results in the gain of glucuronidation activity towards morphine, an activity which is absent in homo-oligomers of either UGT.
  Miyauchi, Biochemical and biophysical research communications 2020 (PubMed)
  • GeneRIF: Hetero-oligomer formation of mouse UDP-glucuronosyltransferase (UGT) 2b1 and 1a1 results in the gain of glucuronidation activity towards morphine, an activity which is absent in homo-oligomers of either UGT.
• Weak activity of UDP-glucuronosyltransferase toward Bisphenol analogs in mouse perinatal development.
  Yabusaki, The Journal of veterinary medical science 2015
  • GeneRIF: The metabolism of bisphenols by UGT2B1 in fetal, newborn, and maternal mice is reported.

W5PGA7 UDP-glucuronosyltransferase from Ovis aries
45% identity, 94% coverage

• Overgrazing induces alterations in the hepatic proteome of sheep (Ovis aries): an iTRAQ-based quantitative proteomic analysis
  Ren, Proteome science 2016
  • “...SV=1 - [W5Q0Z8_SHEEP] TRIM56 0.29 0.0011 Regulator of host innate immunity Stress response and detoxification W5PGA7 UDP-glucuronosyltransferase OS=Ovis aries GN=UGT2B7 PE=3 SV=1 - [W5PGA7_SHEEP] UGT2B7 0.79 0.0376 Elimination of potentially toxic xenobiotics and endogenous compounds W5PWA2 Uncharacterized protein OS=Ovis aries PE=3 SV=1 - [W5PWA2_SHEEP] None 1.24...”

LOC100515394 UDP-glucuronosyltransferase 2C1 from Sus scrofa
44% identity, 94% coverage

• Genomic and transcriptomic insights into vitamin A-induced thermogenesis and gene reuse as a cold adaptation strategy in wild boars
  Zhang, Communications biology 2025
  • “..., LOC106510546 , LOC100623504 , LOC100624788 , LOC100512656 , RDH16 , LOC100516628 , LOC100624700 , LOC100515394 ssc00040 Pentose and glucuronate interconversions 1.6110 6 8 UGT2B31 , SORD , CRPPA , LOC100623504 , LOC100624788 , LOC100516628 , LOC100624700 , LOC100515394 ssc00983 Drug metabolism - other enzymes 2.1310...”
  • “..., LOC100510917 , DUT , LOC100623504 , LOC100624788 , LOC100516628 , LOC100624700 , LOC100526118 , LOC100515394 ssc00980 Metabolism of xenobiotics by cytochrome P450 4.0410 6 10 UGT2B31 , GSTA4 , LOC100510917 , LOC106510546 , LOC100623504 , LOC100624788 , LOC100516628 , LOC100624700 , LOC100526118 , LOC100515394 ssc05204...”
• Whole-genome sequencing of European autochthonous and commercial pig breeds allows the detection of signatures of selection for adaptation of genetic resources to different breeding and production systems
  Bovo, Genetics, selection, evolution : GSE 2020
  • “...LOC100516628 b , LOC100624891 d , LOC110262115 d , LOC110262116 d , LOC100623504 d , LOC100515394 d , UGT2B31 b 8:66,900,00167,000,001 Bsara, Sarda LOC110262013 d , CABS1 d , LOC110262014 d , ODAM d , LOC100624541 d , PRR27 d , CSN1S2 b , LOC110262119 d...”

LOC615303 UDP-glucuronosyltransferase 2B4 from Bos taurus
44% identity, 97% coverage

• Novel Facets of the Liver Transcriptome Are Associated with the Susceptibility and Resistance to Lipid-Related Metabolic Disorders in Periparturient Holstein Cows
  Pralle, Animals : an open access journal from MDPI 2021
  • “...SCD , CYP8B1 , APOA5 , SLC27A6 , FADS2 +1 bta05204 Chemical carcinogenesis 7 0.023 LOC615303 , CYP1A1 , GSTA4 , GSTT1 , GSTA1 , CYP2C87 bta00480 Glutathione metabolism 8 0.026 ODC1 , GSTA4 , GSTT1 , ANPEP , GSTA1 bta00980 Metabolism of xenobiotics by cytochrome...”
  • “...HYOU1 , DNAJB11 , MOGS , SEC23B , WFS1 bta00982 Drug metabolism-cytochrome P450 6 0.079 LOC615303 , GSTA4 , GSTT1 , GSTA1 bta04514 Cell adhesion molecules (CAMs) 4.0 0.085 NRCAM , LOC534578 , CD22 , BOLA-DQB , LOC100848815 +14 bta04512 ECM-receptor interaction 9 6.3 10 5...”

O75310 glucuronosyltransferase (EC 2.4.1.17) from Homo sapiens (see 3 papers)
NP_001064 UDP-glucuronosyltransferase 2B11 precursor from Homo sapiens
46% identity, 94% coverage

• Histopathology of melanosis coli and determination of its associated genes by comparative analysis of expression microarrays.
  Li, Molecular medicine reports 2015
  • GeneRIF: CYP3A4, CYP3A7, UGT2B11 and UGT2B15 genes are significantly downregulated in melanosis coli.
• Quantitative analysis of UGT2B28 mRNA expression by real-time RT-PCR and application to human tissue distribution study.
  Ohno, Drug metabolism letters 2011 (PubMed)
  • GeneRIF: significant expression of UGT2B11 was detected in the liver, breast and kidney, and was clearly different from the distribution of UGT2B28
• Genetic variation in the estrogen metabolic pathway and mammographic density as an intermediate phenotype of breast cancer.
  Li, Breast cancer research : BCR 2010
  • GeneRIF: Observational study of gene-disease association. (HuGE Navigator)
• Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
  Saito, Journal of human genetics 2009 (PubMed)
  • GeneRIF: Observational study of gene-disease association. (HuGE Navigator)
• Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
  Ross, Nature genetics 2009 (PubMed)
  • GeneRIF: Observational study of gene-disease association. (HuGE Navigator)

D2SMM5 glucuronosyltransferase (EC 2.4.1.17) from Papio anubis (see paper)
45% identity, 94% coverage

D2SMM2 glucuronosyltransferase (EC 2.4.1.17) from Papio anubis (see paper)
45% identity, 94% coverage

LOC102175204 UDP-glucuronosyltransferase 2B4 from Capra hircus
45% identity, 94% coverage

• Hepatic Lipid Accumulation and Dysregulation Associate with Enhanced Reactive Oxygen Species and Pro-Inflammatory Cytokine in Low-Birth-Weight Goats
  Liu, Animals : an open access journal from MDPI 2022
  • “...2) GPX3 (glutathione peroxidase 3) Metabolism of xenobiotics by cytochrome P450 KO00980 LOC102170823 (cytochromeP450 1A1) LOC102175204 (UDP-glucuronosyltransferase 2B4) Drug metabolism - cytochrome P450 KO00982 LOC102175204 (UDP-glucuronosyltransferase 2B4) LOC102181105 (alcohol dehydrogenase E chain isoform X1) LOC108635023 (UDP-glucuronosyltransferase 2B18-like) Oxidative phosphorylation KO00190 Capra_hircus_newGene_23729 Capra_hircus_newGene_43596 Capra_hircus_newGene_43600 Capra_hircus_newGene_48268 Inflammation Leukocyte...”

LOC100623255 LOW QUALITY PROTEIN: UDP-glucuronosyltransferase 2B31 from Sus scrofa
46% identity, 92% coverage

• Transcriptomic Responses Induced in Muscle and Adipose Tissues of Growing Pigs by Intravenous Infusion of Sodium Butyrate
  Zhang, Biology 2021
  • “...tissues. Tissues Genes 1 Major Metabolic Types muscle PPP1R3B , PCK1, APOA2, ALDOC , UGT2B31, LOC100623255, ANKH, MAT1A, PRPS2 , ITIH2, ITIH1 Carbohydrate metabolism PLIN1 , ANKRD23, CES3, LOC10073013, HSD17B13, PCK1, CYP2D25, ETNK2, ACSM4, ADH4, CYP1A2, TTR, CYP2E1, APOC3, CPS1, GC, CYP2C33, CYP2C49, LOC100739741, APOA2, APOC2,...”
  • “...Amino acid metabolism adipose LEP , C3, IGF1 , SLC2A4 , APOA2, LPL , UGT2B31, LOC100623255, UPP1, ITIH2, ITIH1, LBP Carbohydrate metabolism APOC3, APOC2, PNPLA3 , APOA2, LPL , LOC100737013, CYP2C49, LEP , LOC100510957, TTR, DHCR24 , LOC100739741, CYP1A2, STAR, CYP2D25, CYP2E1, CPS1, CYP2C33, GNLY ,...”

D2SMM1 glucuronosyltransferase (EC 2.4.1.17) from Papio anubis (see paper)
45% identity, 97% coverage

XP_063129642 UDP-glucuronosyltransferase 2A1 isoform X2 from Rattus norvegicus
44% identity, 94% coverage

• The odorant metabolizing enzyme UGT2A1: Immunolocalization and impact of the modulation of its activity on the olfactory response.
  Neiers, PloS one 2021
  • GeneRIF: The odorant metabolizing enzyme UGT2A1: Immunolocalization and impact of the modulation of its activity on the olfactory response.

UD2A1_RAT / P36510 UDP-glucuronosyltransferase 2A1; UDPGT 2A1; UGT2A1; UGT-OLF; EC 2.4.1.17 from Rattus norvegicus (Rat) (see paper)
CAA40797.1 Glucuronosyltransferase 2A1 (Ugt2a1) (EC 2.4.1.17) (see protein)
44% identity, 95% coverage

• function: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile. Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds. Catalyzes the glucuronidation of endogenous steroid hormones such as androgens (testosterones) and estrogens (estradiol and estriol). Contributes to bile acid (BA) detoxification by catalyzing the glucuronidation of BA substrates, which are natural detergents for dietary lipids absorption. Shows a high affinity to aliphatic odorants such as citronellol as well as olfactory tissue specificity, and therefore may be involved in olfaction.
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
  catalytic activity: 16beta,17beta-estriol + UDP-alpha-D-glucuronate = 16beta,17beta-estriol 16-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52880)
  catalytic activity: 16alpha,17alpha-estriol + UDP-alpha-D-glucuronate = 16alpha,17alpha-estriol 16-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52920)
  catalytic activity: 17alpha-estradiol + UDP-alpha-D-glucuronate = 17alpha- estradiol 17-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52872)
  catalytic activity: 17alpha-estradiol + UDP-alpha-D-glucuronate = 17alpha- estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52868)
  catalytic activity: 17beta-estradiol + UDP-alpha-D-glucuronate = 17beta-estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52460)
  catalytic activity: 17beta-estradiol + UDP-alpha-D-glucuronate = 17beta-estradiol 17-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52464)
  catalytic activity: testosterone + UDP-alpha-D-glucuronate = testosterone 17-O- (beta-D-glucuronate) + UDP + H(+) (RHEA:52456)
  catalytic activity: epitestosterone + UDP-alpha-D-glucuronate = epitestosterone 17-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52568)
  catalytic activity: lithocholate + UDP-alpha-D-glucuronate = lithocholoyl-3-O- (beta-D-glucuronate) + UDP + H(+) (RHEA:53028)
  catalytic activity: lithocholate + UDP-alpha-D-glucuronate = lithocholoyl-24-O- (beta-D-glucuronate) + UDP (RHEA:52952)
  catalytic activity: deoxycholate + UDP-alpha-D-glucuronate = deoxycholoyl-24-O- (beta-D-glucuronate) + UDP (RHEA:52948)
  catalytic activity: hyodeoxycholate + UDP-alpha-D-glucuronate = hyodeoxycholate 6- O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52964)
  catalytic activity: hyocholate + UDP-alpha-D-glucuronate = hyocholoyl-24-O-(beta- D-glucuronate) + UDP (RHEA:52960)
• Diviner uncovers hundreds of novel human (and other) exons though comparative analysis of proteins.
  Nord, bioRxiv : the preprint server for biology 2024
  • “...for the pictured Diviner search result, [C] the sole rat UGT2A1 isoform in SwissProt (accession: P36510), and [D] the protein sequence produced by incorporating the novel rat exon predicted by Diviner into the rat UGT2A1 isoform pictured in [C]. The rat exon predicted by Diviner and...”
• Detection of new pathways involved in the acceptance and the utilisation of a plant-based diet in isogenic lines of rainbow trout fry.
  Callet, PloS one 2018
  • “...to perception. Swiss Prot Description Genotype effect Diet effect R23h AB1h A22h Perception of smell/taste P36510 UDP-glucuronosyltransferase 2A1 (Ugt2a1) R23h <A22h ns ns ns P56373 P2X purinoceptor 3 (P2RX3) R23h <A22h ns ns up Q3V3I2 Guanine nucleotide-binding protein G(t) subunit -3 (GNAT3) R23h <A22h ns ns...”

P36537 glucuronosyltransferase (EC 2.4.1.17) from Homo sapiens (see 9 papers)
CAA44961.1 glucuronosyltransferase 2B10 (Ugt2b10) (EC 2.4.1.17) (see protein)
45% identity, 98% coverage

• A potential implication of UDP-glucuronosyltransferase 2B10 in the detoxification of drugs used in pediatric hematopoietic stem cell transplantation setting: an in silico investigation
  Robin, BMC molecular and cell biology 2022
  • “...amino acid sequence was retrieved from UniProt protein sequence database with the accession number of P36537 [ 83 ]. The signal peptide was removed, as it only serves to direct the protein to the endoplasmic reticulum and is not present in the mature protein. The HHpred...”
• Direct Molecular Fishing of New Protein Partners for Human Thromboxane Synthase
  Svirid, Acta naturae 2017
  • “...28 TPI1 Triosephosphate isomerase 31057 P60174 150 12 (4) 0.26 29 UGT2B10 UDP-glucuronosyltransferase 2B10 61190 P36537 55 8 (3) 0.06 30 UGP2 UTP-glucose-1-phosphate uridylyltransferase 57076 Q16851 72 15 (4) 0.13 Control - upper line, Test - bottom line 1 UGP2 Alcohol dehydrogenase 1B 40684 P00325 408...”

AAA36793.1 UDP-GlcA: β-glucuronosyltransferase 2B7 (Ugt2b7) (EC 2.4.1.17|2.4.1.-) (see protein)
44% identity, 98% coverage

UGT2B7 / P16662 UDP-glucuronosyltransferase 2B7 (EC 2.4.1.17) from Homo sapiens (see 2 papers)
UD2B7_HUMAN / P16662 UDP-glucuronosyltransferase 2B7; UDPGT 2B7; UGT2B7; 3,4-catechol estrogen-specific UDPGT; UDP-glucuronosyltransferase 2B9; UDPGT 2B9; UDPGTh-2; EC 2.4.1.17 from Homo sapiens (Human) (see 16 papers)
P16662 glucuronosyltransferase (EC 2.4.1.17) from Homo sapiens (see 39 papers)
44% identity, 98% coverage

• function: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile (PubMed:10702251, PubMed:15470161, PubMed:15472229, PubMed:17442341, PubMed:18674515, PubMed:18719240, PubMed:19022937, PubMed:23288867, PubMed:23756265, PubMed:26220143, PubMed:15231852, PubMed:21422672, PubMed:38211441). Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds (PubMed:15470161, PubMed:18674515, PubMed:23756265). Catalyzes the glucuronidation of endogenous steroid hormones such as androgens (epitestosterone, androsterone) and estrogens (estradiol, epiestradiol, estriol, catechol estrogens) (PubMed:15472229, PubMed:17442341, PubMed:18719240, PubMed:19022937, PubMed:2159463, PubMed:23288867, PubMed:26220143). Also regulates the levels of retinoic acid, a major metabolite of vitamin A involved in apoptosis, cellular growth and differentiation, and embryonic development (PubMed:10702251). Contributes to bile acid (BA) detoxification by catalyzing the glucuronidation of BA substrates, which are natural detergents for dietary lipids absorption (PubMed:23756265). Involved in the glucuronidation of arachidonic acid (AA) and AA-derived eicosanoids including 15-HETE, 20-HETE, PGE2, PGB1 and F2-isoprostanes (8-iso- PGF2alpha and 5-epi-5-F2t-IsoP) (PubMed:15231852, PubMed:38211441). Involved in the glucuronidation of the phytochemical ferulic acid at the phenolic or the carboxylic acid group (PubMed:21422672). Involved in the glucuronidation of the AGTR1 angiotensin receptor antagonist losartan, caderastan and zolarsatan, drugs which can inhibit the effect of angiotensin II (PubMed:18674515). Also metabolizes mycophenolate, an immunosuppressive agent (PubMed:15470161).
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
  catalytic activity: 17alpha-estradiol + UDP-alpha-D-glucuronate = 17alpha- estradiol 17-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52872)
  catalytic activity: 17beta-estradiol + UDP-alpha-D-glucuronate = 17beta-estradiol 17-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52464)
  catalytic activity: 2-hydroxy-17beta-estradiol + UDP-alpha-D-glucuronate = 2- hydroxy-17beta-estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53004)
  catalytic activity: 4-hydroxy-17beta-estradiol + UDP-alpha-D-glucuronate = 17beta- estradiol 4-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53040)
  catalytic activity: 4-hydroxyestrone + UDP-alpha-D-glucuronate = estrone 4-O- (beta-D-glucuronate) + UDP + H(+) (RHEA:53060)
  catalytic activity: 16alpha-hydroxyestrone + UDP-alpha-D-glucuronate = 16alpha- hydroxyestrone 16-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52452)
  catalytic activity: 16alpha,17beta-estriol + UDP-alpha-D-glucuronate = 16alpha,17beta-estriol 16-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52472)
  catalytic activity: 16beta,17beta-estriol + UDP-alpha-D-glucuronate = 16beta,17beta-estriol 16-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52880)
  catalytic activity: 16alpha,17alpha-estriol + UDP-alpha-D-glucuronate = 16alpha,17alpha-estriol 16-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52920)
  catalytic activity: 16alpha,17alpha-estriol + UDP-alpha-D-glucuronate = 16alpha,17alpha-estriol 17-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52916)
  catalytic activity: epitestosterone + UDP-alpha-D-glucuronate = epitestosterone 17-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52568)
  catalytic activity: hyodeoxycholate + UDP-alpha-D-glucuronate = hyodeoxycholate 6- O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52964)
  catalytic activity: hyocholate + UDP-alpha-D-glucuronate = hyocholate 6-O-(beta-D- glucuronate) + UDP + H(+) (RHEA:52968)
  catalytic activity: all-trans-retinoate + UDP-alpha-D-glucuronate = all-trans- retinoyl-1-O-(beta-D-glucuronate) + UDP (RHEA:55768)
  catalytic activity: all-trans-4-hydroxyretinoate + UDP-alpha-D-glucuronate = all- trans-4-hydroxy-4-O-(beta-D-glucuronide)-retinoate + UDP + H(+) (RHEA:55776)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-ferulic acid beta-D-glucuronate ester + UDP (RHEA:79955)
  catalytic activity: 8-iso-prostaglandin F2alpha + UDP-alpha-D-glucuronate = 8-iso- prostaglandin F2alpha-glucuronide + UDP + H(+) (RHEA:79907)
  catalytic activity: 5-epi-5-F2t-IsoP + UDP-alpha-D-glucuronate = 5-epi-5-F2t-IsoP- glucuronide + UDP + H(+) (RHEA:79911)
  catalytic activity: (5Z,8Z,11Z,14Z)-eicosatetraenoate + UDP-alpha-D-glucuronate = O-[(5Z),(8Z),(11Z),(14Z)-eicosatetraenoyl]-beta-D-glucuronate + UDP (RHEA:79915)
  catalytic activity: 15-hydroxy-(5Z,8Z,11Z,13E)-eicosatetraenoate + UDP-alpha-D- glucuronate = 15-O-(beta-D-glucuronosyl)-(5Z,8Z,11Z,14Z)- eicosatetraenoate + UDP + H(+) (RHEA:79919)
  catalytic activity: 20-hydroxy-(5Z,8Z,11Z,14Z)-eicosatetraenoate + UDP-alpha-D- glucuronate = 20-O-(beta-D-glucuronosyl)-(5Z,8Z,11Z,14Z)- eicosatetraenoate + UDP + H(+) (RHEA:79927)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-4-O-(beta-D- glucuronosyl)-ferulate + UDP + H(+) (RHEA:79951)
  catalytic activity: prostaglandin B1 + UDP-alpha-D-glucuronate = 15-O-(beta-D- glucuronosyl)-prostaglandin B1 + UDP + H(+) (RHEA:79935)
  catalytic activity: mycophenolate + UDP-alpha-D-glucuronate = mycophenolic acid O- acyl-beta-D-glucuronide + UDP (RHEA:63700)
  catalytic activity: losartan + UDP-alpha-D-glucuronate = losartan-2-N-beta-D- glucuronide + UDP (RHEA:63720)
  catalytic activity: candesartan + UDP-alpha-D-glucuronate = candesartan O-beta-D- glucuronoside + UDP (RHEA:63724)
  catalytic activity: candesartan + UDP-alpha-D-glucuronate = candesartan-2-N-beta- D-glucuronide + UDP (RHEA:63728)
  catalytic activity: zolasartan + UDP-alpha-D-glucuronate = zolarsartan O-beta-D- glucuronoside + UDP (RHEA:63732)
• Cytochrome P450 3A gene family and medication in childhood nephrotic syndrome: An update.
  Kochuthakidiyel, Global medical genetics 2025
  • “...d3 25-hydroxylase activity 10681376 CYP3A5 P20815 Cytochrome P450 3A5 Oxygen binding 2732228 Mycophenolate DB01024 UGT2B7 P16662 UDP-glucuronosyltransferase 2B7 Glucuronosyltransferase activity 10702251 UGT1A8 Q9HAW9 UDP-glucuronosyltransferase 18 Steroid binding 15472229 UGT1A9 O60656 UDP-glucuronosyltransferase 19 Retinoic acid binding 12181437 UGT1A1 P22309 UDP-glucuronosyltransferase 11 Steroid binding 12181437 UGT1A7 Q9HAW7 UDP-glucuronosyltransferase...”
  • “...13 Retinoic acid binding 15472229 UGT1A10 Q9HAW8 UDP-glucuronosyltransferase 110 Protein kinase c binding 15258099 UGT2B7 P16662 UDP-glucuronosyltransferase 2B7 Glucuronosyltransferase activity 10702251 UGT2B17 O75795 UDP-glucuronosyltransferase 2B17 Glucuronosyltransferase activity 8798464 CYP2C8 P10632 Cytochrome P450 2C8 Steroid hydroxylase activity 7574697 CYP2C9 P11712 Cytochrome P450 2C9 Steroid hydroxylase activity 9435160...”
• Establishing the capacity to monitor proteins relevant to the study of drug exposure and response using liver-derived extracellular vesicles.
  Newman, British journal of clinical pharmacology 2024
  • “...2B4 (UGT2B4) P06133 Liver, intestine, kidney Medium High in intestine, kidney DME UDPglucuronosyltransferase 2B7 (UGT2B7) P16662 Liver, kidney High High in kidney, medium in intestine Group 3: Extrahepatic tissue enrichment or ubiquitous expression MDT AcetylCoA carboxylase 1 (ACACA) Q13085 Nonspecific High Ubiquitous MDT AcetylCoA carboxylase 2...”
• Computer-Aided Drug Design (CADD) to De-Orphanize Marine Molecules: Finding Potential Therapeutic Agents for Neurodegenerative and Cardiovascular Diseases.
  Llorach-Pares, Marine drugs 2022
  • “...one complex per molecule. For Hodgsonal, Polyrhaphin-A and Dendrinolide, a complex targeting P11511, P04798, and P16662, respectively, was selected. Two complexes targeting P15428 and P00352 were selected for Rossinone-A. For Meridianin-A, three complexes targeting Q9Y463, P15428, and P49759 were selected, and for Aplicyanin-A three complexes with...”
  • “...substrate binding region, it could still be considered, but if not, it should be discarded. P16662, UDP-glucuronosyltransferase 2B7 (UGT2B7), catalyzes the conjugative elimination of drugs as this enzyme is involved in the detoxification of endogenous and exogenous compounds [ 83 , 136 , 137 ]. It...”
• Licorice extract inhibits growth of non-small cell lung cancer by down-regulating CDK4-Cyclin D1 complex and increasing CD8⁺ T cell infiltration
  Zhu, Cancer cell international 2021
  • “...P11413 Glucose-6-phosphate 1-dehydrogenase G6PD 1 Homo sapiens P11473 Vitamin D3 receptor VDR 1 Homo sapiens P16662 UDP-glucuronosyltransferase 2B7 UGT2B7 1 Homo sapiens P18405 3-oxo-5-alpha-steroid 4-dehydrogenase 1 SRD5A1 1 Homo sapiens P19793 Retinoic acid receptor RXR-alpha RXRA 7 Homo sapiens P36873 Serine/threonine-protein phosphatase PP1-gamma catalytic subunit PPP1CC...”
• Network Pharmacology-Based Prediction of Mechanism of Shenzhuo Formula for Application to DKD
  Wang, Evidence-based complementary and alternative medicine : eCAM 2021
  • “...receptor delta PPARD Q03181 19 Peroxisome proliferator-activated receptor gamma PPARG P37231 20 UDP-glucuronosyltransferase 2B7 UGT2B7 P16662 21 11-Beta-hydroxysteroid dehydrogenase 2 HSD11B2 P80365 22 NADPH oxidase 4 NOX4 Q9NPH5 23 Tyrosine-protein kinase SYK SYK P43405 24 Glycogen synthase kinase-3 beta GSK3B P49841 25 Matrix metalloproteinase 9 MMP9...”
  • “...receptor delta PPARD Q03181 19 Peroxisome proliferator-activated receptor gamma PPARG P37231 20 UDP-glucuronosyltransferase 2B7 UGT2B7 P16662 21 11-beta-hydroxysteroid dehydrogenase 2 HSD11B2 P80365 22 NADPH oxidase 4 NOX4 Q9NPH5 23 Tyrosine-protein kinase SYK SYK P43405 24 Glycogen synthase kinase-3 beta GSK3B P49841 25 Matrix metalloproteinase 9 MMP9...”
• AOPM: Application of Antioxidant Protein Classification Model in Predicting the Composition of Antioxidant Drugs.
  Zhai, Frontiers in pharmacology 2021
  • “...The UniProt ID of 36 protein sequences. UniProt ID Drug Type P47989 Carvedilol, Allopurinol enzyme P16662 Carvedilol enzyme P06133 Carvedilol enzyme P22309 Carvedilol, Silibinin enzyme Q16881 Ascorbic acid, Selenium enzyme P00441 Vitamin E, alpha-Tocopherol succinate enzyme Q96I15 Selenium enzyme P16435 Lipoic acid enzyme P15559 Vitamin E,...”
• Protopanaxadiol improves endometriosis associated infertility and miscarriage in sex hormones receptors-dependent and independent manners.
  Lai, International journal of biological sciences 2021
  • “...Nuclear receptor 72/46 20 Q9UHC9 NPC1L1 Niemann-Pick C1-like protein 1 Other membrane protein 15/11 21 P16662 UGT2B7 UDP-glucuronosyltransferase 2B7 Enzyme 0/22 22 O00748 CES2 Carboxylesterase 2 Enzyme 8/7 23 Q14994 NR1I3 Nuclear receptor subfamily 1 group I member 3 Nuclear receptor 1/2 24 P06276 BCHE Butyrylcholinesterase...”
• Electromembrane Extraction and Mass Spectrometry for Liver Organoid Drug Metabolism Studies.
  Skottvoll, Analytical chemistry 2021
  • “...number P23141), hCES2 (also called cocaine esterase, accession number O00748), and UDP-glucuronosyltransferase 2B7 (accession number P16662) were obtained and verified by comparison with the raw file. Calculation of Recovery Recovery measurements were performed using capillary electrophoresis with ultraviolet spectroscopy detection (CE-UV) (see Supporting Information for experimental...”
• More

MGC152010 UDP glucuronosyltransferase 2 family precursor from Bos taurus
45% identity, 94% coverage

• Detection of Genomic Imprinting for Carcass Traits in Cattle Using Imputed High-Density Genotype Data
  Kenny, Frontiers in genetics 2022
  • “...6 84,171,205 8,4195,787 TMPRSS11F (381), TMPRSS11BNL (259), NAP1L1 (253), TMPRSS11E (177), YTHDC1 (31), UGT2B10 (248), MGC152010 (478) 8 11,601,528 11,605,893 SCARA3 (442), CLU (407), TMEM215 (266), NDUFB6 (81), TOPORS (69), DDX58 (0), ACO1 (6) 22 10,225,287 10,229,539 ARPP21 (467), STAC (0), LRRFIP2 (118), MLH1 (228), EPM2AIP1...”
• Gene-based mapping and pathway analysis of metabolic traits in dairy cows
  Ha, PloS one 2015
  • “...dairy cows. Also noticeable are the genes UGT2B15 (UDP glucuronosyltransferase 2 family, polypeptide B15) and MGC152010 (UDP glucuronosyltransferase 2 family) associated with the ratio of NEFA (T3/T1) with p-values of p = 1 . 1110 -15 and p = 1 . 2710 -11 , respectively. This...”

AAA18020.1 glucuronosyltransferase (EGT10;UGT2B13) (EC 2.4.1.17) (see protein)
45% identity, 94% coverage

UD2A2_HUMAN / P0DTE5 UDP-glucuronosyltransferase 2A2; UDPGT 2A2; EC 2.4.1.17 from Homo sapiens (Human) (see 4 papers)
44% identity, 90% coverage

• function: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile (PubMed:18719240, PubMed:19858781, PubMed:23288867, PubMed:23756265). Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds (PubMed:19858781, PubMed:23756265). Catalyzes the glucuronidation of endogenous estrogen hormone estradiol (PubMed:18719240, PubMed:23288867). Contributes to bile acid (BA) detoxification by catalyzing the glucuronidation of BA substrates, which are natural detergents for dietary lipids absorption (PubMed:23756265). Shows a potential role in detoxification of toxic waste compounds in the amniotic fluid before birth, and air-born chemical after birth (PubMed:19858781).
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
  catalytic activity: 17alpha-estradiol + UDP-alpha-D-glucuronate = 17alpha- estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52868)
  catalytic activity: 17beta-estradiol + UDP-alpha-D-glucuronate = 17beta-estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52460)
  catalytic activity: chenodeoxycholate + UDP-alpha-D-glucuronate = chenodeoxycholoyl-24-O-(beta-D-glucuronate) + UDP (RHEA:52940)
  catalytic activity: lithocholate + UDP-alpha-D-glucuronate = lithocholoyl-24-O- (beta-D-glucuronate) + UDP (RHEA:52952)
  catalytic activity: deoxycholate + UDP-alpha-D-glucuronate = deoxycholoyl-24-O- (beta-D-glucuronate) + UDP (RHEA:52948)
  catalytic activity: hyocholate + UDP-alpha-D-glucuronate = hyocholoyl-24-O-(beta- D-glucuronate) + UDP (RHEA:52960)
  catalytic activity: hyodeoxycholate + UDP-alpha-D-glucuronate = hyodeoxycholate 6- O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52964)

D2SMM0 glucuronosyltransferase (EC 2.4.1.17) from Papio anubis (see paper)
46% identity, 94% coverage

XP_016864074 UDP-glucuronosyltransferase 2B10 isoform X1 from Homo sapiens
45% identity, 98% coverage

• UGT2B10 Genotype Influences Serum Cotinine Levels and Is a Primary Determinant of Higher Cotinine in African American Smokers.
  Sipe, Cancer epidemiology, biomarkers & prevention : a publication of the American Association for Cancer Research, cosponsored by the American Society of Preventive Oncology 2020
  • GeneRIF: UGT2B10 Genotype Influences Serum Cotinine Levels and Is a Primary Determinant of Higher Cotinine in African American Smokers.
• rs294775 is a cis-regulatory SNP for human UGT2B10.
  Ruan, Clinical and experimental pharmacology & physiology 2018 (PubMed)
  • GeneRIF: a cis-regulatory SNP for human UGT2B10
• Post-transcriptional Regulation of UGT2B10 Hepatic Expression and Activity by Alternative Splicing.
  Labriet, Drug metabolism and disposition: the biological fate of chemicals 2018
  • GeneRIF: A significant contribution of AS in the regulation of UGT2B10 expression in the liver.
• Influence of UGT2B10 Genotype on Urinary Excretion of 4-(Methylnitrosamino)-1-(3-pyridyl)-1-butanol- N-glucuronide by African American Smokers.
  Murphy, Chemical research in toxicology 2018
  • GeneRIF: The high prevalence of a UGT2B10 splice variant among African Americans results in lower 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanol (NNAL), - N-glucuronidation but only a small decrease in total NNAL glucuronidation. Therefore, despite the significant contribution of UGT2B10 to NNAL- N-glucuronidation, the UGT2B10 genotype does not play a large role in NNAL detoxication.
• Disposition of Mianserin and Cyclizine in UGT2B10-Overexpressing Human Embryonic Kidney 293 Cells: Identification of UGT2B10 as a Novel N-Glucosidation Enzyme and Breast Cancer Resistance Protein as an N-Glucoside Transporter.
  Lu, Drug metabolism and disposition: the biological fate of chemicals 2018 (PubMed)
  • GeneRIF: UGT2B10 was for the first time identified as an N-glucosidation enzyme. Generated N-glucosides were excreted primarily by the BCRP transporter.
• Low Cotinine Glucuronidation Results in Higher Serum and Saliva Cotinine in African American Compared to White Smokers.
  Murphy, Cancer epidemiology, biomarkers & prevention : a publication of the American Association for Cancer Research, cosponsored by the American Society of Preventive Oncology 2017
  • GeneRIF: UGT2B10 activity or genotype should be considered when using cotinine as a tobacco exposure biomarker, particularly in populations such as African American with high frequencies of UGT2B10 nonfunctional variants.
• Human UDP-Glucuronosyltransferase (UGT) 2B10: Validation of Cotinine as a Selective Probe Substrate, Inhibition by UGT Enzyme-Selective Inhibitors and Antidepressant and Antipsychotic Drugs, and Structural Determinants of Enzyme Inhibition.
  Pattanawongsa, Drug metabolism and disposition: the biological fate of chemicals 2016 (PubMed)
  • GeneRIF: Spatial features influence the potency of UGT2B10 inhibition.
• Nicotine N-glucuronidation relative to N-oxidation and C-oxidation and UGT2B10 genotype in five ethnic/racial groups.
  Murphy, Carcinogenesis 2014
  • GeneRIF: UGT2B10 variant allele carriers had increased levels of C-oxidation (P = 0.0099)and all pathways should be considered when characterizing the role of nicotine metabolism on smoking behavior and cancer risk.
• More

AAD24435.1 Glucuronosyltransferase 2B19 (EC 2.4.1.17) (see protein)
45% identity, 95% coverage

LOC110262116 UDP-glucuronosyltransferase 2C1-like from Sus scrofa
44% identity, 94% coverage

• Whole-genome sequencing of European autochthonous and commercial pig breeds allows the detection of signatures of selection for adaptation of genetic resources to different breeding and production systems
  Bovo, Genetics, selection, evolution : GSE 2020
  • “...YTHDC1 d , LOC100515741 d , LOC100516628 b , LOC100624891 d , LOC110262115 d , LOC110262116 d , LOC100623504 d , LOC100515394 d , UGT2B31 b 8:66,900,00167,000,001 Bsara, Sarda LOC110262013 d , CABS1 d , LOC110262014 d , ODAM d , LOC100624541 d , PRR27 d...”

UDB17_HUMAN / O75795 UDP-glucuronosyltransferase 2B17; UDPGT 2B17; UGT2B17; C19-steroid-specific UDP-glucuronosyltransferase; C19-steroid-specific UDPGT; EC 2.4.1.17 from Homo sapiens (Human) (see 6 papers)
O75795 glucuronosyltransferase (EC 2.4.1.17) from Homo sapiens (see 12 papers)
AAC25491.1 UDP-GlcA: glucuronosyltransferase 2B17 (Ugt2b17) (EC 2.4.1.17) (see protein)
NP_001068 UDP-glucuronosyltransferase 2B17 precursor from Homo sapiens
44% identity, 92% coverage

• function: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile (PubMed:16595710, PubMed:18719240, PubMed:19022937, PubMed:23288867, PubMed:8798464). Catalyzes the glucuronidation of endogenous steroid hormones such as androgens (epitestosterone, androsterone) and estrogens (estradiol, epiestradiol) (PubMed:16595710, PubMed:18719240, PubMed:19022937, PubMed:23288867, PubMed:8798464).
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
  catalytic activity: 17alpha-estradiol + UDP-alpha-D-glucuronate = 17alpha- estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52868)
  catalytic activity: 17alpha-estradiol + UDP-alpha-D-glucuronate = 17alpha- estradiol 17-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52872)
  catalytic activity: 17beta-estradiol + UDP-alpha-D-glucuronate = 17beta-estradiol 17-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52464)
  catalytic activity: 17beta-hydroxy-5alpha-androstan-3-one + UDP-alpha-D- glucuronate = 5alpha-dihydrotestosterone 17-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53000)
  catalytic activity: testosterone + UDP-alpha-D-glucuronate = testosterone 17-O- (beta-D-glucuronate) + UDP + H(+) (RHEA:52456)
• Cytochrome P450 3A gene family and medication in childhood nephrotic syndrome: An update.
  Kochuthakidiyel, Global medical genetics 2025
  • “...UDP-glucuronosyltransferase 110 Protein kinase c binding 15258099 UGT2B7 P16662 UDP-glucuronosyltransferase 2B7 Glucuronosyltransferase activity 10702251 UGT2B17 O75795 UDP-glucuronosyltransferase 2B17 Glucuronosyltransferase activity 8798464 CYP2C8 P10632 Cytochrome P450 2C8 Steroid hydroxylase activity 7574697 CYP2C9 P11712 Cytochrome P450 2C9 Steroid hydroxylase activity 9435160 Furosemide DB00695 PGD P52209 6-phosphogluconate dehydrogenase, decarboxylating...”
• Interpreting the Molecular Mechanisms of Yinchenhao Decoction on Hepatocellular Carcinoma through Absorbed Components Based on Network Pharmacology
  Sun, BioMed research international 2021
  • “...Q9HAW9 Tar100 UGT1A9 UDP-glucuronosyltransferase 1A9 Q62452 Tar101 UGT2B15 UDP-glucuronosyltransferase 2B15 P54855 Tar102 UGT2B17 UDP-glucuronosyltransferase 2B17 O75795 Tar103 VCAM1 Vascular cell adhesion protein 1 P19320 Tar104 VEGFA Vascular endothelial growth factor A P15692 Tar105 XDH Xanthine dehydrogenase/oxidase P47989 Table 3 Regulatory network analyses and calculation results of...”
• Identification and Verification of the Main Differentially Expressed Proteins in Gastric Cancer via iTRAQ Combined with Liquid Chromatography-Mass Spectrometry
  Gao, Analytical cellular pathology (Amsterdam) 2019
  • “...-05 37 Q14315 Filamin-C OS=Homo sapiens GN=FLNC PE=1 SV=3 (FLNC_HUMAN) 0.478864 3.98 E -05 38 O75795 UDP-glucuronosyltransferase 2B17 OS=Homo sapiens GN=UGT2B17 PE=1 SV=1 (UDB17_HUMAN) 0.486547 5.80 E -05 39 B2RTX2 Palladin, cytoskeletal associated protein OS=Homo sapiens GN=PALLD PE=2 SV=1 (B2RTX2_HUMAN) 0.491737 7.42 E -05 40 G3V144...”
• Ulcerative colitis: functional analysis of the in-depth proteome.
  Schniers, Clinical proteomics 2019
  • “...l -fucosidase FUCA1 P04066 10.42 0.37 Phospholipase A(2) PLA2G1B F8W062 2.71 0.38 UDP-glucuronosyltransferase 2B17 UGT2B17;UGT2B15 O75795 3.10 0.38 Aquaporin-8 AQP8 Q53GF6 7.86 0.38 Mimecan OGN Q7Z532 9.66 0.39 Cadherin-17 CDH17 Q12864 17.16 0.39 Alcohol dehydrogenase 1C ADH1C P00326 10.05 Included are only significantly different proteins as...”
• Proteomics analysis of colon cancer progression.
  Saleem, Clinical proteomics 2019
  • “...6.00 116 3 13 2.70 4.18 4.28 Excretion, transport of metabolites and modification of xenobiotics O75795 UDP-glucuronosyltransferase 2B17 UGT2B17 61.055 8.54 895 8 14 6.21 4.49 5.67 P40879 Chloride anion exchanger SLC26A3 84.451 8.69 91 2 3 4.01 4.36 4.89 Q6UWM9 UDP-glucuronosyltransferase 2A3 UGT2A3 60.215 7.96...”
• Effect of Inulin on Proteome Changes Induced by Pathogenic Lipopolysaccharide in Human Colon
  Guarino, PloS one 2017
  • “...Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS = Homo sapiens GN = ACADVL[ACADV_HUMAN] 1,0 1,3 O75795 UDP-glucuronosyltransferase 2B17 OS = Homo sapiens GN = UGT2B17 PE = 2 SV = 1 - [UDB17_HUMAN] 1,0 1,7 P06133 UDP-glucuronosyltransferase 2B4 OS = Homo sapiens GN = UGT2B4 PE...”
• Probing the prostate tumour microenvironment II: Impact of hypoxia on a cell model of prostate cancer progression
  Tonry, Oncotarget 2017
  • “...v AI Up 3 Q8TEM1 PO210_HUMAN 5.4 7.9 8 Hour AS v AI Up 3 O75795 UDB17_HUMAN 6.9 8.2 8 Hour AS v AI Up 3 P30533 AMRP_HUMAN 18.2 8.5 24 Hour AS v AI Up 3 Q9UM54-6 MYO6_HUMAN 4.9 3.2 8 Hour AS v AI...”
• Sorbitol dehydrogenase overexpression and other aspects of dysregulated protein expression in human precancerous colorectal neoplasms: a quantitative proteomics study.
  Uzozie, Molecular & cellular proteomics : MCP 2014
• Promiscuity and Quantitative Contribution of UGT2B17 in Drug and Steroid Metabolism Determined by Experimental and Computational Approaches.
  Ahire, Journal of chemical information and modeling 2024 (PubMed)
  • GeneRIF: Promiscuity and Quantitative Contribution of UGT2B17 in Drug and Steroid Metabolism Determined by Experimental and Computational Approaches.
• Extensive metabolic consequences of human glycosyltransferase gene knockouts in prostate cancer.
  Rouleau, British journal of cancer 2023
  • GeneRIF: Extensive metabolic consequences of human glycosyltransferase gene knockouts in prostate cancer.
• A Non-Canonical Role for the Glycosyltransferase Enzyme UGT2B17 as a Novel Constituent of the B Cell Receptor Signalosome.
  Wagner, Cells 2023
  • GeneRIF: A Non-Canonical Role for the Glycosyltransferase Enzyme UGT2B17 as a Novel Constituent of the B Cell Receptor Signalosome.
• Pangenomic analysis of Chinese gastric cancer.
  Yu, Nature communications 2022
  • GeneRIF: Genes ACOT1, GSTM1, SIGLEC14 and UGT2B17 are identified as highly absent genes in gastric cancer population.
• Expression of UDP Glucuronosyltransferases 2B15 and 2B17 is associated with methylation status in prostate cancer cells.
  Shafiee-Kermani, Epigenetics 2021
  • GeneRIF: Expression of UDP Glucuronosyltransferases 2B15 and 2B17 is associated with methylation status in prostate cancer cells.
• Potential Assessment of UGT2B17 Inhibition by Salicylic Acid in Human Supersomes In Vitro.
  Salhab, Molecules (Basel, Switzerland) 2021
  • GeneRIF: Potential Assessment of UGT2B17 Inhibition by Salicylic Acid in Human Supersomes In Vitro.
• Prognostic impact of genetic variants of CYP19A1 and UGT2B17 in a randomized trial for endocrine-responsive postmenopausal breast cancer.
  Johansson, The pharmacogenomics journal 2020 (PubMed)
  • GeneRIF: Prognostic impact of genetic variants of CYP19A1 and UGT2B17 in a randomized trial for endocrine-responsive postmenopausal breast cancer.
• Alternative promoters control UGT2B17-dependent androgen catabolism in prostate cancer and its influence on progression.
  Lévesque, British journal of cancer 2020
  • GeneRIF: Alternative promoters control UGT2B17-dependent androgen catabolism in prostate cancer and its influence on progression.
• More

LOC100624891 UDP-glucuronosyltransferase 2C1 from Sus scrofa
43% identity, 94% coverage

• Whole-genome sequencing of European autochthonous and commercial pig breeds allows the detection of signatures of selection for adaptation of genetic resources to different breeding and production systems
  Bovo, Genetics, selection, evolution : GSE 2020
  • “...Lithuanian Indigenous Wattle LOC100515222 d , YTHDC1 d , LOC100515741 d , LOC100516628 b , LOC100624891 d , LOC110262115 d , LOC110262116 d , LOC100623504 d , LOC100515394 d , UGT2B31 b 8:66,900,00167,000,001 Bsara, Sarda LOC110262013 d , CABS1 d , LOC110262014 d , ODAM d...”

UDB28_HUMAN / Q9BY64 UDP-glucuronosyltransferase 2B28; UDPGT 2B28; UGT2B28; EC 2.4.1.17 from Homo sapiens (Human) (see paper)
Q9BY64 glucuronosyltransferase (EC 2.4.1.17) from Homo sapiens (see paper)
45% identity, 94% coverage

• function: [Isoform 1]: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile (PubMed:11300766). Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds (PubMed:11300766). Catalyzes the glucuronidation of endogenous steroid hormones such as androgens (androsterone, 3alpha-androstanediol) and estrogens (estradiol, estrone) (PubMed:11300766). Catalyzes the glucuronidation of bile acid substrates, which are natural detergents for dietary lipids absorption (PubMed:11300766). Displays glucuronidation activity toward the phenolic compounds eugenol (PubMed:11300766).
  function: [Isoform 2]: Lack UDP-glucuronosyltransferase (UGT) activity.
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)

UD2B1_RAT / P09875 UDP-glucuronosyltransferase 2B1; UDPGT 2B1; UGT2B1; UDPGTr-2; EC 2.4.1.17 from Rattus norvegicus (Rat) (see paper)
P09875 glucuronosyltransferase (EC 2.4.1.17) from Rattus norvegicus (see 2 papers)
AAA42310.1 Glucuronosyltransferase 2B1 (Ugt2b1) (EC 2.4.1.17) (see protein)
44% identity, 94% coverage

• function: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile (PubMed:18719240). Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds (PubMed:18719240). Catalyzes the glucuronidation of the endogenous estrogen hormone estradiol (PubMed:18719240).
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
  catalytic activity: 17beta-estradiol + UDP-alpha-D-glucuronate = 17beta-estradiol 17-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52464)
• The Influence of Lipid Microdomain Heterogeneity on Protein-Protein Interactions: Proteomic Analysis of Co-Immunoprecipitated Binding Partners of P450 1A2 and P450 3A in Rat Liver Microsomes
  Reed, Drug metabolism and disposition: the biological fate of chemicals 2023 (secret)
• Hyperoside attenuates non-alcoholic fatty liver disease in rats via cholesterol metabolism and bile acid metabolism.
  Wang, Journal of advanced research 2021
  • “...export pump 1.44 0.0006 Q08201 Abcb4 10 9 7 10.3 Phosphatidylcholine translocator ABCB4 1.38 0.0272 P09875 Ugt2b1 25 3 0 50.4 UDP-glucuronosyltransferase 2B1 1.22 0.0484 Fatty acid degradation P23965 ECI1, DCI 14 14 1 48.1 Delta3-Delta2-enoyl-CoA isomerase [EC:5.3.3.8] 1.19 0.0145 P70584 ACADSB 15 15 15 51.2...”
• Functional proteomic analysis of corticosteroid pharmacodynamics in rat liver: Relationship to hepatic stress, signaling, energy regulation, and drug metabolism.
  Ayyar, Journal of proteomics 2017
  • “...Ugt1a9 UDP-glucuronosyltransferase 1A9 Drugs = R-oxepam, mycophenolic acid, SN-38 (irinotecan); halogenated phenols; polymorphic enzyme DOWN P09875 Ugt2b1 UDP-glucuronosyltransferase 2B1 Drug = diclofenac ; bisphenol A (environmental chemical) UP P36511 Ugt2b15 UDP-glucuronosyltransferase 2B15 Drug = S-oxazepam, paracetamol, (+)-menthol, and eugenol; polymorphic enzyme UP P08542 Ugt2b17 UDP-glucuronosyltransferase 2B17...”
• Phenobarbital induces alterations in the proteome of hepatocytes and mesenchymal cells of rat livers.
  Klepeisz, PloS one 2013
  • “...process P17988 Sulfotransferase 1A1 drug metabolic process P08011 Microsomal glutathione S-transferase 1 drug metabolic process P09875 t, PB UDP-glucuronosyltransferase 2B1 drug metabolic process P19488 t, PB UDP-glucuronosyltransferase 2B37 drug metabolic process P97675 Ectonucleotide pyrophosphatase / phosphodiesterase family member 3 (E-NPP 3) (B10) immune response P07151 Beta-2-microglobulin...”
• Development of a pharmaceutical hepatotoxicity biomarker panel using a discovery to targeted proteomics approach
  Collins, Molecular & cellular proteomics : MCP 2012
  • “...P23965 Q4V8F9 Q64591 O88267 P04903 P07687 P07896 P08516 P09875 P14141 P21775 P38918 P51647 Q6I7R1 O55171 P00176 P04182 P04906 P05369 P06757 P13697 P36365 Q5XI60...”
• Proteomic analysis of interchromatin granule clusters.
  Saitoh, Molecular biology of the cell 2004

BAB82476.1 UDP-glucuronosyltransferase 2B21 (UGT2B21) (EC 2.4.1.17) (see protein)
45% identity, 94% coverage

UD2A3_CAVPO / Q9R110 UDP-glucuronosyltransferase 2A3; UDPGT 2A3; EC 2.4.1.17 from Cavia porcellus (Guinea pig) (see paper)
AAD51732.1 UDP glucuronosyltransferase UGT2A3 (EC 2.4.1.17) (see protein)
44% identity, 94% coverage

• function: UDP-glucuronosyltransferases catalyze phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. They are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds (By similarity).
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)

UDB30_MACFA / Q8WN97 UDP-glucuronosyltransferase 2B30; UDPGT 2B30; EC 2.4.1.17 from Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) (see paper)
45% identity, 95% coverage

• function: UDPGTs are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. This isozyme has glucuronidating capacity on testosterone, dihydrotestosterone, 5-alpha-androstane-3-alpha,17-beta-diol, androsterone, oestradiol, tetrahydroaldosterone and tetrahydrocortisone. This enzyme is essential to inactivation of several steroids
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)

A0A4Y1K7J9 glucuronosyltransferase (EC 2.4.1.17) from Macaca fascicularis (see paper)
44% identity, 91% coverage

LOC781988 uncharacterized protein LOC781988 precursor from Bos taurus
43% identity, 92% coverage

• Genome-wide association analysis for β-hydroxybutyrate concentration in Milk in Holstein dairy cattle
  Nayeri, BMC genetics 2019
  • “...rs29018853 6 88732184 88728581; 88724389; 88735599; 79273130; 79203343 ENSBTAG00000013718 GC BovineHD0600023797 rs135797682 6 86686282 ENSBTAG00000015047 LOC781988 BovineHD0600023599; BovineHD0600023609 rs135335675; rs136617775 6 85838311; 85861013 ENSBTAG00000015572 YTHDC1 BovineHD0600024791 rs109793149 6 90557327 ENSBTAG00000019716 CXCL8 Hapmap43767-BTA-113302 rs41618641 6 85646902 ENSBTAG00000038520 NA Hapmap60224-rs29001782 rs29001782 6 85178107 ENSBTAG00000038648 LOC100140490 BovineHD0600023676 rs136388495 6...”
• Single nucleotide polymorphism and haplotype effects associated with somatic cell score in German Holstein cattle
  Abdel-Shafy, Genetics, selection, evolution : GSE 2014
  • “...1.84E-07 0.44 GNRHR, TMPRSS11D UBA6 BTA6_Hap8 6 86642355 86904512 0.26 AGGG 0.38 0.107 4.08E-08 0.54 LOC781988, UGT2A1 SULT1B1 BTA6_Hap12* 6 87929420 88174863 0.25 AAGGGC 0.32 0.103 3.37E-07 0.46 GRSF1, MOB1B, DCK IGJ , DBP BTA13_Hap10* 13 78383148 78858126 0.47 AAAGGAG 0.14 0.12 3.60E-08 0.33 SLC9A8, RNF114...”

Q5RFJ3 UDP-glucuronosyltransferase 2A3 from Pongo abelii
44% identity, 94% coverage

• Novel polymorphic human UDP-glucuronosyltransferase 2A3: cloning, functional characterization of enzyme variants, comparative tissue expression, and gene induction
  Court, Molecular pharmacology 2008 (secret)

Q6UWM9 glucuronosyltransferase (EC 2.4.1.17) from Homo sapiens (see 3 papers)
NP_079019 UDP-glucuronosyltransferase 2A3 precursor from Homo sapiens
44% identity, 94% coverage

• Bioinformatic characterization of ENPEP, the gene encoding a potential cofactor for SARS-CoV-2 infection.
  Arppo, PloS one 2024
  • “...cortex TINAG 0.8463 14599 Q9UJW2 Tubulointerstitial nephritis antigen cysteine protease Kidney cortex UGT2A3 0.8434 28528 Q6UWM9 UDP-glucuronosyltransferase 2A3 Kidney cortex UGT1A9 0.8335 12541 O60656 UDP-glucuronosyltransferase 1A9 glycosyltransferase Kidney cortex ANPEP 0.8259 500 P15144 Aminopeptidase N metalloprotease Kidney cortex SLC4A4 0.8179 11030 Q9Y6R1 Electrogenic sodium bicarbonate cotransporter...”
• Proteomics analysis of colon cancer progression.
  Saleem, Clinical proteomics 2019
  • “...4.49 5.67 P40879 Chloride anion exchanger SLC26A3 84.451 8.69 91 2 3 4.01 4.36 4.89 Q6UWM9 UDP-glucuronosyltransferase 2A3 UGT2A3 60.215 7.96 234 4 10 3.83 6.25 Q14CN2 Calcium-activated chloride channel regulator 4 CLCA4 PE=1 1S0V1=.219 5.47 274 5 6 3.59 P54289 Voltage-dependent calcium channel subunit alpha-2/delta-1...”
• Ulcerative colitis: functional analysis of the in-depth proteome.
  Schniers, Clinical proteomics 2019
  • “...beta PKIB Q5T0Z6 7.57 0.34 Chloride anion exchanger SLC26A3;DKFZp686P10213 P40879 10.33 0.35 UDP-glucuronosyltransferase 2A3 UGT2A3 Q6UWM9 14.95 0.36 Chymotrypsin-C CTRC Q99895 5.37 0.36 Hyaluronan and proteoglycan link protein 3 HAPLN3 A0A024RC58 8.55 0.37 Calcium-activated chloride channel regulator 1 CLCA1 A8K7I4 6.68 0.37 Tissue alpha- l -fucosidase...”
• Quantitative proteomics reveal the anti-tumour mechanism of the carbohydrate recognition domain of Galectin-3 in Hepatocellular carcinoma.
  Wang, Scientific reports 2017
  • “...0.62 9 10 P28332 ADH6 0.65 0.69 9 10 Q96A26 FAM162A 0.66 0.65 6 4 Q6UWM9 UGT2A3 0.67 0.48 8 6 Data mining of differentially expressed proteins To obtain a biological view of 190 differentially expressed proteins, Gene Ontology (GO) enrichment analysis for biological process, cell...”
• MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
  Zhang, Carcinogenesis 2010
  • GeneRIF: Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
• Human UDP-glucuronosyltransferase UGT2A2: cDNA construction, expression, and functional characterization in comparison with UGT2A1 and UGT2A3.
  Sneitz, Pharmacogenetics and genomics 2009
  • GeneRIF: Results show that UGT2A2 not only shares exons 2-6 with UGT2A1, it also shares with it a similar tissue expression pattern; both UGTs are primarily expressed in nasal epithelium. The 3rd member of UGT2A subfamily, UGT2A3 exhibited a different tissue expression pattern, found mainly in liver and small intestine.
• Novel polymorphic human UDP-glucuronosyltransferase 2A3: cloning, functional characterization of enzyme variants, comparative tissue expression, and gene induction.
  Court, Molecular pharmacology 2008
  • GeneRIF: This is the first report establishing UGT2A3 as a functional enzyme.
  • GeneRIF: Describes initial cloning, expression and functional characterization of UGT2A3. Shows mRNA expression primarily in liver and intestines; and selective glucuronidation of bile acids, particularly hyodeoxycholic acid.
• Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
  Rose, Molecular medicine (Cambridge, Mass.)
  • GeneRIF: Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

D2SML9 glucuronosyltransferase (EC 2.4.1.17) from Papio anubis (see paper)
43% identity, 95% coverage

• Proteomic profiling of regenerated urinary bladder tissue with stem cell seeded scaffold composites in a non-human primate bladder augmentation model.
  Sharma, bioRxiv : the preprint server for biology 2023
  • “...transport; developmental processes; other biological processes cytoskeleton;other cell component cytoskeletal activity;other molecular function 3.28 0.015 D2SML9 UGT2B43 UDP-g1ucurortosyltransferase endoplasmic reticulum membrane glucuronosyltransferase activity 3.29 0.007 A0A8I5R289 CA13 Carbonic anhydrase cytosol;intracellular membrane-bounded organelle;myelin sheath carbonate dehydratase activity;zinc ion binding 3.30 0.031 A0A096NF33 AGR3 Anterior gradient 3, protein...”

NP_775445 UDP-glucuronosyltransferase 2B7 precursor from Rattus norvegicus
43% identity, 96% coverage

• Inhibition of UGT2B7 Enzyme Activity in Human and Rat Liver Microsomes by Herbal Constituents.
  Abdullah, Molecules (Basel, Switzerland) 2018
  • GeneRIF: Meanwhile, only mitragynine and zerumbone inhibited ZDV(probe substrate to determine UGT2B7 activity) glucuronidation in RLM with IC50 values of 51.20 +/- 5.95 muM and 8.14 +/- 2.12 microM, respectively, indicating a difference between the human and rat microsomal model so caution must be exercised when extrapolating inhibitory metabolic data from rats to humans.
• Acute liver failure enhances oral plasma exposure of zidovudine in rats by downregulation of hepatic UGT2B7 and intestinal P-gp.
  Wang, Acta pharmacologica Sinica 2017
  • GeneRIF: Acute liver failure significantly increases the oral plasma exposure of zidovudine in rats, a result partly attributed to the impaired function and expression of hepatic UGT2B7 and intestinal P-gp.
• Human UDP-glucuronosyltransferase isoforms involved in haloperidol glucuronidation and quantitative estimation of their contribution.
  Kato, Drug metabolism and disposition: the biological fate of chemicals 2012 (PubMed)
  • GeneRIF: Data suggest that UGT2B7 is the predominant activity in liver microsomes for haloperidol O-glucuronidation (in both rat and human).

AAD08808.1 Glucuronosyltransferase 2B20 (EC 2.4.1.17) (see protein)
43% identity, 95% coverage

AAB28536.1 UDP-GlcA: glucuronosyltransferase 2B15 (Ugt2b15) (EC 2.4.1.17) (see protein)
44% identity, 92% coverage

UDB15_HUMAN / P54855 UDP-glucuronosyltransferase 2B15; UDPGT 2B15; UGT2B15; HLUG4; UDP-glucuronosyltransferase 2B8; UDPGT 2B8; UDPGTh-3; EC 2.4.1.17 from Homo sapiens (Human) (see 6 papers)
P54855 glucuronosyltransferase (EC 2.4.1.17) from Homo sapiens (see 17 papers)
NP_001067 UDP-glucuronosyltransferase 2B15 precursor from Homo sapiens
44% identity, 92% coverage

• function: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile (PubMed:16595710, PubMed:18719240, PubMed:23288867, PubMed:7835232, PubMed:9295060). Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds (PubMed:7835232). Catalyzes the glucuronidation of endogenous steroid hormones such as androgens (testosterone, androsterone) and estrogens (estradiol, epiestradiol, estriol, catechol estrogens) (PubMed:16595710, PubMed:18719240, PubMed:23288867, PubMed:7835232, PubMed:9295060). Displays glucuronidation activity toward several classes of xenobiotic substrates, including phenolic compounds (eugenol, 4-nitrophenol, 4-hydroxybiphenyl) and phenylpropanoids (naringenin, coumarins) (PubMed:7835232). Catalyzes the glucuronidation of monoterpenoid alcohols such as borneol, menthol and isomenthol, a class of natural compounds used in essential oils (By similarity).
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
  catalytic activity: 17alpha-estradiol + UDP-alpha-D-glucuronate = 17alpha- estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52868)
  catalytic activity: 16alpha,17alpha-estriol + UDP-alpha-D-glucuronate = 16alpha,17alpha-estriol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52924)
  catalytic activity: 17beta-hydroxy-5alpha-androstan-3-one + UDP-alpha-D- glucuronate = 5alpha-dihydrotestosterone 17-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53000)
• Identification of UDP-Glucuronosyltransferase 2B15 (UGT2B15) as a Target for IGF1 and Insulin Action.
  Sarfstein, Cells 2022
  • GeneRIF: Identification of UDP-Glucuronosyltransferase 2B15 (UGT2B15) as a Target for IGF1 and Insulin Action.
• Expression of UDP Glucuronosyltransferases 2B15 and 2B17 is associated with methylation status in prostate cancer cells.
  Shafiee-Kermani, Epigenetics 2021
  • GeneRIF: Expression of UDP Glucuronosyltransferases 2B15 and 2B17 is associated with methylation status in prostate cancer cells.
• Coordinated Regulation of UGT2B15 Expression by Long Noncoding RNA LINC00574 and hsa-miR-129-5p in HepaRG Cells.
  Yu, Drug metabolism and disposition: the biological fate of chemicals 2020
  • GeneRIF: Coordinated Regulation of UGT2B15 Expression by Long Noncoding RNA LINC00574 and hsa-miR-129-5p in HepaRG Cells.
• The correlation between UDP-glucuronosyltransferase polymorphisms and environmental endocrine disruptors levels in polycystic ovary syndrome patients.
  Luo, Medicine 2020
  • GeneRIF: Novel associations between the UGT polymorphisms and EEDs concentrations in patients with PCOS, supporting the relevance of genetic differences in EEDs metabolism, which might be considered as an etiology of PCOS.
• Regulation of UDP-Glucuronosyltransferase 2B15 by miR-331-5p in Prostate Cancer Cells Involves Canonical and Noncanonical Target Sites.
  Wijayakumara, The Journal of pharmacology and experimental therapeutics 2018 (PubMed)
  • GeneRIF: Regulation of UDP-Glucuronosyltransferase 2B15 by miR-331-5p in Prostate Cancer Cells
• Bioinformatic analysis suggests that UGT2B15 activates the Hippo‑YAP signaling pathway leading to the pathogenesis of gastric cancer.
  Chen, Oncology reports 2018
  • GeneRIF: High UGT2B15 expression is associated with the pathogenesis of gastric cancer.
• Genetic variations in UGT2B28, UGT2B17, UGT2B15 genes and the risk of prostate cancer: A case-control study.
  Habibi, Gene 2017 (PubMed)
  • GeneRIF: Results found no significant increased risk for benign prostatic hyperplasia (BPH) in men with low activity genotype at D85Y, but found rather, a significant association between UGT2B15 D85Y and BPH risk when it is in combination with the UGT2B17 copy number variation.
• Identification and validation of the microRNA response elements in the 3'-untranslated region of the UDP glucuronosyltransferase (UGT) 2B7 and 2B15 genes by a functional genomics approach.
  Papageorgiou, Biochemical pharmacology 2017
  • GeneRIF: This study showed that UGT2B7 and UGT2B15 3'-UTRs contain miRNA response elements for multiple miRNAs that may contribute to variable drug glucuronidation.
• More
• Interpreting the Molecular Mechanisms of Yinchenhao Decoction on Hepatocellular Carcinoma through Absorbed Components Based on Network Pharmacology
  Sun, BioMed research international 2021
  • “...Q9HAW7 Tar099 UGT1A8 UDP-glucuronosyltransferase 1A8 Q9HAW9 Tar100 UGT1A9 UDP-glucuronosyltransferase 1A9 Q62452 Tar101 UGT2B15 UDP-glucuronosyltransferase 2B15 P54855 Tar102 UGT2B17 UDP-glucuronosyltransferase 2B17 O75795 Tar103 VCAM1 Vascular cell adhesion protein 1 P19320 Tar104 VEGFA Vascular endothelial growth factor A P15692 Tar105 XDH Xanthine dehydrogenase/oxidase P47989 Table 3 Regulatory network...”

Q3UEP4 glucuronosyltransferase (EC 2.4.1.17) from Mus musculus (see paper)
NP_001025038 UDP glucuronosyltransferase 2 family, polypeptide B36 precursor from Mus musculus
43% identity, 95% coverage

• Re-adaption on Earth after Spaceflights Affects the Mouse Liver Proteome.
  Anselm, International journal of molecular sciences 2017
  • “...P450 4A10 O88833 * >0.05 0.0154 Cytochrome P450 3A11 Q3UEN8 - 0.7 0.0198 0.0166 UDP-glucuronosyltransferase Q3UEP4 - 2.1 0.0167 0.0132 Cytochrome P450 3A13 Q3UW87 - 0.4 0.0121 0.0279 UDP-glucuronosyltransferase 1-1 Q63886 - 1.2 0.0420 0.0185 UDP-glucuronosyltransferase 1-6 Q64435 - 2.0 0.0179 0.0410 Cytochrome P450 2C54 Q6XVG2...”
• The nuclear receptor Shp regulates morphine withdrawal syndrome via modulation of Ugt2b expression in mice.
  Chen, Biochemical pharmacology 2019 (PubMed)
  • GeneRIF: Shp regulated morphine withdrawal syndrome via modulation of Ugt2b expression.
• Comprehensive Characterization of Mouse UDP-Glucuronosyltransferase (Ugt) Belonging to the Ugt2b Subfamily: Identification of Ugt2b36 as the Predominant Isoform Involved in Morphine Glucuronidation.
  Kurita, The Journal of pharmacology and experimental therapeutics 2017 (PubMed)
  • GeneRIF: As Ugt2b36 is highly expressed in the liver, it is most likely that Ugt2b36 is a major morphine Ugt in mouse liver.

AAA18021.1 glucuronosyltransferase (EGT12;UGT2B14) (EC 2.4.1.17) (see protein)
44% identity, 92% coverage

UDB17_RAT / P08542 UDP-glucuronosyltransferase 2B17; UDPGT 2B17; UGT2B17; 17-beta-hydroxysteroid-specific UDPGT; RLUG38; Testosterone, dihydrotestosterone, and beta-estradiol-specific UDPGT; UDP-glucuronosyltransferase 2B5; UDPGT 2B5; UDPGTr-3; EC 2.4.1.17 from Rattus norvegicus (Rat) (see 2 papers)
P08542 glucuronosyltransferase (EC 2.4.1.17) from Rattus norvegicus (see paper)
AAA41280.1 Glucuronosyltransferase 2B3 (EC 2.4.1.17) (see protein)
43% identity, 95% coverage

• function: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile (PubMed:18719240). Catalyzes the glucuronidation of endogenous steroid hormones such as androgens (epitestosterone, androsterone) and estrogens (estradiol, epiestradiol) (By similarity) (PubMed:18719240).
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
  catalytic activity: 17alpha-estradiol + UDP-alpha-D-glucuronate = 17alpha- estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52868)
  catalytic activity: 17alpha-estradiol + UDP-alpha-D-glucuronate = 17alpha- estradiol 17-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52872)
  catalytic activity: 17beta-estradiol + UDP-alpha-D-glucuronate = 17beta-estradiol 17-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52464)
  catalytic activity: 17beta-hydroxy-5alpha-androstan-3-one + UDP-alpha-D- glucuronate = 5alpha-dihydrotestosterone 17-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53000)
  catalytic activity: testosterone + UDP-alpha-D-glucuronate = testosterone 17-O- (beta-D-glucuronate) + UDP + H(+) (RHEA:52456)
• The Influence of Lipid Microdomain Heterogeneity on Protein-Protein Interactions: Proteomic Analysis of Co-Immunoprecipitated Binding Partners of P450 1A2 and P450 3A in Rat Liver Microsomes
  Reed, Drug metabolism and disposition: the biological fate of chemicals 2023 (secret)
• Extracellular vesicles released by steatotic hepatocytes alter adipocyte metabolism
  Mleczko, Journal of extracellular biology 2022
  • “...P07687 1.88 5.86E03 Epoxide hydrolase 1 IDHP_RAT P56574 1.88 9.46E03 Isocitrate dehydrogenase [NADP], mitochondrial UDB17_RAT P08542 1.88 3.09E04 UDPglucuronosyltransferase 2B17 MOT1_RAT P53987 1.95 8.53E04 Monocarboxylate transporter 1 CYB5_RAT P00173 1.96 3.20E03 Cytochrome b5 CP2D4_RAT Q64680 2.00 9.96E04 Cytochrome P450 2D4 ALDH2_RAT P11884 2.03 6.31E03 Aldehyde dehydrogenase,...”
• Functional proteomic analysis of corticosteroid pharmacodynamics in rat liver: Relationship to hepatic stress, signaling, energy regulation, and drug metabolism.
  Ayyar, Journal of proteomics 2017
  • “...UP P36511 Ugt2b15 UDP-glucuronosyltransferase 2B15 Drug = S-oxazepam, paracetamol, (+)-menthol, and eugenol; polymorphic enzyme UP P08542 Ugt2b17 UDP-glucuronosyltransferase 2B17 Drug = MK-7246; endogenous substrates = steroid hormones; polymorphic enzyme UP P08541 Ugt2b2 UDP-glucuronosyltransferase 2B2 Endogenous substrates = triiodothyronine, androsterone UP P17988 Sult1a1 Sulfotransferase 1A1 Sulfate conjugation...”

UDB37_RAT / P19488 UDP-glucuronosyltransferase 2B37; UDPGT 2B37; 17-beta-hydroxysteroid-specific UDPGT; UDP-glucuronosyltransferase R-21; UDPGTr-21; UDPGTr-5; EC 2.4.1.17 from Rattus norvegicus (Rat) (see paper)
AAA03216.1 Glucuronosyltransferase 2B6 (EC 2.4.1.17) (see protein)
43% identity, 95% coverage

• function: UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. About 30-fold less active than Ugt2b17 toward testosterone and dihydrotestosterone.
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
• High throughput metabolomics-proteomics investigation on metabolic phenotype changes in rats caused by Radix Scrophulariae using ultra-performance liquid chromatography with mass spectrometry.
  Lu, RSC advances 2019
  • “...3 1.2021 Up** 0.0011 L33 P00502 Gsta1 Glutathione S -transferase alpha-1 1.2046 Up** 0.0000 L34 P19488 Ugt2b37 UDP-glucuronosyltransferase 2B37 1.2057 Up** 0.0045 L35 Q6AXQ0 Sae1 SUMO-activating enzyme subunit 1 1.2057 Up* 0.0347 L36 F1LNM4 LOC103689965 Complement C4 (fragment) 1.2075 Up** 0.0039 L37 F1LU27 Focad Protein Focad...”
• Phenobarbital induces alterations in the proteome of hepatocytes and mesenchymal cells of rat livers.
  Klepeisz, PloS one 2013
  • “...Microsomal glutathione S-transferase 1 drug metabolic process P09875 t, PB UDP-glucuronosyltransferase 2B1 drug metabolic process P19488 t, PB UDP-glucuronosyltransferase 2B37 drug metabolic process P97675 Ectonucleotide pyrophosphatase / phosphodiesterase family member 3 (E-NPP 3) (B10) immune response P07151 Beta-2-microglobulin immune response, antigen processing and presentation of peptide...”
  • “...cyclase 1. Proteins in HC: (1) P07756 Carbamoyl-phosphate synthase [ammonia], (2) P08932 T-kininogen 2, (3) P19488 UDP-glucuronosyltransferase 2B37, (4) Q6DGG0 Peptidyl-prolyl cis-trans isomerase D. Part B) demonstrates the distribution of distinct proteins within the three fractions, supernatant, cytoplasm and nuclear protein fractions, underneath the respective treatment...”

UD2A3_MOUSE / Q8BWQ1 UDP-glucuronosyltransferase 2A3; UDPGT 2A3; EC 2.4.1.17 from Mus musculus (Mouse) (see paper)
43% identity, 97% coverage

• function: UDP-glucuronosyltransferases catalyze phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. They are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds (By similarity).
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
• Development of a Global Metabo-Lipid-Prote-omics Workflow to Compare Healthy Proximal and Distal Colonic Epithelium in Mice
  Hemmati, Journal of proteome research 2024
  • “...tissue which represents 5 UDP-glucuronosyltransferases [Ugt2b17 (P17717), Ugt1a1 (Q63886), Ugt1a6 (Q64435), Ugt1a7c (Q6ZQM8), and Ugt2a3 (Q8BWQ1, 2.4.1.17)]. Higher levels of the substrate UDP-glucuronide and its precursor UDP-glucose were observed in the DC tissue, indicating the usage of the UDP-glucuronide pool in PC tissue. In line with...”
• Proteome and microbiota analysis highlight Lactobacillus plantarum TWK10 supplementation improves energy metabolism and exercise performance in mice.
  Chen, Food science & nutrition 2020
  • “...Q9JKR6 HYOU1 3.2643.626 18.642.278 .000 5.7 Peroxiredoxin4 O08807 PRDX4 0.2080.416 1.1120.142 .006 5.3 UDPglucuronosyltransferase 2A3 Q8BWQ1 UD2A3 1.231.038 6.5321.917 .003 5.3 Treslin Q8BQ33 TICRR 1.2031.397 4.9991.251 .007 4.2 Interleukin17B Q9QXT6 IL17B 3.5092.556 14.3424.062 .004 4.1 40S ribosomal protein SA P14206 RSSA 0.951.2 3.560.4 .006 3.7 Heat...”
• Sortilin 1 Loss-of-Function Protects Against Cholestatic Liver Injury by Attenuating Hepatic Bile Acid Accumulation in Bile Duct Ligated Mice.
  Li, Toxicological sciences : an official journal of the Society of Toxicology 2018
• Re-adaption on Earth after Spaceflights Affects the Mouse Liver Proteome.
  Anselm, International journal of molecular sciences 2017
  • “...1-6 Q64435 - 2.0 0.0179 0.0410 Cytochrome P450 2C54 Q6XVG2 * >0.05 0.0476 UDP-glucuronosyltransferase 2A3 Q8BWQ1 - 1.9 0.0109 0.0132 UDP-glucuronosyltransferase Q8K154 - 1.9 0.0172 0.0126 UDP-glucuronosyltransferase Q8R084 - 3.5 0.0118 0.0119 Cytochrome P450 2C70 Q91W64 * >0.05 0.0340 Cytochrome P450 4A12A Q91WL5 - 5.0 0.0113...”

F1M7N8 UDP-glucuronosyltransferase from Rattus norvegicus
42% identity, 96% coverage

• Possible Role of Extracellular Vesicles in Hepatotoxicity of Acetaminophen.
  Šrajer, International journal of molecular sciences 2022
  • “...] P50170 Retinol dehydrogenase 3 8 29.97 Hepatocytes [ 30 , 31 , 32 ] F1M7N8 UDP-glucuronosyltransferase 7 16.97 Hepatocytes [ 20 , 28 , 29 ] P02793 Serum albumin 4 8.55 Hepatocytes [ 23 ] P27364 NADPH-dependent 3-keto-steroid reductase Hsd3b5 4 8.66 Hepatocytes [ 33...”
• High throughput metabolomics-proteomics investigation on metabolic phenotype changes in rats caused by Radix Scrophulariae using ultra-performance liquid chromatography with mass spectrometry.
  Lu, RSC advances 2019
  • “...1 1.2576 Up** 0.0077 L49 A2VCW9 Aass Alpha-aminoadipic semialdehyde synthase, mitochondrial 1.2637 Up** 0.0000 L50 F1M7N8 Ugt2b37 UDP-glucuronosyltransferase 1.2647 Up** 0.0010 L51 P38659 Pdia4 Protein disulfide-isomerase A4 1.2670 Up** 0.0018 L52 Q6AXR4 Hexb Beta-hexosaminidase subunit beta 1.2712 Up** 0.0021 L53 D4A3E8 Mrps27 Mitochondrial ribosomal protein S27...”

CAA29657.1 glucuronosyltransferase 2B5 (Ugt2b5) (EC 2.4.1.17) (see protein)
P17717 UDP-glucuronosyltransferase 2B17 from Mus musculus
41% identity, 98% coverage

• Development of a Global Metabo-Lipid-Prote-omics Workflow to Compare Healthy Proximal and Distal Colonic Epithelium in Mice
  Hemmati, Journal of proteome research 2024
  • “...addition, the GO-term GO:0015020_F:glucuronosyltransferase activity was increased in PC tissue which represents 5 UDP-glucuronosyltransferases [Ugt2b17 (P17717), Ugt1a1 (Q63886), Ugt1a6 (Q64435), Ugt1a7c (Q6ZQM8), and Ugt2a3 (Q8BWQ1, 2.4.1.17)]. Higher levels of the substrate UDP-glucuronide and its precursor UDP-glucose were observed in the DC tissue, indicating the usage of...”
• Sortilin 1 Loss-of-Function Protects Against Cholestatic Liver Injury by Attenuating Hepatic Bile Acid Accumulation in Bile Duct Ligated Mice.
  Li, Toxicological sciences : an official journal of the Society of Toxicology 2018
• Identification and quantification of the basal and inducible Nrf2-dependent proteomes in mouse liver: biochemical, pharmacological and toxicological implications.
  Walsh, Journal of proteomics 2014
  • “...value Nrf2 (+/+) CDDO Nrf2 (+/+) P value Nrf2 (/) CDDO Nrf2 (/) P value P17717 UDP-glucuronosyltransferase 2B17 38 4.28 <0.001 P10649 Glutathione S-transferase Mu 1 69 4.11 <0.001 1.43 0.022 P19639 Glutathione S-transferase Mu 3 49 4.04 <0.001 1.58 <0.001 P02762 Major urinary protein 6...”
• Novel gene expression responses in the ovine abomasal mucosa to infection with the gastric nematode Teladorsagia circumcincta
  Knight, Veterinary research 2011
  • “...transcriptase-like, partial (21%) --- -1.93 KN511_9486b13.p1kM13F TC341767 --- --- -1.90 KN511_9484h13.p1kM13F TC350450 similar to UP|UDB5_MOUSE (P17717) UDP-glucuronosyltransferase 2B5 precursor (UDPGT) (M-1), partial (49%) UGT2B17 -1.81 KN511_9263c22.p1kaM13F --- --- --- -1.80 KN511_9264a19.p1kaM13F --- --- --- -1.77 KN511_9484l14.p1kM13F TC362885 similar to UP|MALAT_HUMAN (Q9UHZ2) Metastasis-associated lung adenocarcinoma transcript 1,...”
  • “...(Q9UHZ2) Metastasis-associated lung adenocarcinoma transcript 1, partial (72%) MALAT1 -1.74 KN511_9481o23.p1kaM13F TC350450 similar to UP|UDB5_MOUSE (P17717) UDP-glucuronosyltransferase 2B5 precursor (UDPGT) (M-1), partial (49%) UGT2B17 -1.73 CN824758 --- --- --- -1.72 KN511_9488a17.p1kM13F TC318925 --- --- -1.71 KN511_9480o03.p1kaM13F --- --- --- -1.70 KN511_9263o20.p1kaM13F TC380127 similar to UP|UDB5_MOUSE (P17717)...”
• Altered retinoic acid metabolism in diabetic mouse kidney identified by O isotopic labeling and 2D mass spectrometry.
  Starkey, PloS one 2010
  • “...member A2 2.05 2.85E-04 ACSM3 Q3UNX5 acyl-CoA synthetase medium-chain family member 3 2.14 4.73E-03 UGT2B17 P17717 UDP glucuronosyltransferase 2 family, polypeptide B17 2.23 5.19E-03 ADH1C P00329 Alcohol dehydrogenase 1C (class 1) 2.49 5.11E-12 Data are sorted by the fold change score. Two highlighted proteins represent key...”
• Proteomic analysis of Nrf2 deficient transgenic mice reveals cellular defence and lipid metabolism as primary Nrf2-dependent pathways in the liver.
  Kitteringham, Journal of proteomics 2010
  • “...1.21 0.94 1.12 1.06 0.95 1.19 0.62 0.56 0.60 0.54 0.58 0.55 0.62 0.55 0.011 P17717 UDP-glucuronosyltransferase 2B5 4 5.8 15.5 1.00 1.16 0.99 1.08 1.05 0.98 1.13 0.59 0.57 0.56 0.61 0.58 0.56 0.61 0.55 0.004 Q63836 Selenium-binding protein 2 4 26.0 47.9 1.00 1.26...”
  • “...95% CI P10649 Glutathione S-transferase Mu 1 1.00 0.91 1.10 0.44 0.40 0.47 0.44 0.001 P17717 UDP-glucuronosyltransferase 2B5 0.99 0.93 1.06 0.55 0.52 0.57 0.55 0.001 Q8VCC2 Liver carboxylesterase 1 1.06 0.96 1.17 0.59 0.54 0.64 0.56 0.001 Q91X77 Cytochrome P450 2C50 0.97 0.87 1.08 0.56...”

Q8VCN3 glucuronosyltransferase (EC 2.4.1.17) from Mus musculus (see paper)
42% identity, 98% coverage

Q62789 glucuronosyltransferase (EC 2.4.1.17) from Rattus norvegicus (see paper)
AAA86833.1 Glucuronosyltransferase 2B8 (Ugt2b8) (EC 2.4.1.17) (see protein)
42% identity, 96% coverage

• Investigation into potential mechanisms of metabolic syndrome by integrative analysis of metabolomics and proteomics.
  Chen, PloS one 2022
  • “...Ugt1a1 Q64550 UDP-glucuronosyltransferase 11 Glycosyltransferase 0.722 0 Ugt1a5 Q64638 UDP-glucuronosyltransferase 15 Glycosyltransferase 0.694 0.0246 Ugt2b7 Q62789 UDP-glucuronosyltransferase 2B7 Lipid metabolism 0.623 0.0038 As shown in Table 1 , all impact values of these pathways were greater than 0.2. Generally, an impact value equal to or greater...”

Q68G19 UDP-glucuronosyltransferase from Rattus norvegicus
42% identity, 99% coverage

• Hyperoside attenuates non-alcoholic fatty liver disease in rats via cholesterol metabolism and bile acid metabolism.
  Wang, Journal of advanced research 2021
  • “...MFS transporter, OCT family, solute carrier family 22 (organic anion transporter), member 7 1.30 0.0344 Q68G19 Ugt2b35 19 2 2 43.2 UDP-glucuronosyltransferase 1.66 0.0067 D4A132 Ugt2b10 14 2 2 28.6 Glucuronosyltransferase [EC:2.4.1.17] 1.24 0.0287 Q5FVR5 Acnat2 11 11 11 36.1 Bile acid-CoA:amino acid N-acyltransferase [EC:2.3.1.65 3.1.2.2]...”

F1LM22 UDP-glucuronosyltransferase from Rattus norvegicus
41% identity, 95% coverage

• Multi-Omics Approaches for Liver Reveal the Thromboprophylaxis Mechanism of Aspirin Eugenol Ester in Rat Thrombosis Model.
  Tao, International journal of molecular sciences 2024
  • “...P14480 6 0.11 0.0289 map00980 Metabolism of xenobiotics by CYP450 A1L128 P04903 O35543 P06757 A9EEP5 F1LM22 6 0.11 0.0366 map00982 Drug metabolismCYP450 A1L128 P04903 O35543 P06757 A9EEP5 F1LM22 6 0.11 0.0366 map04977 Vitamin digestion and absorption Q5FVF9 Q9JI61 2 0.25 0.0461 ASA vs. Model map04068 FoxO...”
• High throughput metabolomics-proteomics investigation on metabolic phenotype changes in rats caused by Radix Scrophulariae using ultra-performance liquid chromatography with mass spectrometry.
  Lu, RSC advances 2019
  • “...Up** 0.0001 L73 D3ZXC8 Ebpl Emopamil binding protein-like (predicted), isoform CRA_a 1.8324 Up** 0.0018 L74 F1LM22 Ugt2b UDP-glucuronosyltransferase 1.8894 Up** 0.0000 L75 Q63002 Igf2r Mannose 6-phosphate/insulin-like growth factor II receptor 2.1130 Up** 0.0080 L76 Q5BK88 Amacr Alpha-methylacyl-CoA racemase 2.5845 Up** 0.0001 a Compared with control group,...”

Q5EBC8 UDP-glucuronosyltransferase from Rattus norvegicus
NP_113721 UDP-glucuronosyltransferase 2B2 precursor from Rattus norvegicus
42% identity, 92% coverage

• Hepatoprotective Effect of Grape Seed and Skin Extract Against Lithium Exposure Examined by the Window of Proteomics
  Mezni, Dose-response : a publication of International Hormesis Society 2022
  • “...P18886 Cpt2 1.03 10 4 Carnitine O-palmitoyltransferase (EC 2.3.1.21) ++ + - + + ++ Q5EBC8 Ugt2b 5.24 10 4 UDP glycosyltransferase 2 family, polypeptide B ++ ++ + ++ + + P15429 Eno3 1.27 10 4 Enolase 3, beta + ++ +++ ++ + -...”
  • “...P18886 Cpt2 Mitochondrion Mitochondrial inner membrane, membrane, carnitine O-palmitoyltransferase activity, transferase activity, transferring acyl groups Q5EBC8 Ugt2b Membrane Integral component of membrane, glucuronosyltransferase activity, transferase activity, transferring glycosyl groups P15429 Eno3 Cytoplasm Phosphopyruvate hydratase activity, lyase activity, metal ion binding Q68G40 Cyp2c23 Unknown Monooxygenase activity, oxidoreductase...”
• Enhanced phase II detoxification contributes to beneficial effects of dietary restriction as revealed by multi-platform metabolomics studies.
  Wen, Molecular & cellular proteomics : MCP 2013
  • GeneRIF: Data indicate that the up-regulation of phase II detoxification in the DR group was confirmed by mRNA and protein expression levels of uridinediphospho-glucuronosyltransferase and glycine-N-acyltransferase in actual liver tissues.

UD2B2_RAT / P08541 UDP-glucuronosyltransferase 2B2; UDPGT 2B2; 3-hydroxyandrogen-specific UDPGT; RLUG23; UDPGTr-4; EC 2.4.1.17 from Rattus norvegicus (Rat) (see paper)
P08541 glucuronosyltransferase (EC 2.4.1.17) from Rattus norvegicus (see paper)
AAA42314.1 Glucuronosyltransferase 2B2 (EC 2.4.1.17) (see protein)
42% identity, 92% coverage

• function: UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. 2B2 acts on various endogenous steroids, especially etiocholanolone and androsterone
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
• The Influence of Lipid Microdomain Heterogeneity on Protein-Protein Interactions: Proteomic Analysis of Co-Immunoprecipitated Binding Partners of P450 1A2 and P450 3A in Rat Liver Microsomes
  Reed, Drug metabolism and disposition: the biological fate of chemicals 2023 (secret)
• Extracellular vesicles released by steatotic hepatocytes alter adipocyte metabolism
  Mleczko, Journal of extracellular biology 2022
  • “...TRFE_RAT P12346 1.02 7.94E03 Serotransferrin PP1A_RAT P62138 1.02 3.58E03 Serine/threonineprotein phosphatase PP1alpha catalytic subunit UD2B2_RAT P08541 1.03 1.65E02 UDPglucuronosyltransferase 2B2 PRS7_RAT Q63347 1.04 1.83E02 26S protease regulatory subunit 7 RS8_RAT P62243 1.04 6.54E03 40S ribosomal protein S8 RHOA_RAT P61589 1.04 6.21E04 Transforming protein RhoA RL15_RAT P61314...”
• Functional proteomic analysis of corticosteroid pharmacodynamics in rat liver: Relationship to hepatic stress, signaling, energy regulation, and drug metabolism.
  Ayyar, Journal of proteomics 2017
  • “...P08542 Ugt2b17 UDP-glucuronosyltransferase 2B17 Drug = MK-7246; endogenous substrates = steroid hormones; polymorphic enzyme UP P08541 Ugt2b2 UDP-glucuronosyltransferase 2B2 Endogenous substrates = triiodothyronine, androsterone UP P17988 Sult1a1 Sulfotransferase 1A1 Sulfate conjugation of catecholamines, phenolic drugs and neurotransmitters UP P50237 Sult1c1 Sulfotransferase 1C1 Sulfonation of p-nitrophenol and...”
• Protein targets of thioacetamide metabolites in rat hepatocytes.
  Koen, Chemical research in toxicology 2013
  • “...carboxylesterase 4 Q64573 Mt10 (1D) BB, HAL UDP-glucuronosyltransferase 2B15 P36511 Mt9, Ms9 (1D) UDP-glucuronosyltransferase 2B2 P08541 Mt10 (1D) Apoptosis related proteins Cytochrome c, somatic P62898 Mt135 (2D) Mitochondrial fission 1 protein P84817 Mt4 (1D) Miscellaneous proteins Macrophage migration inhibitory factor P30904 Mt2 (1D) BB Membrane-associated progesterone...”

A1XF83 UDP-glucuronosyltransferase from Rattus norvegicus
42% identity, 92% coverage

• High throughput metabolomics-proteomics investigation on metabolic phenotype changes in rats caused by Radix Scrophulariae using ultra-performance liquid chromatography with mass spectrometry.
  Lu, RSC advances 2019
  • “...D3ZMQ0 Mga Protein Mga 1.6374 Up* 0.0312 L71 Q6T5E9 Ugt1a6 UDP-glucuronosyltransferase 1.7279 Up** 0.0003 L72 A1XF83 Ugt2b UDP-glucuronosyltransferase 1.8256 Up** 0.0001 L73 D3ZXC8 Ebpl Emopamil binding protein-like (predicted), isoform CRA_a 1.8324 Up** 0.0018 L74 F1LM22 Ugt2b UDP-glucuronosyltransferase 1.8894 Up** 0.0000 L75 Q63002 Igf2r Mannose 6-phosphate/insulin-like growth...”

UDB15_RAT / P36511 UDP-glucuronosyltransferase 2B15; UDPGT 2B15; UGT2B15; UDP-glucuronosyltransferase 2B36; UDPGT 2B36; EC 2.4.1.17 from Rattus norvegicus (Rat) (see paper)
P36511 glucuronosyltransferase (EC 2.4.1.17) from Rattus norvegicus (see 2 papers)
AAA83404.1 Glucuronosyltransferase 2B12 (Ugt2b12) (EC 2.4.1.17) (see protein)
42% identity, 95% coverage

• function: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile (PubMed:7574722). Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds (PubMed:7574722). Catalyzes the glucuronidation of endogenous steroid hormones such as androgens (testosterone, androsterone) and estrogens (estradiol, epiestradiol, estriol, catechol estrogens) (PubMed:7574722). Displays glucuronidation activity toward several classes of xenoblotic substrates, including phenolic compounds (eugenol, 4-nitrophenol, 4- hydroxybiphenyl) and phenylpropanoids (naringenin, coumarins) (PubMed:7574722). Catalyzes the glucuronidation of monoterpenoid alcohols such as borneol, menthol and isomenthol, a class of natural compounds used in essential oils (PubMed:7574722).
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
  catalytic activity: 17alpha-estradiol + UDP-alpha-D-glucuronate = 17alpha- estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52868)
  catalytic activity: 16alpha,17alpha-estriol + UDP-alpha-D-glucuronate = 16alpha,17alpha-estriol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52924)
  catalytic activity: 17beta-hydroxy-5alpha-androstan-3-one + UDP-alpha-D- glucuronate = 5alpha-dihydrotestosterone 17-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53000)
• The Influence of Lipid Microdomain Heterogeneity on Protein-Protein Interactions: Proteomic Analysis of Co-Immunoprecipitated Binding Partners of P450 1A2 and P450 3A in Rat Liver Microsomes
  Reed, Drug metabolism and disposition: the biological fate of chemicals 2023 (secret)
• Extracellular vesicles released by steatotic hepatocytes alter adipocyte metabolism
  Mleczko, Journal of extracellular biology 2022
  • “...dehydrogenase, mitochondrial A1M_RAT Q63041 2.07 1.11E02 Alpha1macroglobulin RDH7_RAT P55006 2.12 6.66E04 Retinol dehydrogenase 7 UDB15_RAT P36511 2.16 3.72E03 UDPglucuronosyltransferase 2B15 PCCB_RAT P07633 2.17 1.05E02 PropionylCoA carboxylase beta chain, mitochondrial BASI_RAT P26453 2.17 3.95E04 Basigin MBL2_RAT P08661 2.21 1.40E03 Mannosebinding protein C CP2CB_RAT P08683 2.52 1.35E04 Cytochrome...”
• Functional proteomic analysis of corticosteroid pharmacodynamics in rat liver: Relationship to hepatic stress, signaling, energy regulation, and drug metabolism.
  Ayyar, Journal of proteomics 2017
  • “...enzyme DOWN P09875 Ugt2b1 UDP-glucuronosyltransferase 2B1 Drug = diclofenac ; bisphenol A (environmental chemical) UP P36511 Ugt2b15 UDP-glucuronosyltransferase 2B15 Drug = S-oxazepam, paracetamol, (+)-menthol, and eugenol; polymorphic enzyme UP P08542 Ugt2b17 UDP-glucuronosyltransferase 2B17 Drug = MK-7246; endogenous substrates = steroid hormones; polymorphic enzyme UP P08541 Ugt2b2...”
• Improved detection of quantitative differences using a combination of spectral counting and MS/MS total ion current
  Freund, Journal of proteome research 2013
  • “...TIC Values P-value Fold Change Control (S.E.) Acidotic (S.E.) Control (S.E.) Acidotic (S.E.) UDP-glucuronosyltransferase 2B15 P36511 0.00022 6.4 1.8 (1.0) 17.0 (0.7) 1.9E+05 (1.7E+05) 7.0E+04 (2.2E+04) UDP-glucuronosyltransferase 11 (UGT1A1) Q64550 0.00086 4.6 11.0 (1.8) 54.1 (4.5) 6.3E+04 (2.0E+04) 6.8E+04 (4.6E+03) Peroxisomal multifunctional enzyme type 2 (HSD17B4)...”
• Response of the mitochondrial proteome of rat renal proximal convoluted tubules to chronic metabolic acidosis
  Freund, American journal of physiology. Renal physiology 2013
  • “...chronic metabolic acidosis Uniprot Protein Name Gene Mass, kDa P36511 Ugt2b15 61 Q66HG6 Q64240 Q64550 Ca5b Ambp Ugt1a1 37 39 60 G3V7V6 Q6AXT5 D4A0Y1 Retsat...”
• Protein targets of thioacetamide metabolites in rat hepatocytes.
  Koen, Chemical research in toxicology 2013
  • “...mu-3) P08009 Ct6, Mt6 (1D) Liver carboxylesterase 4 Q64573 Mt10 (1D) BB, HAL UDP-glucuronosyltransferase 2B15 P36511 Mt9, Ms9 (1D) UDP-glucuronosyltransferase 2B2 P08541 Mt10 (1D) Apoptosis related proteins Cytochrome c, somatic P62898 Mt135 (2D) Mitochondrial fission 1 protein P84817 Mt4 (1D) Miscellaneous proteins Macrophage migration inhibitory factor...”

NP_001284545 UDP-glucuronosyltransferase 2B4 isoform 3 from Homo sapiens
52% identity, 71% coverage

• Distilling functional variations for human UGT2B4 upstream region based on selection signals and implications for phenotypes of Neanderthal and Denisovan.
  Wang, Scientific reports 2023
  • GeneRIF: Distilling functional variations for human UGT2B4 upstream region based on selection signals and implications for phenotypes of Neanderthal and Denisovan.
• Absence of significant association between UGT2B4 genetic variants and the susceptibility to anti-tuberculosis drug-induced liver injury in a Western Chinese population.
  Chen, Journal of clinical pharmacy and therapeutics 2021 (PubMed)
  • GeneRIF: Absence of significant association between UGT2B4 genetic variants and the susceptibility to anti-tuberculosis drug-induced liver injury in a Western Chinese population.
• Clopidogrel Carboxylic Acid Glucuronidation is Mediated Mainly by UGT2B7, UGT2B4, and UGT2B17: Implications for Pharmacogenetics and Drug-Drug Interactions .
  Kahma, Drug metabolism and disposition: the biological fate of chemicals 2018 (PubMed)
  • GeneRIF: Clopidogrel carboxylic acid is metabolized mainly by UGT2B7 and UGT2B4 in the liver and by UGT2B17 in the small intestinal wall.
• UGT2B4 previously implicated in the risk of breast cancer is associated with menarche timing in Ukrainian females.
  Yermachenko, Gene 2016 (PubMed)
  • GeneRIF: UGT2B4 previously implicated in the risk of breast cancer is associated with menarche timing in Ukrainian females.
• Upregulation of UGT2B4 Expression by 3'-Phosphoadenosine-5'-Phosphosulfate Synthase Knockdown: Implications for Coordinated Control of Bile Acid Conjugation.
  Barrett, Drug metabolism and disposition: the biological fate of chemicals 2015
  • GeneRIF: These data indicate that knocking down PAPSS increases UGT2B4 transcription and mRNA stability as a compensatory response to the loss of SULT2A1 activity
• Methadone inhibits CYP2D6 and UGT2B7/2B4 in vivo: a study using codeine in methadone- and buprenorphine-maintained subjects.
  Gelston, British journal of clinical pharmacology 2012
  • GeneRIF: Methadone inhibits CYP2D6 and UGT2B7/2B4 in vivo
• High enzyme activity UGT1A1 or low activity UGT1A8 and UGT2B4 genotypes increase esophageal cancer risk.
  Dura, International journal of oncology 2012 (PubMed)
  • GeneRIF: The UGT1A8 and UGT2B4 genotypes associated with decreased predicted enzyme activities, were significantly associated with an increased risk of esophageal squamous cell carcinoma.
• A signature of balancing selection in the region upstream to the human UGT2B4 gene and implications for breast cancer risk.
  Sun, Human genetics 2011
  • GeneRIF: The variation pattern upstream UGT2B4 is highly unusual and may be the result of balancing selection.
• More

B5X180 UDP-glucuronosyltransferase from Salmo salar
40% identity, 91% coverage

• Liver proteome response of pre-harvest Atlantic salmon following exposure to elevated temperature
  Nuez-Ortín, BMC genomics 2018
  • “...bco2 BCO2 28 Apolipoprotein B (Fragment) (Q91480) 2.05 8 0.016 APOB 29 UDP-glucuronosyltransferase (EC 2.4.1.17) (B5X180) 2.16 4 0.014 UD2A2 UGT2A1 30 15-hydroxyprostaglandin dehydrogenase (B9EPG3) 2.19 11 <0.001 PGDH HPGD 31 Phenazine biosynthesis-like domain-containing protein 2 (C0H855) 2.33 11 <0.001 PBLD2 PBLD 32 Metallothionein B (MT-B)...”
• Preliminary Validation of a High Docosahexaenoic Acid (DHA) and α-Linolenic Acid (ALA) Dietary Oil Blend: Tissue Fatty Acid Composition and Liver Proteome Response in Atlantic Salmon (Salmo salar) Smolts
  Nuez-Ortín, PloS one 2016
  • “...11 0.001 0.094 7 B5DG71 H33 Histone H3 4.69E+07 7.14E+07 1.5 2 0.001 0.094 8 B5X180 UD2A2 UDP-glucuronosyltransferase 2A2 1.23E+06 2.43E+06 2 5 0.000 0.025 9 B5X1I8 STT3A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit STT3A 7.64E+05 1.76E+06 2.3 5 0.000 0.089 10 B5X322 S61A1 Transport protein Sec61 subunit alpha...”

NP_001288162 UDP-glucuronosyltransferase 2A2 isoform UGT2A2_i2 precursor from Homo sapiens
39% identity, 92% coverage

• The UGT2A1/UGT2A2 locus is associated with COVID-19-related loss of smell or taste.
  Shelton, Nature genetics 2022 (PubMed)
  • GeneRIF: The UGT2A1/UGT2A2 locus is associated with COVID-19-related loss of smell or taste.
• Human UDP-glucuronosyltransferase UGT2A2: cDNA construction, expression, and functional characterization in comparison with UGT2A1 and UGT2A3.
  Sneitz, Pharmacogenetics and genomics 2009
  • GeneRIF: Results show that UGT2A2 not only shares exons 2-6 with UGT2A1, it also shares with it a similar tissue expression pattern; both UGTs are primarily expressed in nasal epithelium. The 3rd member of UGT2A subfamily, UGT2A3 exhibited a different tissue expression pattern, found mainly in liver and small intestine.

UD2A1_HUMAN / P0DTE4 UDP-glucuronosyltransferase 2A1; UDPGT 2A1; UGT2A1; EC 2.4.1.17 from Homo sapiens (Human) (see 7 papers)
36% identity, 93% coverage

• function: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile (PubMed:10359671, PubMed:18719240, PubMed:19022937, PubMed:19858781, PubMed:23288867, PubMed:23756265). Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds (PubMed:10359671, PubMed:19858781, PubMed:23756265). Catalyzes the glucuronidation of endogenous steroid hormones such as androgens (testosterone and epitestosterone) and estrogens (estradiol and epiestriol) (PubMed:18719240, PubMed:19022937, PubMed:19858781, PubMed:23288867). Contributes to bile acid (BA) detoxification by catalyzing the glucuronidation of BA substrates, which are natural detergents for dietary lipids absorption (PubMed:23756265). Shows a high affinity to aliphatic odorants such as citronellol as well as olfactory tissue specificity, and therefore may be involved in olfaction (PubMed:10359671). Shows a potential role in detoxification of toxic waste compounds in the amniotic fluid before birth, and air- born chemical after birth (PubMed:19858781).
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
  catalytic activity: 16beta,17beta-estriol + UDP-alpha-D-glucuronate = 16beta,17beta-estriol 16-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52880)
  catalytic activity: 16alpha,17alpha-estriol + UDP-alpha-D-glucuronate = 16alpha,17alpha-estriol 16-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52920)
  catalytic activity: 17alpha-estradiol + UDP-alpha-D-glucuronate = 17alpha- estradiol 17-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52872)
  catalytic activity: 17alpha-estradiol + UDP-alpha-D-glucuronate = 17alpha- estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52868)
  catalytic activity: 17beta-estradiol + UDP-alpha-D-glucuronate = 17beta-estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52460)
  catalytic activity: 17beta-estradiol + UDP-alpha-D-glucuronate = 17beta-estradiol 17-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52464)
  catalytic activity: testosterone + UDP-alpha-D-glucuronate = testosterone 17-O- (beta-D-glucuronate) + UDP + H(+) (RHEA:52456)
  catalytic activity: epitestosterone + UDP-alpha-D-glucuronate = epitestosterone 17-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52568)
  catalytic activity: lithocholate + UDP-alpha-D-glucuronate = lithocholoyl-3-O- (beta-D-glucuronate) + UDP + H(+) (RHEA:53028)
  catalytic activity: lithocholate + UDP-alpha-D-glucuronate = lithocholoyl-24-O- (beta-D-glucuronate) + UDP (RHEA:52952)
  catalytic activity: deoxycholate + UDP-alpha-D-glucuronate = deoxycholoyl-24-O- (beta-D-glucuronate) + UDP (RHEA:52948)
  catalytic activity: hyodeoxycholate + UDP-alpha-D-glucuronate = hyodeoxycholoyl- 24-O-(beta-D-glucuronate) + UDP (RHEA:52956)
  catalytic activity: hyocholate + UDP-alpha-D-glucuronate = hyocholoyl-24-O-(beta- D-glucuronate) + UDP (RHEA:52960)
• Diviner uncovers hundreds of novel human (and other) exons though comparative analysis of proteins.
  Nord, bioRxiv : the preprint server for biology 2024
  • “...visualizations of the predicted structures for: [A] the primary human UGT2A1 isoform in SwissProt (accession: P0DTE4), [B] an alternative human UGT2A1 isoform in SwissProt (accession: P0DTE4-4), containing the exon that served as the query for the pictured Diviner search result, [C] the sole rat UGT2A1 isoform...”
• An Epigenetic Locus Associated with Loss of Smell in COVID-19.
  Aslan, Diagnostics (Basel, Switzerland) 2024
  • “...genes are expressed in blood (UniProt Consortium 2023 [ 23 ]; accession numbers P22308 (UGT1A1), P0DTE4 (UGT2A1)), which is the sample type analysed in this study. Epigenome wide association studies look for an association between tissue methylation patterns of DNA and disease states and are mostly...”
• Complete Reaction Phenotyping of Propranolol and 4-Hydroxypropranolol with the 19 Enzymes of the Human UGT1 and UGT2 Families.
  Yang, International journal of molecular sciences 2022
  • “...human UGT1A7, UGT1A8, UGT1A9, UGT1A10 and UGT2A1 sequence (UniProt, Identifiers: Q9HAW7, Q9HAW9, O60656, Q9HAW8 and P0DTE4), respectively. The crystal structure of sterol 3-beta-glucosyltransferase in complex with its cofactor UDP-glucose (PDB code: 5GL5 [ 45 ]) was chosen as the template, for all the homology modeling, since...”

A0A0G2JMZ5 glucuronosyltransferase (EC 2.4.1.17) from Homo sapiens (see paper)
53% identity, 60% coverage

D4A147 UDP-glucuronosyltransferase from Rattus norvegicus
41% identity, 82% coverage

• Integrative proteomics and metabolomics of Guizhou Miao Sour Soup affecting simple obese rats.
  Yuan, Frontiers in nutrition 2022
  • “...Nags Down 0.711 0.0011298 Up 1.361 0.003964 A0A0G2JSK9 Bhmt Down 0.474 0.0013865 Up 1.855 0.0053504 D4A147 Ugt2a3 Down 0.591 0.007114 Up 1.68 0.0134986 P13221 Got1 Down 0.672 0.0005016 Up 1.652 0.0044859 P12785 Fasn Down 0.531 0.0036612 Up 2.195 0.00184 P09034 Ass1 Down 0.686 0.0007396 Up 1.41...”

A4IFB0 UDP glycosyltransferase 8 from Bos taurus
34% identity, 92% coverage

• Glucosylceramide transferase in Giardia preferentially catalyzes the synthesis of galactosylceramide during encystation
  Robles-Martinez, Molecular and biochemical parasitology 2017
  • “...shows homology with vertebrate CGalT sequences in an alignment with the following taxa: Bos Taurus (A4IFB0), Homo sapiens (Q16880), Mus musculus (Q64676), Rattus norvegicus (Q09426), Gallus gallus (Q98TB5), Canis lupus familiaris (E2RA42), Felis catus (M3WVI1), Xenopus tropicalis (F6W899). Like CGalT, CGlcT has a predicted C-terminal transmembrane...”

AAK16234.1 UDP-Gal: ceramide galactosyltransferase (EC 2.4.1.47) (see protein)
Q98TB5 UDP-galactose ceramide galactosyltransferase from Gallus gallus
35% identity, 88% coverage

• Glucosylceramide transferase in Giardia preferentially catalyzes the synthesis of galactosylceramide during encystation
  Robles-Martinez, Molecular and biochemical parasitology 2017
  • “...taxa: Bos Taurus (A4IFB0), Homo sapiens (Q16880), Mus musculus (Q64676), Rattus norvegicus (Q09426), Gallus gallus (Q98TB5), Canis lupus familiaris (E2RA42), Felis catus (M3WVI1), Xenopus tropicalis (F6W899). Like CGalT, CGlcT has a predicted C-terminal transmembrane domain and a conserved ER retrieval sequence. Fig. 5 Modulation of gGlcT1...”

Q1ECX6 UDP glycosyltransferase 8 from Danio rerio
35% identity, 94% coverage

• Zebrafish models of skeletal dysplasia induced by cholesterol biosynthesis deficiency
  Anderson, Disease models & mechanisms 2020
  • “...ID: Q16880), UGT8 Gallus gallus (Entry ID: F 1NH08) and Ugt8 Danio rerio (Entry ID: Q1ECX6). These sequences were then aligned using MultAlin ( Corpet, 1988 ), using an absolute scoring method and Blosum62 symbol comparison table with a gap opening default value of 12 and...”

M3WVI1 UDP glycosyltransferase 8 from Felis catus
34% identity, 94% coverage

• Glucosylceramide transferase in Giardia preferentially catalyzes the synthesis of galactosylceramide during encystation
  Robles-Martinez, Molecular and biochemical parasitology 2017
  • “...Mus musculus (Q64676), Rattus norvegicus (Q09426), Gallus gallus (Q98TB5), Canis lupus familiaris (E2RA42), Felis catus (M3WVI1), Xenopus tropicalis (F6W899). Like CGalT, CGlcT has a predicted C-terminal transmembrane domain and a conserved ER retrieval sequence. Fig. 5 Modulation of gGlcT1 activity influences CWP synthesis and ESV biogenesis....”

CGT_RAT / Q09426 2-hydroxyacylsphingosine 1-beta-galactosyltransferase; Ceramide UDP-galactosyltransferase; CGalT; Cerebroside synthase; UDP-galactose-ceramide galactosyltransferase; EC 2.4.1.47 from Rattus norvegicus (Rat) (see 2 papers)
AAA16108.1 Ceramide 1-β-galactosyltransferase (EC 2.4.1.45) (see protein)
34% identity, 93% coverage

• function: Catalyzes the transfer of galactose to ceramide, a key enzymatic step in the biosynthesis of galactocerebrosides, which are abundant sphingolipids of the myelin membrane of the central nervous system and peripheral nervous system. Galactosylates both hydroxy- and non-hydroxy fatty acid-containing ceramides and diglycerides (PubMed:8713090).
  catalytic activity: an N-acylsphing-4-enine + UDP-alpha-D-galactose = a beta-D- galactosyl-(1<->1')-N-acylsphing-4-enine + UDP + H(+) (RHEA:13093)
  catalytic activity: N-(2-hydroxy-hexanoyl)-sphing-4-enine + UDP-alpha-D-galactose = N-(2-hydroxy-hexanoyl)-beta-D-galactosyl-sphing-4-enine + UDP + H(+) (RHEA:43400)
  catalytic activity: N-(2-hydroxy-hexanoyl)-sphinganine + UDP-alpha-D-galactose = N-(2-hydroxyhexanoyl)-beta-D-galactosylsphinganine + UDP + H(+) (RHEA:43404)
  catalytic activity: an N-acyl-sphingoid base + UDP-alpha-D-galactose = a D- galactosylceramide + UDP + H(+) (RHEA:48344)
• Identification of protein targets for the antidepressant effects of Kai-Xin-San in Chinese medicine using isobaric tags for relative and absolute quantitation.
  Dong, Neural regeneration research 2020
  • “...Q6IFW6, D3ZDA6, Q4FZU2, Q6IMF3, Q5U2Y6, P84087, D3ZDE4, Q6IG04, D3ZS28, E9PU01, Q64598, F1LNE8, Q6IG02, Q05140, G3V9B3, Q09426, D3ZAW2, Q3KRE8, P51907, Q6P6Q2, P10688, Q6IRG7, D3ZY19, Q924S1, F1LX47, Q5BK56, D4AA63, Q5FVF3, Q3SWT4, F1LN57, Q6IFU7, D3ZK01, G3V8E8, Q6PDW6, D3ZK70, Q5U2Q7, D4AAZ9, D3ZBE6, Q5FVQ2, F1LPT0, Q5I034, Q5I0K3, G3V7C4, B2RZ66, P68255, G3V6X7,...”
• Glucosylceramide transferase in Giardia preferentially catalyzes the synthesis of galactosylceramide during encystation
  Robles-Martinez, Molecular and biochemical parasitology 2017
  • “...with the following taxa: Bos Taurus (A4IFB0), Homo sapiens (Q16880), Mus musculus (Q64676), Rattus norvegicus (Q09426), Gallus gallus (Q98TB5), Canis lupus familiaris (E2RA42), Felis catus (M3WVI1), Xenopus tropicalis (F6W899). Like CGalT, CGlcT has a predicted C-terminal transmembrane domain and a conserved ER retrieval sequence. Fig. 5...”

XP_545033 2-hydroxyacylsphingosine 1-beta-galactosyltransferase from Canis lupus familiaris
34% identity, 94% coverage

• Ceramide galactosyltransferase (UGT8) as a molecular marker of canine mammary tumor malignancy.
  Nowak, Folia histochemica et cytobiologica 2013 (PubMed)
  • GeneRIF: The authors propose that UGT8 is associated with malignancy of canine mammary gland cells and may have a potential value as a diagnostic marker.

Q64676 2-hydroxyacylsphingosine 1-beta-galactosyltransferase from Mus musculus
33% identity, 93% coverage

• Metabolic Enzyme Alterations and Astrocyte Dysfunction in a Murine Model of Alexander Disease With Severe Reactive Gliosis
  Heaven, Molecular & cellular proteomics : MCP 2022
  • “...( GFAP Tg ;Gfap +/R236H /wild type) RNA-seq ( GFAP Tg ;Gfap +/R236H /wild type) Q64676 Ugt8 2-hydroxyacylsphingosine 1-beta-galactosyltransferase 4.28 1.72 P16330 Cnp 2,3-cyclic-nucleotide 3-phosphodiesterase 1.31 1.55 Q61885 Mog Myelin-oligodendrocyte glycoprotein 1.21 1.45 P04370 Mbp Myelin basic protein 1.46 1.40 Q9D2P8 Mobp Myelin-associated oligodendrocyte basic protein...”
• Glucosylceramide transferase in Giardia preferentially catalyzes the synthesis of galactosylceramide during encystation
  Robles-Martinez, Molecular and biochemical parasitology 2017
  • “...in an alignment with the following taxa: Bos Taurus (A4IFB0), Homo sapiens (Q16880), Mus musculus (Q64676), Rattus norvegicus (Q09426), Gallus gallus (Q98TB5), Canis lupus familiaris (E2RA42), Felis catus (M3WVI1), Xenopus tropicalis (F6W899). Like CGalT, CGlcT has a predicted C-terminal transmembrane domain and a conserved ER retrieval...”
• RNA sequencing and proteomics approaches reveal novel deficits in the cortex of Mecp2-deficient mice, a model for Rett syndrome.
  Pacheco, Molecular autism 2017
  • “...Yes 2 Retinal dehydrogenase Slc9a3r1 /NHERF1(P)* P70441 0.74 1.79 Yes 3 Scaffold protein Ugt8a /UGT8 Q64676 0.79 1.76 --- Sphingolipid metabolism Qdpr /QDPR (or DHPR)* Q8BVI4 0.74 1.68 Yes 2 Monoamine metabolism (tetrahydrobiopterin biosynthesis) Ugp2 /UGP2* Q91ZJ5 0.73 1.67 Yes 2 Glycogen synthesis Car2 /Ca2 P00920...”

CAA63090.1 UDP-Gal: ceramide 1-β-galactosyltransferase (EC 2.4.1.45) (see protein)
33% identity, 93% coverage

UGT8 / Q16880 N-acylsphingosine galactosyltransferase/bile acid galactosyltransferase (EC 2.4.1.47) from Homo sapiens (see 12 papers)
CGT_HUMAN / Q16880 2-hydroxyacylsphingosine 1-beta-galactosyltransferase; Ceramide UDP-galactosyltransferase; Cerebroside synthase; UDP-galactose-ceramide galactosyltransferase; EC 2.4.1.47 from Homo sapiens (Human) (see paper)
Q16880 N-acylsphingosine galactosyltransferase (EC 2.4.1.47) from Homo sapiens (see 2 papers)
NP_001309042 2-hydroxyacylsphingosine 1-beta-galactosyltransferase precursor from Homo sapiens
34% identity, 94% coverage

• function: Catalyzes the transfer of galactose to ceramide, a key enzymatic step in the biosynthesis of galactocerebrosides, which are abundant sphingolipids of the myelin membrane of the central nervous system and peripheral nervous system (PubMed:9125199). Galactosylates both hydroxy- and non-hydroxy fatty acid-containing ceramides and diglycerides (By similarity).
  catalytic activity: an N-acylsphing-4-enine + UDP-alpha-D-galactose = a beta-D- galactosyl-(1<->1')-N-acylsphing-4-enine + UDP + H(+) (RHEA:13093)
  catalytic activity: an N-acyl-sphingoid base + UDP-alpha-D-galactose = a D- galactosylceramide + UDP + H(+) (RHEA:48344)
  catalytic activity: N-(2-hydroxy-hexanoyl)-sphing-4-enine + UDP-alpha-D-galactose = N-(2-hydroxy-hexanoyl)-beta-D-galactosyl-sphing-4-enine + UDP + H(+) (RHEA:43400)
  catalytic activity: N-(2-hydroxy-hexanoyl)-sphinganine + UDP-alpha-D-galactose = N-(2-hydroxyhexanoyl)-beta-D-galactosylsphinganine + UDP + H(+) (RHEA:43404)
• SOX9-mediated UGT8 expression promotes glycolysis and maintains the malignancy of non-small cell lung cancer.
  Ji, Biochemical and biophysical research communications 2022 (PubMed)
  • GeneRIF: SOX9-mediated UGT8 expression promotes glycolysis and maintains the malignancy of non-small cell lung cancer.
• High FA2H and UGT8 transcript levels predict hydroxylated hexosylceramide accumulation in lung adenocarcinoma.
  Lemay, Journal of lipid research 2019
  • GeneRIF: High FA2H and UGT8 transcript levels predict hydroxylated hexosylceramide accumulation in lung adenocarcinoma
• Inhibition of UGT8 suppresses basal-like breast cancer progression by attenuating sulfatide-αVβ5 axis.
  Cao, The Journal of experimental medicine 2018
  • GeneRIF: UGT8 is a potential prognostic indicator and druggable target of basal-like breast cancer.
• Microbubble-based enhancement of radiation effect: Role of cell membrane ceramide metabolism.
  Al-Mahrouki, PloS one 2017
  • GeneRIF: An increase in the immunolabelling of ceramide was observed in cells where UDP glycosyltransferase 8 (UGT8) was down-regulated as opposed to cells where UGT8 was either not regulated or was up-regulated.
• Expression of Ceramide Galactosyltransferase (UGT8) in Primary and Metastatic Lung Tissues of Non-Small-Cell Lung Cancer.
  Rzechonek, Advances in experimental medicine and biology 2016 (PubMed)
  • GeneRIF: Data indicate that ceramide galactosyltransferase (UGT8), although enhanced in non-small cell lung carcinoma (NSCLC) tissues, does not meet the criteria of a lung tumor marker.
• A novel function for UDP glycosyltransferase 8: galactosidation of bile acids.
  Meech, Molecular pharmacology 2015 (PubMed)
  • GeneRIF: A new role was identified for UGT8 as a modulator of bile acid homeostasis.
• Ceramide galactosyltransferase expression is regulated positively by Nkx2.2 and negatively by OLIG2.
  Okahara, Glycobiology 2014 (PubMed)
  • GeneRIF: Our study suggests that CGT expression is controlled by balanced expression of the negative modulator OLIG2 and positive regulator Nkx2.2, providing new insights into how expression of GalCer is tightly regulated in cell-type- and stage-specific manners.
• Galactosylceramide affects tumorigenic and metastatic properties of breast cancer cells as an anti-apoptotic molecule.
  Owczarek, PloS one 2013
  • GeneRIF: High expression of UGT8 accompanied by accumulation of GalCer in MDA-MB-231 cells is associated with a much higher proliferative index and a lower number of apoptotic cells in comparison to the MDA/LUC-shUGT8 cells.
• More
• Zebrafish models of skeletal dysplasia induced by cholesterol biosynthesis deficiency
  Anderson, Disease models & mechanisms 2020
  • “...analysis All protein sequences were obtained from UniProtKB (UniProt, 2019): UGT8 Homo sapiens (Entry ID: Q16880), UGT8 Gallus gallus (Entry ID: F 1NH08) and Ugt8 Danio rerio (Entry ID: Q1ECX6). These sequences were then aligned using MultAlin ( Corpet, 1988 ), using an absolute scoring method...”
• Metabolism of Glycosphingolipids and Their Role in the Pathophysiology of Lysosomal Storage Disorders.
  Ryckman, International journal of molecular sciences 2020
  • “...CAZy Family Cer -Glc-transferase, GlcCer synthase, UGCG Q16739 GT21 Cer -Gal-transferase, GalCer synthase CGT, UGT8 Q16880 GT1 Cerebroside sulfotransferase, Gal3ST1, CST Q99999 - CerGlc 1,4Gal-transferase, B4GALT6, LacCer synthase Q9UBX8 GT7 GalNAc 1,3Gal-transferase, B3GALT4, GM2 synthase O96024 GT31 GlcNAc 1,3Gal-transferase, B3GALT5 Q9Y2C3 GT31 Gal 1,4Gal-transferase, A4GALT, Gb3...”
• Glucosylceramide transferase in Giardia preferentially catalyzes the synthesis of galactosylceramide during encystation
  Robles-Martinez, Molecular and biochemical parasitology 2017
  • “...vertebrate CGalT sequences in an alignment with the following taxa: Bos Taurus (A4IFB0), Homo sapiens (Q16880), Mus musculus (Q64676), Rattus norvegicus (Q09426), Gallus gallus (Q98TB5), Canis lupus familiaris (E2RA42), Felis catus (M3WVI1), Xenopus tropicalis (F6W899). Like CGalT, CGlcT has a predicted C-terminal transmembrane domain and a...”

F6W899 UDP glycosyltransferase 8 from Xenopus tropicalis
35% identity, 82% coverage

• Glucosylceramide transferase in Giardia preferentially catalyzes the synthesis of galactosylceramide during encystation
  Robles-Martinez, Molecular and biochemical parasitology 2017
  • “...Rattus norvegicus (Q09426), Gallus gallus (Q98TB5), Canis lupus familiaris (E2RA42), Felis catus (M3WVI1), Xenopus tropicalis (F6W899). Like CGalT, CGlcT has a predicted C-terminal transmembrane domain and a conserved ER retrieval sequence. Fig. 5 Modulation of gGlcT1 activity influences CWP synthesis and ESV biogenesis. ( A )...”

AAC50565.1 UDP-galactose:ceramide 1-β-galactosyltransferase (CGalT) (EC 2.4.1.45) (see protein)
33% identity, 94% coverage

LOC107315928 2-hydroxyacylsphingosine 1-beta-galactosyltransferase-like from Coturnix japonica
34% identity, 88% coverage

• Uterus-specific transcriptional regulation underlies eggshell pigment production in Japanese quail
  Ishishita, PloS one 2022
  • “...kb on either side (nucleotide positions 14.2314.61 Mb), of which six genes ( PIK3AP1 , LOC107315928 [ 2-hydroxyacylsphingosine 1-beta-galactosyltransferase-like ], PITX3 , TMEM150A , PSD , and CUEDC2 ), were substantially downregulated in the mutant (their expression was less than approximately 70% of that in the...”

XP_016863792 UDP-glucuronosyltransferase 2B28 isoform X1 from Homo sapiens
40% identity, 68% coverage

• UGT2B28 accelerates prostate cancer progression through stabilization of the endocytic adaptor protein HIP1 regulating AR and EGFR pathways.
  Lacombe, Cancer letters 2023 (PubMed)
  • GeneRIF: UGT2B28 accelerates prostate cancer progression through stabilization of the endocytic adaptor protein HIP1 regulating AR and EGFR pathways.
• Extensive metabolic consequences of human glycosyltransferase gene knockouts in prostate cancer.
  Rouleau, British journal of cancer 2023
  • GeneRIF: Extensive metabolic consequences of human glycosyltransferase gene knockouts in prostate cancer.
• Uridine Diphosphate Glucuronosyl Transferase 2B28 (UGT2B28) Promotes Tumor Progression and Is Elevated in African American Prostate Cancer Patients.
  Ravindran, Cells 2022
  • GeneRIF: Uridine Diphosphate Glucuronosyl Transferase 2B28 (UGT2B28) Promotes Tumor Progression and Is Elevated in African American Prostate Cancer Patients.
• Whole exome sequencing identifies hemizygous deletions in the UGT2B28 and USP17L2 genes in a three‑generation family with endometriosis.
  Albertsen, Molecular medicine reports 2019
  • GeneRIF: further analysis revealed 2 hemizygous deletions in the grandmother that segregate in several of her affected offspring. The first deletion was found in the UGT2B28 locus, spanning 7 informative sequence variants across at least 14 kb. The second deletion, located in USP17L2, spans 3 informative variants across at least 2 kb. On the whole, the findings of the presents study implicate 2 additional genes in the pathogenesis
• Ages of hepatocellular carcinoma occurrence and life expectancy are associated with a UGT2B28 genomic variation.
  Le, BMC cancer 2019
  • GeneRIF: Patients with UGT2B28-rs2132039 - TT variant type had an earlier presentation of hepatocellular carcinoma (HCC), earlier post-surgery recurrence, metastasis and HCC-related death.
• rs142362919 and rs7681187 Are cis-Regulatory Variations for Human UGT2B28 in Breast.
  Wang, Journal of clinical pharmacology 2018 (PubMed)
  • GeneRIF: Our effort identified 2 novel functional regulatory SNPs for UGT2B28, which might contribute to metabolism variation of related steroid hormones in breast.
• Genetic variations in UGT2B28, UGT2B17, UGT2B15 genes and the risk of prostate cancer: A case-control study.
  Habibi, Gene 2017 (PubMed)
  • GeneRIF: Findings suggest that the D85Y polymorphism of UGT2B15 and CNVs in UGT2B28 and UGT2B17 genes is not associated with prostate cancer risk in Iranian patients.
• The UGT2B28 Sex-steroid Inactivation Pathway Is a Regulator of Steroidogenesis and Modifies the Risk of Prostate Cancer Progression.
  Belledant, European urology 2016 (PubMed)
  • GeneRIF: The androgen-inactivating UGT2B28 enzyme influences hormone levels, clinical and pathologic factors, and the risk of prostate cancer progression.
• More

LOC100228968 2-hydroxyacylsphingosine 1-beta-galactosyltransferase from Taeniopygia guttata
34% identity, 92% coverage

• Transcriptomic changes in the posterior pallium of male zebra finches associated with social niche conformance
  Riyahi, BMC genomics 2024
  • “...Protein Subunit Alpha 11 0.163 0.044 RND3 Rho Family GTPase 3 0.138 0.044 Predicted: UGT8 (LOC100228968) 2-hydroxyacylsphingosine 1-beta galactosyltransferase 0.813 0.099 Pallium: higher expression in the Single-pair treatment level Predicted: MTTP (LOC105759397) Microsomal triglyceride transfer protein large subunit -2.596 0.031 Predicted: SMAD6 (LOC105758838) Mothers against decapentaplegic...”

LOC100547576 UDP-glucuronosyltransferase 1-1-like from Meleagris gallopavo
47% identity, 49% coverage

• Comparative Response of the Hepatic Transcriptomes of Domesticated and Wild Turkey to Aflatoxin B₁
  Reed, Toxins 2018
  • “...cytochrome P450 2W1-like LOC100547030 0.0000 7.6458 0.0000 13.6234 1.0000 0.2262 0.0010 5.8718 cytochrome P450 2W1-like LOC100547576 0.0000 4.3115 0.0000 5.2719 0.0014 1.0131 1.0000 0.1127 UDP-glucuronosyltransferase 1-1-like LOC100547627 0.7689 0.1433 0.0094 0.7229 0.0023 1.0592 0.7311 0.2480 sulfotransferase family cytosolic 1B member 1 LOC100547794 0.0284 0.7020 0.9613 0.0689...”

LOC108635023 UDP-glucuronosyltransferase 2B18-like from Capra hircus
64% identity, 37% coverage

• Hepatic Lipid Accumulation and Dysregulation Associate with Enhanced Reactive Oxygen Species and Pro-Inflammatory Cytokine in Low-Birth-Weight Goats
  Liu, Animals : an open access journal from MDPI 2022
  • “...metabolism - cytochrome P450 KO00982 LOC102175204 (UDP-glucuronosyltransferase 2B4) LOC102181105 (alcohol dehydrogenase E chain isoform X1) LOC108635023 (UDP-glucuronosyltransferase 2B18-like) Oxidative phosphorylation KO00190 Capra_hircus_newGene_23729 Capra_hircus_newGene_43596 Capra_hircus_newGene_43600 Capra_hircus_newGene_48268 Inflammation Leukocyte transendothelial migration KO04670 NCF4 (neutrophil cytosol factor 4 isoform X1) PTK2B (protein-tyrosine kinase 2-beta isoform X1) NF-kappa B signaling...”

Q6NUS8 glucuronosyltransferase (EC 2.4.1.17) from Homo sapiens (see 2 papers)
CAC42674.1 UDP-GlcNAc: ursodeoxycholic acid β-N-acetylglucosaminyltransferase (UGT3A1;LOC133688) (UGT3A1) (EC 2.4.1.-) (see protein)
31% identity, 96% coverage

• Similarities in Structure and Function of UDP-Glycosyltransferase Homologs from Human and Plants.
  Lethe, International journal of molecular sciences 2024
  • “...which shares 25% homology. The AlphaFold2 prediction is also available for UGT3A1 (from UniProtKB; accession Q6NUS8). A structural comparison between UGT71G1 and UGT3A1 shows significant differences in surface loops and helices, but they still align well enough to show a common origin. The listed acceptor substrates...”
• Bioinformatic characterization of angiotensin-converting enzyme 2, the entry receptor for SARS-CoV-2.
  Barker, PloS one 2020
  • “...Solute carrier family 13 member 1 secondary carrier transporter (PC00258) kidney UGT3A1 0.8608 4.52E-26 26625 Q6NUS8 UDP-glucuronosyltransferase 3A1 kidney SLC27A2 0.8535 3.26E-25 10996 O14975 Very long-chain acyl-CoA synthetase secondary carrier transporter (PC00258) kidney TMEM27 0.8526 4.1E-25 29437 Q9HBJ8 Collectrin kidney CLRN3 0.8443 3.36E-24 20795 Q8NCR9 Clarin-3...”
• Massive peptide sharing between viral and human proteomes
  Kanduc, Peptides 2008
  • “...TSH3_HUMAN; Q6ZNA9; Q5TG33 17 OR5U1_HUMAN; Q9BRW6; FBX2_HUMAN; Q5TAE7; Q5T011; ELOV2_HUMAN; Q8NC43; Q5JR89 18 Q6ZRR8; Q5T435; Q6NUS8; CX033_HUMAN; ALG1_HUMAN; Q6ZUT0; Q86UH7; NCKX5_HUMAN; Q9BRY8; RT34_HUMAN; PODO_HUMAN; Q6ZNI2; Q6UXQ0 19 Q6ZTL0; Q6H9L7; Q96I32; PIPNA_HUMAN; Q9H5L8; Q5W0W3; Q9UMD0; Q5T9C4; Q5VU34; Q8N996; TRI11_HUMAN; Q5T884; Q6VEP3 20 VPS16_HUMAN; GLUC_HUMAN; Q5TI49; DAF_HUMAN; Q4G1H0;...”

Q3SY77 glucuronosyltransferase (EC 2.4.1.17) from Homo sapiens (see 2 papers)
32% identity, 91% coverage

• Global and Comparative Proteome Signatures in the Lens Capsule, Trabecular Meshwork, and Iris of Patients With Pseudoexfoliation Glaucoma
  Sahay, Frontiers in molecular biosciences 2022
  • “...(GATM) 2.7508166 9 P30711 Glutathione S-transferase theta-1 (GSTT1) 2.7638696 10 Q06828 Fibromodulin (FMOD) 2.7716544 11 Q3SY77 UDP-glucuronosyltransferase 3A2 (UGT3A2) 2.8206772 12 Q15370 Transcription elongation factor B polypeptide 2 (TCEB2) 2.828358 13 P21281 V-type proton ATPase subunit B, brain isoform (ATP6V1B2) 2.9473999 14 O00292 Left-right determination factor...”
• Altered Metabolism of Polycyclic Aromatic Hydrocarbons by UDP-Glycosyltransferase 3A2 Missense Variants.
  Vergara, Chemical research in toxicology 2020
  • “...from the SWISS-MODEL Repository ( http://swissmodel.expasy.org/ ) using the search term ugt3a2. UniProtKB accession number Q3SY77, corresponding to the human UGT3A2 sequence, was selected, and model coordinates were downloaded. The model of UGT3A2 was built by standard SWISS-MODEL Repository procedures based on available coordinates for UGT76G1...”

XP_011512261 UDP-glucuronosyltransferase 3A1 isoform X4 from Homo sapiens
31% identity, 83% coverage

• UDP-Glycosyltransferase 3A Metabolism of Polycyclic Aromatic Hydrocarbons: Potential Importance in Aerodigestive Tract Tissues.
  Vergara, Drug metabolism and disposition: the biological fate of chemicals 2020
  • GeneRIF: UDP-Glycosyltransferase 3A Metabolism of Polycyclic Aromatic Hydrocarbons: Potential Importance in Aerodigestive Tract Tissues.
• Identification of residues that confer sugar selectivity to UDP-glycosyltransferase 3A (UGT3A) enzymes.
  Meech, The Journal of biological chemistry 2012
  • GeneRIF: An asparagine (Asn-391) in the UGT signature sequence of UGT3A1 is necessary for utilization of UDP-GlcNAc.
• UGT3A: novel UDP-glycosyltransferases of the UGT superfamily.
  Meech, Drug metabolism reviews 2010 (PubMed)
  • GeneRIF: UGT3A1 is involved in drug metabolism and uses UDP N-acetylglucosamine as a sugar donor
• Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
  Flachsbart, Mutation research 2010 (PubMed)
  • GeneRIF: Observational study of gene-disease association. (HuGE Navigator)
• Identification of UDP glycosyltransferase 3A1 as a UDP N-acetylglucosaminyltransferase.
  Mackenzie, The Journal of biological chemistry 2008
  • GeneRIF: UDP glycosyltransferase 3A1 is a UDP N-acetylglucosaminyltransferase
• Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
  Rose, Molecular medicine (Cambridge, Mass.)
  • GeneRIF: Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

UGT2 / A0A291PQH4 kermesate C-glycosyltranferase from Dactylopius coccus (see 2 papers)
UGT2_DACCO / A0A291PQH4 UDP-glucosyltransferase 2; DcUGT2; EC 2.4.1.- from Dactylopius coccus (Cochineal) (see paper)
35% identity, 73% coverage

• function: Membrane-bound UDP-glucosyltransferase (UGT) which catalyzes the C-glucosylation of kermesate and flavokermesate to produce carminate and flavokermesate 7-C-beta-D-glucoside (dcll) respectively (PubMed:29215010). Carminate is used as a deterrent against insect predators (PubMed:29215010).
  catalytic activity: kermesate + UDP-alpha-D-glucose = carminate + UDP + 2 H(+) (RHEA:63752)
  catalytic activity: flavokermesate + UDP-alpha-D-glucose = flavokermesate 7-C- beta-D-glucoside + UDP + 2 H(+) (RHEA:63756)

LOC105218578 UDP-glycosyltransferase UGT5 from Zeugodacus cucurbitae
31% identity, 97% coverage

• Identification of testis development-related genes by combining Iso-Seq and RNA-Seq in Zeugodacus tau
  Liu, Frontiers in cell and developmental biology 2024
  • “...(1 RDH (LOC105212701), 3 SDR16C (LOC105209516, LOC105209517, and LOC105213735) and 3 UGT (LOC105209919, LOC105210791, and LOC105218578)) were significantly continuously upregulated. Additionally, the expression level of 1 DGAT ( Dgat1_0 ) and 6 UGT (LOC105210436, LOC105218581, LOC105219093, LOC105219094, LOC105220158, and LOC105221422) was significantly increased and plateaued (...”
  • “...26.58083 no * LOC105210436 0.416249 1.227206 1.176597 no * LOC105210791 2.563174 6.072815 8.231448 * * LOC105218578 0.473939 3.880796 11.32484 * * LOC105218581 1.9247 4.529353 3.680961 * * LOC105219093 0.553394 2.890756 2.247317 * * LOC105219094 2.26124 14.76726 11.56811 * * LOC105220158 12.73465 27.6289 27.27457 * * LOC105221422...”

UGT5_DACCO / A0A291PQF1 UDP-glycosyltransferase UGT5; UDP-glucosyltransferase 5; DcUGT5; EC 2.4.1.- from Dactylopius coccus (Cochineal) (see paper)
36% identity, 66% coverage

• function: Catalyzes the transfer of a glycosyl group from a UDP-sugar to an acceptor molecule.

LOC104915473 UDP-glucuronosyltransferase 1-9-like from Meleagris gallopavo
43% identity, 54% coverage

• Comparative Response of the Hepatic Transcriptomes of Domesticated and Wild Turkey to Aflatoxin B₁
  Reed, Toxins 2018
  • “...alcohol dehydrogenase 1-like LOC104915446 0.0000 3.8678 0.0000 5.4661 0.1525 0.6518 0.4129 0.8857 alcohol dehydrogenase 1-like LOC104915473 0.0000 1.5141 0.8643 0.0874 0.8777 0.3084 0.0010 1.0674 UDP-glucuronosyltransferase 1-9-like LOC104915474 0.8756 0.1560 0.0000 3.7112 0.0000 2.5312 0.0418 0.9617 UDP-glucuronosyltransferase 1-6-like LOC104915476 0.0006 1.6704 0.9112 0.1504 0.4764 1.0151 0.6292 0.4445...”

XP_967924 UDP-glycosyltransferase UGT5-like from Tribolium castaneum
32% identity, 91% coverage

• Microarray analysis yields candidate markers for rotation resistance in the western corn rootworm beetle, Diabrotica virgifera virgifera
  Knolhoff, Evolutionary applications 2010
  • “...EW761417 511 C 6.07 6.83 None (no open reading frame) CN497825 742 C 6.60 5.71 XP_967924 ( S = 125, E = 2e-27) UDP-glucoronosyl and UDP-glucosyl transferase XP_967924: PREDICTED: similar to CG18578-PA ( S = 125, E = 2e-27) Contig1160 * 889 C 4.66 5.54 ACI32832...”

LOC656120 UDP-glycosyltransferase UGT5 from Tribolium castaneum
32% identity, 89% coverage

• Insecticidal Activity of Artemisia vulgaris Essential Oil and Transcriptome Analysis of Tribolium castaneum in Response to Oil Exposure
  Gao, Frontiers in genetics 2020
  • “...I LOC657454 1.27 Up 2.98E-30 CYP9AC1 Phase I LOC661469 1.24 Up 0.000982 CSP17 Phase 0 LOC656120 1.22 Up 1.19E-27 Ugt2B16 Phase II LOC659847 1.15 Up 4.96E-63 MRP49 Phase III LOC659009 1.13 Up 4.50E-45 GSTs7 Phase II LOC656770 1.12 Up 6.93E-55 CYP6BK11 Phase I LOC661219 1.12 Up...”

NP_001161788 UDP-glucuronosyltransferase 3A2 isoform 2 precursor from Homo sapiens
33% identity, 72% coverage

• Identification of residues that confer sugar selectivity to UDP-glycosyltransferase 3A (UGT3A) enzymes.
  Meech, The Journal of biological chemistry 2012
  • GeneRIF: A phenylalanine (Phe-391) in UGT3A2 favors UDP-Glc use.
• MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
  Zhang, Carcinogenesis 2010
  • GeneRIF: Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)

XP_001638304 UDP-glucuronosyltransferase 2A3 isoform X2 from Nematostella vectensis
32% identity, 76% coverage

• Coral-zooxanthellae meta-transcriptomics reveals integrated response to pollutant stress
  Gust, BMC genomics 2014
  • “...increased expression of potential detoxification mechanisms (i.e. cytochrome P450, XP_001624662, and UDP glucuronosyltransferase 2 family, XP_001638304, Figure 5 ). Carbohydrate metabolism was the most represented second order KEGG term in the 0.5mg/L treatment. All transcripts involved in carbohydrate metabolism had increased expression (Additional file 2 :...”

LOC100142486 UDP-glycosyltransferase UGT5 from Tribolium castaneum
32% identity, 52% coverage

• Insecticidal Activity of Artemisia vulgaris Essential Oil and Transcriptome Analysis of Tribolium castaneum in Response to Oil Exposure
  Gao, Frontiers in genetics 2020
  • “...0 LOC657560 1.07 Up 3.78E-13 CYP6A14 Phase I LOC657825 1.12 Down 1.27E-15 BG Phase II LOC100142486 1.17 Down 1.98E-46 Ugt86Dc Phase II LOC656306 1.22 Down 3.25E-57 CYP4BN5 Phase I LOC655331 1.24 Down 5.47E-242 GSTe7 Phase II LOC655415 1.33 Down 3.03E-92 GSTe8 Phase II LOC658886 1.42 Down...”

LOC100166729 UDP-glucuronosyltransferase 2B2 from Acyrthosiphon pisum
29% identity, 90% coverage

• Increases in Genistein in Medicago sativa Confer Resistance against the Pisum Host Race of Acyrthosiphon pisum
  Yuan, Insects 2019
  • “...race and Pisum host race. Gene ID Putative Function log2 Fold Change 1 Probability 2 LOC100166729 UDP-glucuronosyltransferase 2B2 4.42 up 0.93 LOC100169601 UDP-glucuronosyltransferase 2B17 6.40 up 0.88 LOC100159691 UDP-glucuronosyltransferase 1-7C-like 2.58 up 0.89 LOC100570856 glutathione S-transferase 1.74 up 0.87 LOC100572007 cytochrome P450, family 6-like 2.61 up...”

LOC109408672 UDP-glycosyltransferase UGT5 from Aedes albopictus
29% identity, 92% coverage

• Insecticide resistance in the field populations of the Asian tiger mosquito <i>Aedes albopictus</i> in Beijing: resistance status and associated detoxification genes
  Zhou, Frontiers in physiology 2024
  • “...5.73* 5.52E-10 UGT49C1b LOC109426260 12.43 58.15 4.56* 1.65E-02 18.99 1.37 4.81E-01 34.03 2.22* 5.97E-11 UGT5 LOC109408672 3.87 17.61 4.40* 4.60E-03 10.07 2.38* 1.87E-02 16.88 3.59* 4.69E-13 ABCs ABCG1 LOC109428250 16.05 46.11 2.63* 6.16E-03 22.86 1.29 5.84E-01 52.64 2.68* 3.31E-19 ABCG1-X1 LOC109429973 6.41 16.74 2.34* 6.77E-03 12.10...”

LOC128919756 UDP-glycosyltransferase UGT5-like from Zeugodacus cucurbitae
31% identity, 92% coverage

• Identification of testis development-related genes by combining Iso-Seq and RNA-Seq in Zeugodacus tau
  Liu, Frontiers in cell and developmental biology 2024
  • “...developments (T1T11). With the development of testis (from T1 to T11), only one UGT gene (LOC128919756) was continuously downregulated. Seven genes (1 RDH (LOC105212701), 3 SDR16C (LOC105209516, LOC105209517, and LOC105213735) and 3 UGT (LOC105209919, LOC105210791, and LOC105218578)) were significantly continuously upregulated. Additionally, the expression level of...”
  • “...no * LOC105209517 0.256519 0.672628 1.740267 no * LOC105213735 13.17173 51.44456 63.12685 * * UGT LOC128919756 8.726864 5.028652 0.848712 * * LOC105209919 12.46673 21.09953 26.58083 no * LOC105210436 0.416249 1.227206 1.176597 no * LOC105210791 2.563174 6.072815 8.231448 * * LOC105218578 0.473939 3.880796 11.32484 * * LOC105218581...”

LOC105219094 UDP-glucosyltransferase 2 from Zeugodacus cucurbitae
29% identity, 98% coverage

• Identification of testis development-related genes by combining Iso-Seq and RNA-Seq in Zeugodacus tau
  Liu, Frontiers in cell and developmental biology 2024
  • “...the expression level of 1 DGAT ( Dgat1_0 ) and 6 UGT (LOC105210436, LOC105218581, LOC105219093, LOC105219094, LOC105220158, and LOC105221422) was significantly increased and plateaued ( Table 2 ). Therefore, these retinol metabolism-associated DEGs with specific expression patterns were highly likely to be involved in testis development....”
  • “...11.32484 * * LOC105218581 1.9247 4.529353 3.680961 * * LOC105219093 0.553394 2.890756 2.247317 * * LOC105219094 2.26124 14.76726 11.56811 * * LOC105220158 12.73465 27.6289 27.27457 * * LOC105221422 2.08642 5.149338 5.300399 * * Vitamin B6 metabolism PNPO LOC105219330 4.915588 10.87719 9.781125 * * PDXK LOC105220897 4.831618...”

LOC105218581 UDP-glucosyltransferase 2 from Zeugodacus cucurbitae
30% identity, 88% coverage

• Identification of testis development-related genes by combining Iso-Seq and RNA-Seq in Zeugodacus tau
  Liu, Frontiers in cell and developmental biology 2024
  • “...upregulated. Additionally, the expression level of 1 DGAT ( Dgat1_0 ) and 6 UGT (LOC105210436, LOC105218581, LOC105219093, LOC105219094, LOC105220158, and LOC105221422) was significantly increased and plateaued ( Table 2 ). Therefore, these retinol metabolism-associated DEGs with specific expression patterns were highly likely to be involved in...”
  • “...1.176597 no * LOC105210791 2.563174 6.072815 8.231448 * * LOC105218578 0.473939 3.880796 11.32484 * * LOC105218581 1.9247 4.529353 3.680961 * * LOC105219093 0.553394 2.890756 2.247317 * * LOC105219094 2.26124 14.76726 11.56811 * * LOC105220158 12.73465 27.6289 27.27457 * * LOC105221422 2.08642 5.149338 5.300399 * * Vitamin...”

UD3A2_MOUSE / Q8JZZ0 UDP-glucuronosyltransferase 3A2; UDPGT 3A2; EC 2.4.1.17 from Mus musculus (Mouse) (see paper)
33% identity, 69% coverage

• function: UDP-glucuronosyltransferases catalyze phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. They are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds (By similarity).
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
• Deciphering the Kidney Matrisome: Identification and Quantification of Renal Extracellular Matrix Proteins in Healthy Mice
  Rende, International journal of molecular sciences 2023
  • “...the MD. Protein ID Protein Name Gene Symbol Identified by Method Ref * CME SME Q8JZZ0 Alpha-2-macroglobulin; Alpha-2-macroglobulin 165 kDa subunit; Alpha-2-macroglobulin 35 kDa subunit A2m + MD P09470 Angiotensin-converting enzyme Ace + + [ 40 ] Q8R0I0 Angiotensin-converting enzyme 2 Ace2 + + [ 38...”
• Dataset on the mass spectrometry-based proteomic profiling of the kidney from wild type and the dystrophic mdx-4cv mouse model of X-linked muscular dystrophy.
  Dowling, Data in brief 2020
  • “...Transmembrane protein 33 Tmem33 2 6.1302 0.00735 1.38 Q61207 Prosaposin Psap 2 5.1656 0.00022 1.37 Q8JZZ0 UDP-glucuronosyltransferase 3A2 Ugt3a2 2 6.4221 0.02672 1.37 Q9DBX3 Sushi domain-containing protein 2 Susd2 4 14.5368 0.00470 1.37 Q9Z1J3 Cysteine desulfurase, mitochondrial Nfs1 2 11.6958 1.28E-05 1.36 Q3U9G9 Lamin-B receptor Lbr...”
• Alport syndrome: Proteomic analysis identifies early molecular pathway alterations in Col4a3 knock out mice.
  Nicolaou, Nephrology (Carlton, Vic.) 2020
  • “...2.74E04 14.7 MM NN Protein S100A8 P20852 CP2A5 1.59E02 4.0 MM NN Cytochrome P450 2A5 Q8JZZ0 UD3A2 2.03E06 3.0 MM NN UDPglucuronosyltransferase 3A2 Q99K74 MED24 1.09E02 2.5 MM NN Mediator of RNA polymerase II transcription subunit 24 Q9JIY7 NAT8 1.86E02 2.2 MM NN Nacetyltransferase 8 Q8K0H1...”

UD3A1_MOUSE / Q3UP75 UDP-glucuronosyltransferase 3A1; UDPGT 3A1; EC 2.4.1.17 from Mus musculus (Mouse) (see paper)
30% identity, 86% coverage

• function: UDP-glucuronosyltransferases catalyze phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. They are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds (By similarity).
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)

LOC105219093 UDP-glycosyltransferase UGT5 from Zeugodacus cucurbitae
36% identity, 61% coverage

• Identification of testis development-related genes by combining Iso-Seq and RNA-Seq in Zeugodacus tau
  Liu, Frontiers in cell and developmental biology 2024
  • “...Additionally, the expression level of 1 DGAT ( Dgat1_0 ) and 6 UGT (LOC105210436, LOC105218581, LOC105219093, LOC105219094, LOC105220158, and LOC105221422) was significantly increased and plateaued ( Table 2 ). Therefore, these retinol metabolism-associated DEGs with specific expression patterns were highly likely to be involved in testis...”
  • “...8.231448 * * LOC105218578 0.473939 3.880796 11.32484 * * LOC105218581 1.9247 4.529353 3.680961 * * LOC105219093 0.553394 2.890756 2.247317 * * LOC105219094 2.26124 14.76726 11.56811 * * LOC105220158 12.73465 27.6289 27.27457 * * LOC105221422 2.08642 5.149338 5.300399 * * Vitamin B6 metabolism PNPO LOC105219330 4.915588 10.87719...”

Q9XYN3 UDP-glucuronosyltransferase from Drosophila melanogaster
31% identity, 90% coverage

• A First Glimpse of the Mexican Fruit Fly Anastrepha ludens (Diptera: Tephritidae) Antenna Morphology and Proteome in Response to a Proteinaceous Attractant
  Ruiz-May, International journal of molecular sciences 2020
  • “...upregulated: cytochrome Cyp4p1 (Q9V558), Cyp4e1 (Q9V4T5), Cypr (Q8IPJ7), GstO1 (Q9VSL6), AOX3 (Q9VF51), and UDP-glucuronosyltransferase (Ugt35b, Q9XYN3). Furthermore, the Cyp6a9 (Q27594), thioester-containing protein 4 (Tep4, M9PD73), AOX1 (Q9VF53), and GstE9 (Q7K8X7), in the group III, were also upregulated in sexually mature females (24h_15D). Mature male flies treated...”

LOC105220158 uncharacterized protein LOC105220158 from Zeugodacus cucurbitae
31% identity, 44% coverage

• Identification of testis development-related genes by combining Iso-Seq and RNA-Seq in Zeugodacus tau
  Liu, Frontiers in cell and developmental biology 2024
  • “...genes (2 belonging to SDR16C (LOC105209516 and LOC105213735) and 2 belonging to UGT (LOC105209919 and LOC105220158)) was higher than the remaining 11 genes throughout testis developments (T1T11). With the development of testis (from T1 to T11), only one UGT gene (LOC128919756) was continuously downregulated. Seven genes...”
  • “...expression level of 1 DGAT ( Dgat1_0 ) and 6 UGT (LOC105210436, LOC105218581, LOC105219093, LOC105219094, LOC105220158, and LOC105221422) was significantly increased and plateaued ( Table 2 ). Therefore, these retinol metabolism-associated DEGs with specific expression patterns were highly likely to be involved in testis development. TABLE...”

LOC113510033 UDP-glucosyltransferase 2-like from Galleria mellonella
26% identity, 97% coverage

• RNAi-mediated knockdown of gut receptor-like genes prohibitin and α-amylase altered the susceptibility of Galleria mellonella to Cry1AcF toxin
  Dutta, BMC genomics 2022
  • “...1869 MZ576276 623 68.53 7.56 ADAM LOC113515341 51805 17 4476 MZ576274 990 111.99 8.12 UDP-GT LOC113510033 4642 4 1852 MZ561436 431 49.67 6.93 arylphorin LOC113516268 3829 5 2195 MZ576275 702 83.37 5.09 a Coding sequences with accession numbers are cloned and sequenced from the midgut mRNA...”

LOC660846 UDP-glycosyltransferase UGT5 from Tribolium castaneum
29% identity, 90% coverage

• Insecticidal Activity of Artemisia vulgaris Essential Oil and Transcriptome Analysis of Tribolium castaneum in Response to Oil Exposure
  Gao, Frontiers in genetics 2020
  • “...LOC103313826 2.22 Down 8.77E-05 FMO 2 Phase I LOC664598 2.25 Down 0 OBPC01 Phase 0 LOC660846 2.44 Down 7.10E-103 Ugt2C1 Phase II LOC662337 2.49 Down 6.97E-127 CYP4C1 Phase I LOC107398495 2.77 Down 7.86E-25 GSTe4 like Phase II LOC664475 2.87 Down 5.91E-05 CYP6A20 Phase I LOC661930 3.09...”

LOC661967, XP_973188 UDP-glycosyltransferase UGT5 from Tribolium castaneum
29% identity, 98% coverage

• Insecticidal Activity of Artemisia vulgaris Essential Oil and Transcriptome Analysis of Tribolium castaneum in Response to Oil Exposure
  Gao, Frontiers in genetics 2020
  • “...II LOC655415 1.33 Down 3.03E-92 GSTe8 Phase II LOC658886 1.42 Down 1.80E-08 XDH Phase I LOC661967 1.48 Down 7.35E-79 Ugt2B20 Phase II LOC659878 1.51 Down 1.31E-71 CYP4Q1 Phase I LOC662300 1.99 Down 3.03E-22 CYP351A3 Phase I LOC661799 2.15 Down 9.46E-10 CSP8 Phase 0 LOC103313826 2.22 Down...”
• Analysis of Transcripts Expressed in One-Day-Old Larvae and Fifth Instar Silk Glands of Tasar Silkworm, Antheraea mylitta
  Maity, Comparative and functional genomics 2010
  • “...larvae (1d) (C) Other categories (1) Detoxification Am[023] 15 Slucosyl/glucuronosyl transferases [ Tribolium castaneum ] XP_973188 7.00 E 60 Silk gland Am[039] 9 Carboxylesterase [ Bombyx mori ] NP_001040411 6.00 E 37 larvae (1d) Am[049] 8 Glutathione S-transferase theta [ Antheraea pernyi ] ACB36909 2 e...”

LOC115065792 UDP-glucosyltransferase 2 from Bactrocera dorsalis
29% identity, 88% coverage

• AANAT1 regulates insect midgut detoxification through the ROS/CncC pathway
  Zeng, Communications biology 2024
  • “...(GstE4) , LOC105229682 (GstE7) , LOC105229681 (GstE9) , LOC105233810 (Cyp6g2) , LOC105224660 (UGT36-D1) , and LOC115065792 (UGT49-C1) to vitamin C treatment. l Effect of vitamin C treatment on flies to trichlorphon. SS, sensitive strain, VC, vitamin C. Ten-day old adults mixed with the same number of...”

LOC112052352 uncharacterized protein LOC112052352 from Bicyclus anynana
30% identity, 40% coverage

• Transcriptional responses of Daphnis nerii larval midgut to oral infection by Daphnis nerii cypovirus-23
  Kuang, Virology journal 2021
  • “...hypothetical protein B5X24_HaOG201493 [Helicoverpa armigera] RDH12 TRINITY_DN9738_c0_g1_i1_6 438.41149 83.17535239 0.189719828 0.04256225 0.7412925 Down uncharacterized protein LOC112052352 [Bicyclus anynana] UGT TRINITY_DN8673_c0_g1_i3_3 839.7824168 167.2848772 0.199200262 0.00073535 0.0803495 Down PREDICTED: UDP-glucuronosyltransferase 2B19-like isoform X6 [Amyelois transitella] UGT TRINITY_DN17220_c0_g1_i1_4 6379.593263 3.929259199 0.000615911 0.00570705 0.2744919 Down UDP-glycosyltransferase UGT340C1 precursor [Bombyx mori]...”

Q9VGT8 UDP-glucuronosyltransferase from Drosophila melanogaster
29% identity, 90% coverage

• Satellite DNA-like elements associated with genes within euchromatin of the beetle Tribolium castaneum
  Brajković, G3 (Bethesda, Md.) 2012
  • “...P41596 FBgn0011582 Transposon 900 D6X259 656290 Transport and Golgi organization 13 9 14 5 9456 Q9VGT8 FBgn0040256 Satellite 222 0.6 D6X260 656373 Protein-tyrosine sulfotransferase 9 14 3 33,523 Q9VYB7 FBgn0086674 Satellite 222 0.6 D6X075 658603 MICAL-like protein 9 15 5 39,684 Q9VU34 FBgn0036333 Satellite 203 0.6...”

LOC100649407 UDP-glucosyltransferase 2 from Bombus terrestris
28% identity, 91% coverage

• Diesel exhaust particles alter gut microbiome and gene expression in the bumblebee Bombus terrestris
  Seidenath, Ecology and evolution 2023
  • “...1.213 0.225 0.008 LOC100649579 1.209 9.855 <0.001 LOC100645676 1.202 7.801 <0.001 LOC100646376 1.195 0.595 0.033 LOC100649407 1.188 9.355 <0.001 LOC100647950 Alphatocopherol transfer proteinlike 1.184 1.030 0.046 LOC100651491 1.177 2.702 <0.001 LOC100642208 DNA ligase 1like isoform X6 1.175 2.630 <0.001 LOC100649496 Uncharacterized protein LOC100649496 1.174 0.985 0.006...”

LOC100169601 UDP-glucuronosyltransferase 2B17 from Acyrthosiphon pisum
30% identity, 86% coverage

• Increases in Genistein in Medicago sativa Confer Resistance against the Pisum Host Race of Acyrthosiphon pisum
  Yuan, Insects 2019
  • “...ID Putative Function log2 Fold Change 1 Probability 2 LOC100166729 UDP-glucuronosyltransferase 2B2 4.42 up 0.93 LOC100169601 UDP-glucuronosyltransferase 2B17 6.40 up 0.88 LOC100159691 UDP-glucuronosyltransferase 1-7C-like 2.58 up 0.89 LOC100570856 glutathione S-transferase 1.74 up 0.87 LOC100572007 cytochrome P450, family 6-like 2.61 up 0.89 LOC100569567 cytochrome P450, family 6...”

LOC109410284 UDP-glucosyltransferase 2-like from Aedes albopictus
29% identity, 95% coverage

• Insecticide resistance in the field populations of the Asian tiger mosquito <i>Aedes albopictus</i> in Beijing: resistance status and associated detoxification genes
  Zhou, Frontiers in physiology 2024
  • “...3.31* 4.69E-13 UGT36D1b LOC109429550 3.51 15.58 3.66* 2.70E-03 11.07 2.54* 6.20E-04 15.75 3.32* 1.32E-18 UGT49B1 LOC109410284 14.67 47.18 2.97* 3.85E-03 26.15 1.61 1.63E-01 52.21 2.90* 2.05E-26 UGT49C1a LOC109430808 1.73 14.04 7.07* 1.01E-08 6.31 3.22* 1.35E-04 12.54 5.73* 5.52E-10 UGT49C1b LOC109426260 12.43 58.15 4.56* 1.65E-02 18.99 1.37...”
• Transcriptome Analysis of Response to Zika Virus Infection in Two Aedes albopictus Strains with Different Vector Competence
  Jia, International journal of molecular sciences 2023
  • “...1.32 18.95 12.73 19.52 Sialidase-like LOC109409947 GZ 2.55 12.31 5.78 43.89 cell wall protein DAN4-like LOC109410284 GZ 1.16 100.29 2.13 68.19 UDP-glucuronosyltransferase 2B18-like LOC109410780 GZ 1.69 40.73 6.74 120.48 uncharacterized LOC109410780 LOC109410802 GZ 1.98 9.21 5.75 13.88 A-agglutinin anchorage subunit-like LOC109411630 GZ 1.77 15.02 1.51 13.05...”

R7UBD8 Sulfotransferase domain-containing protein from Capitella teleta
28% identity, 77% coverage

• A synthetic peptide from Sipunculus nudus promotes bone formation via Estrogen/MAPK signal pathway based on network pharmacology.
  Wang, Frontiers in pharmacology 2023
  • “...strong antioxidant properties and is involved in the synthesis of several proteins such as R7UNS2, R7UBD8, R7UTA6, R7TB03, R7V7P3, R7V3Y8, A3QRJ2, etc., which play critical roles in cell membrane composition, enzyme activation, binding to essential biomolecules, and other cell growth and differentiation activities. For example, in...”

LOC118279357 UDP-glucosyltransferase 2-like from Spodoptera frugiperda
25% identity, 93% coverage

• Transcriptome and Metabolome Analysis Reveals the Importance of Amino-Acid Metabolism in Spodoptera Frugiperda Exposed to Spinetoram
  Gao, Insects 2022
  • “...cytochrome P450 301a1 Up Up LOC118279412 UDP-glucuronosyltransferase 2B15 Up Up LOC118269333 UDP-glucuronosyltransferase 2B19 Up Up LOC118279357 UDP-glucuronosyltransferase 2B7 Up Up insects-13-00852-t003_Table 3 Table 3 Changes of key metabolites in S. frugiperda by exposure to LC 10 and LC 90 dose of the spinetoram compared to the...”

LOC100141953 UDP-glucosyltransferase 2-like from Tribolium castaneum
27% identity, 92% coverage

• Insecticidal Activity of Artemisia vulgaris Essential Oil and Transcriptome Analysis of Tribolium castaneum in Response to Oil Exposure
  Gao, Frontiers in genetics 2020
  • “...I LOC657602 1.76 Up 3.47E-76 GSTs6 Phase II LOC103313315 1.63 Up 6.44E-23 CYP351A2 Phase I LOC100141953 1.58 Up 2.82E-06 Ugt2B7-like Phase II LOC656937 1.47 Up 1.65E-114 MRP4 Phase III LOC661102 1.43 Up 1.12E-09 -EST2 Phase I LOC664599 1.41 Up 5.71E-155 OBPC02 Phase 0 LOC656243 1.40 Up...”

LOC118279412 UDP-glucosyltransferase 2 from Spodoptera frugiperda
27% identity, 88% coverage

• Transcriptome and Metabolome Analysis Reveals the Importance of Amino-Acid Metabolism in Spodoptera Frugiperda Exposed to Spinetoram
  Gao, Insects 2022
  • “...6B5 Up Up LOC118264635 cytochrome P450 9e2 Up Up LOC118271250 cytochrome P450 301a1 Up Up LOC118279412 UDP-glucuronosyltransferase 2B15 Up Up LOC118269333 UDP-glucuronosyltransferase 2B19 Up Up LOC118279357 UDP-glucuronosyltransferase 2B7 Up Up insects-13-00852-t003_Table 3 Table 3 Changes of key metabolites in S. frugiperda by exposure to LC 10...”

UGT4_DACCO / A0A291PQG3 UDP-glycosyltransferase UGT4; UDP-glucosyltransferase 4; DcUGT4; EC 2.4.1.- from Dactylopius coccus (Cochineal) (see paper)
32% identity, 58% coverage

• function: Catalyzes the transfer of a glycosyl group from a UDP-sugar to an acceptor molecule.

LOC126984017 UDP-glycosyltransferase UGT5-like from Eriocheir sinensis
33% identity, 56% coverage

• Transcriptome and metabolomics analysis of adaptive mechanism of Chinese mitten crab (Eriocheir sinensis) to aflatoxin B1
  Yang, PloS one 2023
  • “...38 ]. In our sequencing results, we found that the gene novel.6517 and the gene LOC126984017 ( UGT ) were associated with the synthesis of eytoehrome P450. Gene novel . 6517 encoded NADPHcytochrome P450 reductase, with an mean FPKM of 0.01 and 2.50 in the L-C...”

Q7Q3R0 AGAP007990-PA from Anopheles gambiae
27% identity, 88% coverage

• Proteome-wide analysis of Anopheles culicifacies mosquito midgut: new insights into the mechanism of refractoriness
  Vijay, BMC genomics 2018
  • “...32. Q7QFS4 AGAP003869-PA (similar to Anopheles gambiae ) 11.29 6 54 Aminopeptidase activity 0.646 33. Q7Q3R0 AGAP007990-PA (similar to Anopheles gambiae ) 10.22 6 61.4 transferase activity 0.380 34. Q7QEF5 AGAP000679-PA (similar to Anopheles gambiae ) 9 4 46.4 Aminoacylase activity 0.585 35. A0NFA5 AGAP007790-PA (similar...”
• Towards a Proteomic Catalogue and Differential Annotation of Salivary Gland Proteins in Blood Fed Malaria Vector Anopheles culicifacies by Mass Spectrometry
  Rawal, PloS one 2016
  • “...attachment protein/ Band 27 Biosynthesis: 02 Q7QA89 AGAP004366-PA An . gambiae 15.88 6 Aldehyde DH Q7Q3R0 AGAP007990-PA An . gambiae 6.51 2 UDP -glucuronosyl transferase Protein synthesis: 05 T1DN37 Elongation factor 1alpha An . aquasalis 30.48 5 Band 18 P33514 40S ribosomal protein An . gambiae...”

Q17399 UDP-glucuronosyltransferase from Caenorhabditis elegans
27% identity, 95% coverage

• Distinct GluN1 and GluN2 Structural Determinants for Subunit-Selective Positive Allosteric Modulation of N-Methyl-d-aspartate Receptors.
  Strong, ACS chemical neuroscience 2021
  • “...91 The Uniprot numbers for the human sequences used are Q05586, Q12879, Q13224, Q14957, and Q17399. Ten homology models were generated for each of the two target models (GluN1/GluN2B and GluN1/GluN2D with GYKI 53655) using Modeller v9.24, 92 from which the lowest energy model was selected...”

LOC109429036 UDP-glycosyltransferase UGT5 from Aedes albopictus
29% identity, 88% coverage

• Transcriptome Analysis of Responses to Dengue Virus 2 Infection in Aedes albopictus (Skuse) C6/36 Cells
  Li, Viruses 2021
  • “...). At 1 dpi, the FC range was 0.031.89, and the expression of LOC109396991 and LOC109429036 was significantly upregulated ( p < 0.05). At 2 dpi, the FC value was between 0.55 and 1.85, and the expression of LOC109396991 and LOC109429036 was significantly upregulated ( p...”
  • “...validated by qRT-PCR were also verified to be differentially expressed in Aag2 cells (UDP-glucuronosyltransferase 2B1-like, LOC109429036; cystathionine beta-synthase, LOC109427518; and facilitated trehalose transporter Tret1, LOC109409093). Unlike in C6/36 cells (for which gene expression was analyzed by qRT-PCR), the gene expression of these three genes was downregulated...”

XP_008768282 UDP-glucuronosyltransferase 2B15 isoform X1 from Rattus norvegicus
33% identity, 61% coverage

• Regulation of uridine diphosphate-glucuronosyltransferase 2B15 expression during ovulation in the rat.
  Dam, Endocrine journal 2017 (PubMed)
  • GeneRIF: Data suggest that gonadotropins transiently stimulate Ugt2b15 expression and activity in granulosa cells of pre-ovulatory follicles as they undergo ovulation; Ugt2b15 mRNA levels appear to be regulated by signal transduction involving progesterone receptors and vitamin D receptors.

LOC118269333 UDP-glycosyltransferase UGT5-like from Spodoptera frugiperda
34% identity, 55% coverage

• Transcriptome and Metabolome Analysis Reveals the Importance of Amino-Acid Metabolism in Spodoptera Frugiperda Exposed to Spinetoram
  Gao, Insects 2022
  • “...P450 9e2 Up Up LOC118271250 cytochrome P450 301a1 Up Up LOC118279412 UDP-glucuronosyltransferase 2B15 Up Up LOC118269333 UDP-glucuronosyltransferase 2B19 Up Up LOC118279357 UDP-glucuronosyltransferase 2B7 Up Up insects-13-00852-t003_Table 3 Table 3 Changes of key metabolites in S. frugiperda by exposure to LC 10 and LC 90 dose of...”

LOC105209919 UDP-glycosyltransferase UGT5 from Zeugodacus cucurbitae
30% identity, 74% coverage

• Identification of testis development-related genes by combining Iso-Seq and RNA-Seq in Zeugodacus tau
  Liu, Frontiers in cell and developmental biology 2024
  • “...of 4 genes (2 belonging to SDR16C (LOC105209516 and LOC105213735) and 2 belonging to UGT (LOC105209919 and LOC105220158)) was higher than the remaining 11 genes throughout testis developments (T1T11). With the development of testis (from T1 to T11), only one UGT gene (LOC128919756) was continuously downregulated....”
  • “...no * LOC105213735 13.17173 51.44456 63.12685 * * UGT LOC128919756 8.726864 5.028652 0.848712 * * LOC105209919 12.46673 21.09953 26.58083 no * LOC105210436 0.416249 1.227206 1.176597 no * LOC105210791 2.563174 6.072815 8.231448 * * LOC105218578 0.473939 3.880796 11.32484 * * LOC105218581 1.9247 4.529353 3.680961 * * LOC105219093...”

LOC109424170 UDP-glucuronosyltransferase 2B20 from Aedes albopictus
28% identity, 93% coverage

• Insecticide resistance in the field populations of the Asian tiger mosquito <i>Aedes albopictus</i> in Beijing: resistance status and associated detoxification genes
  Zhou, Frontiers in physiology 2024
  • “...8.04E-09 UGTs UGT2B15 LOC109410290 5.62 11.26 1.91 2.56E-01 5.31 0.86 7.87E-01 13.78 2.03* 3.01E-05 UGT35E2 LOC109424170 10.68 52.83 4.95* 1.29E-02 18.80 1.63 4.54E-01 42.7 3.44* 4.09E-02 UGT36D1a LOC109398287 2.47 8.99 3.30* 1.98E-03 8.04 2.89* 5.77E-03 10.11 3.31* 4.69E-13 UGT36D1b LOC109429550 3.51 15.58 3.66* 2.70E-03 11.07 2.54*...”

Q9U3Q6 UDP-glucuronosyltransferase from Caenorhabditis elegans
26% identity, 94% coverage

• A role for SKN-1/Nrf in pathogen resistance and immunosenescence in Caenorhabditis elegans
  Papp, PLoS pathogens 2012
  • “...** p<0.001, *** p<0.0001. Accession numbers C. elegans proteins/genes: Q17941, Q9XTG7, Q2MGF0, Q17450, O61213, P54145, Q9U3Q6, O02215, G5EC10, Q18198, Q9XUH3, Q9XUF9, O44552, Q27487, Q18938, O17725, O16849, Q968Y9, Q9XVB4, Q9XVA9, Q19223, O62146, G5EGH6, Q8MNR8, Q19774, O02357, Q09321, Q9UAQ9, P91316, Q20770, Q20840, G5EC22, P90893, Q20968, Q21009, Q20117, Q9U2Q9,...”

LOC105195675 uncharacterized protein LOC105195675 from Solenopsis invicta
32% identity, 35% coverage

• Brain gene expression analyses in virgin and mated queens of fire ants reveal mating-independent and socially regulated changes
  Calkins, Ecology and evolution 2018
  • “...2.79 92.55 Uncharacterized LOC105204893 partial mRNA XM_011160766 LOC105195388 4.21 62.52 Venom proteaselike partial mRNA XM_011161187 LOC105195675 6.44 45.67 UDPglucuronosyltransferase 2C1like, transcript variant X2, mRNA GO:0008152: metabolic process; GO:0016758: transferase activity, transferring hexosyl groups XM_011157651 LOC105193270 10.89 24.36 Chymotrypsin1like mRNA GO:0006508: proteolysis; GO:0004252: serinetype endopeptidase activity XM_011157183...”

Bm17378, Bm1_13480 Uncharacterized protein from Brugia malayi
27% identity, 89% coverage

• Intestinal UDP-glucuronosyltransferase as a potential target for the treatment and prevention of lymphatic filariasis
  Flynn, PLoS neglected tropical diseases 2019
  • “...malayi intestinal UGT exhibits high homology to other filarial species Previously, we reported that Bm-UGT (Bm17378) was a specific intestinal protein of B . malayi adult worms [ 12 ]. Sequence analyses indicated the presence of homologues in human filarial worms ( Brugia sp., W ....”
  • “...WormBase Parasite based on a BLAST query [ 24 ] against the Bm-UGT protein sequence (Bm17378). The following are the accession numbers of each ortholog as identified in WormBase Parasite: Brugia timori (BTMF_0001026401), Wuchereria bancrofti (WBA_0000030501), Brugia pahangi (BPAG_0000208101), Loa loa (LOAG_03428), Dirofilaria immitis (nDi.2.2.2.t06727), Litomosoides...”
• A Proteomic Analysis of the Body Wall, Digestive Tract, and Reproductive Tract of Brugia malayi
  Morris, PLoS neglected tropical diseases 2015
  • “...nonmuscle type 1, putative 7.8E-04 2.0 Phagocytosis associated Bm1_02265 MGC69076 protein-related 7.3E-04 3.77 Xenobiotic metabolism Bm1_13480 UDP-glucoronosyl and UDP-glucosyl transferase family protein 7.0E-04 28.16 RNA binding Bm1_20295 Glycine-rich RNA-binding protein.-related 6.9E-04 8.96 Miscellaneous Bm1_25280 Prion-likerelated 6.4E-04 2.37 Cell Adhesion Bm1_10500 AMOP domain containing protein 6.1E-04 5.99...”
  • “...Bm1_44655 Fukutin.-related 31 138364 96 1362 73 1364 85 1364 75 1364 28364 1 # Bm1_13480 UDP-glucoronosyl and UDP-glucosyl transferase family protein 27 35509 95 1425 29 214293 81 1423 72 155502 1486 1 Miscellaneous # Bm1_49590 CG3054-PA-related 28 97260 81 1242 69 1260 63 1262...”

LOC109032577 UDP-glucuronosyltransferase 2B18-like from Bemisia tabaci
25% identity, 98% coverage

• Transcriptional analysis of Bemisia tabaci MEAM1 cryptic species under the selection pressure of neonicotinoids imidacloprid, acetamiprid and thiamethoxam
  Zhou, BMC genomics 2022
  • “...require more database information for reference. Two phase II enzymes, UDP-glucuronosyltransferase 2B18-like genes (LOC109030370 and LOC109032577), were obviously downregulated in all three selected resistant strains relative to the SUS strain (Fig. 1 ) (Additionalfiles 6 , 7 , 8 ). Fig. 1 Differentially expressed genes between...”

LOC100879769 2-hydroxyacylsphingosine 1-beta-galactosyltransferase from Megachile rotundata
27% identity, 96% coverage

• Immediate Transcriptional Response to a Temperature Pulse under a Fluctuating Thermal Regime
  Melicher, Integrative and comparative biology 2019
  • “...enzymes (LOC100881347, LOC100878698, LOC100876260), serine kinases (LOC100877637, LOC100881145) aminotransferases (LOC100878030), and glycoside hydrolase-family enzymes (LOC100877705, LOC100879769, LOC100878475) ( Holthuis and Menon 2014 ) ( Fig.3a, b ). The cholesterol desaturase neverland (LOC100877176), Delta 11 acyl-CoA desaturase (LOC100881714), and desaturase/reductase enzymes (LOC100881714, LOC100881578, LOC100879632) modify fatty acid...”

LOC109430808 UDP-glucosyltransferase 2 from Aedes albopictus
28% identity, 92% coverage

• Insecticide resistance in the field populations of the Asian tiger mosquito <i>Aedes albopictus</i> in Beijing: resistance status and associated detoxification genes
  Zhou, Frontiers in physiology 2024
  • “...3.32* 1.32E-18 UGT49B1 LOC109410284 14.67 47.18 2.97* 3.85E-03 26.15 1.61 1.63E-01 52.21 2.90* 2.05E-26 UGT49C1a LOC109430808 1.73 14.04 7.07* 1.01E-08 6.31 3.22* 1.35E-04 12.54 5.73* 5.52E-10 UGT49C1b LOC109426260 12.43 58.15 4.56* 1.65E-02 18.99 1.37 4.81E-01 34.03 2.22* 5.97E-11 UGT5 LOC109408672 3.87 17.61 4.40* 4.60E-03 10.07 2.38*...”

XP_033176691 UDP-glucuronosyltransferase 2B15 isoform X3 from Bombus impatiens
25% identity, 98% coverage

• Differential bumble bee gene expression associated with pathogen infection and pollen diet
  Giacomini, BMC genomics 2023
  • “...with detoxification that were upregulated in infected sunflower-fed bees (Fig. 3 ), including UDP-glucuronosyltransferase 2B17-like (XP_033176691) , three transcripts for cytochrome P450 9e2-like (XP_033174299 and XP_003484581) , two transcripts for oxidation resistance protein 1 (XP_024222768) , thioredoxin reductase 1 (XP_012247756) and E3 ubiquitin-protein ligase MARCH5 (XP_003492433)...”

LOC109030370 UDP-glucuronosyltransferase 2B18-like from Bemisia tabaci
26% identity, 90% coverage

• Transcriptional analysis of Bemisia tabaci MEAM1 cryptic species under the selection pressure of neonicotinoids imidacloprid, acetamiprid and thiamethoxam
  Zhou, BMC genomics 2022
  • “...genes will require more database information for reference. Two phase II enzymes, UDP-glucuronosyltransferase 2B18-like genes (LOC109030370 and LOC109032577), were obviously downregulated in all three selected resistant strains relative to the SUS strain (Fig. 1 ) (Additionalfiles 6 , 7 , 8 ). Fig. 1 Differentially expressed...”

LOC100647883 UDP-glycosyltransferase UGT5 from Bombus terrestris
26% identity, 93% coverage

• Diesel exhaust particles alter gut microbiome and gene expression in the bumblebee Bombus terrestris
  Seidenath, Ecology and evolution 2023
  • “...LOC100646677 1.774 9.275 <0.001 LOC110120139 Uncharacterized protein LOC110120139 1.759 0.166 <0.001 LOC100645840 1.739 0.876 <0.001 LOC100647883 1.738 9.769 <0.001 LOC100651423 Cystinosin homolog isoform X1 1.726 7.389 <0.001 LOC110119585 Odorant receptor 49blike 1.718 1.471 <0.001 LOC100646153 1.709 2.931 <0.001 LOC105666013 Protein Hook homolog 3like 1.687 0.056 0.013...”

LOC413043 UDP-glucuronosyltransferase 1-3 from Apis mellifera
26% identity, 90% coverage

• Identification of Multiple Loci Associated with Social Parasitism in Honeybees
  Wallberg, PLoS genetics 2016 (no snippet)
• Developmental regulation of ecdysone receptor (EcR) and EcR-controlled gene expression during pharate-adult development of honeybees (Apis mellifera)
  Mello, Frontiers in genetics 2014
  • “...a common function related to ecdysteroid metabolism (Iida et al., 2007 ). The products of LOC413043 and LOC725997 may regulate ecdysteroid titer and function since the enzymes encoded by these genes catalyze the transfer of glucose from UDP-glucose to ecdysteroids, and thus are possibly related to...”

LOC100642358 UDP-glucosyltransferase 2 from Bombus terrestris
27% identity, 77% coverage

• Diesel exhaust particles alter gut microbiome and gene expression in the bumblebee Bombus terrestris
  Seidenath, Ecology and evolution 2023
  • “...<0.001 LOC105666138 1.035 6.859 <0.001 LOC100642963 Histidinerich glycoproteinlike 1.045 5.154 0.002 LOC100651034 1.045 6.727 <0.001 LOC100642358 1.045 3.873 <0.001 LOC100648843 1.049 8.843 <0.001 LOC100642272 1.054 8.741 0.021 LOC100631070 Melittin 1.059 3.766 0.008 LOC100642297 Lysozymelike 1.061 10.682 0.002 LOC100649166 1.061 4.248 <0.001 LOC100644014 1.072 6.401 <0.001 LOC100651129...”

SRAE_2000477000 UDP-glucuronosyl/UDP-glucosyltransferase family-containing protein from Strongyloides ratti
27% identity, 91% coverage

• Intestinal UDP-glucuronosyltransferase as a potential target for the treatment and prevention of lymphatic filariasis
  Flynn, PLoS neglected tropical diseases 2019
  • “...(NDV.1.0.1.g111112), Haemonchus contortus (HCON_00121250), Heligmosomoides polygyrus (HPOL_0001615101), Nippostrongylus brasiliensis (NBR_0001252501), Caenorhabditis elegans (Y37E11AR), Strongyloides ratti (SRAE_2000477000), Strongyloides stercoralis (SSTP_0001129400), and Oesophagostomum dentatum (OESDEN_03545). Orthologs in selected mammals were identified in the National Center of Biotechnology Information (NCBI) databases based on a BLAST query against the Bm-UGT...”

LOC109410290 UDP-glucosyltransferase 2-like from Aedes albopictus
33% identity, 50% coverage

• Insecticide resistance in the field populations of the Asian tiger mosquito <i>Aedes albopictus</i> in Beijing: resistance status and associated detoxification genes
  Zhou, Frontiers in physiology 2024
  • “...2.03E-08 Est-P LOC109406417 15.59 32.28 1.91 1.54E-01 25.52 1.47 1.22E-01 40.63 2.10* 8.04E-09 UGTs UGT2B15 LOC109410290 5.62 11.26 1.91 2.56E-01 5.31 0.86 7.87E-01 13.78 2.03* 3.01E-05 UGT35E2 LOC109424170 10.68 52.83 4.95* 1.29E-02 18.80 1.63 4.54E-01 42.7 3.44* 4.09E-02 UGT36D1a LOC109398287 2.47 8.99 3.30* 1.98E-03 8.04 2.89*...”

Q0IG96 N-acylneuraminate cytidylyltransferase (EC 2.7.7.43) from Aedes aegypti (see paper)
25% identity, 93% coverage

LOC5576973 UDP-glucuronosyltransferase 2B15 from Aedes aegypti
33% identity, 48% coverage

• Differing Transcriptomic Responses in High Titer versus Low Titer Aedes aegypti Mosquitoes after Oral Infection with Sindbis Virus
  Hodoameda, Viruses 2024
  • “...uncharacterized 21.82318215 0.003321752 AAEL022803 LOC110680552 LMBR1 domain-containing protein 2 homolog 19.58182813 1.66 10 8 AAEL027016 LOC5576973 UDP-glucuronosyltransferase 2B15 30.62089836 1.01 10 5 AAEL025019 LOC110680819 Ubiquinol-cytochrome c reductase complex assembly factor 6 45.53775816 5.97 10 19 High titer midgut Gene ID RefSeq Gene description Fold change Adjusted...”

LOC105210791 uncharacterized protein LOC105210791 from Zeugodacus cucurbitae
26% identity, 47% coverage

• Identification of testis development-related genes by combining Iso-Seq and RNA-Seq in Zeugodacus tau
  Liu, Frontiers in cell and developmental biology 2024
  • “...Seven genes (1 RDH (LOC105212701), 3 SDR16C (LOC105209516, LOC105209517, and LOC105213735) and 3 UGT (LOC105209919, LOC105210791, and LOC105218578)) were significantly continuously upregulated. Additionally, the expression level of 1 DGAT ( Dgat1_0 ) and 6 UGT (LOC105210436, LOC105218581, LOC105219093, LOC105219094, LOC105220158, and LOC105221422) was significantly increased and...”
  • “...0.848712 * * LOC105209919 12.46673 21.09953 26.58083 no * LOC105210436 0.416249 1.227206 1.176597 no * LOC105210791 2.563174 6.072815 8.231448 * * LOC105218578 0.473939 3.880796 11.32484 * * LOC105218581 1.9247 4.529353 3.680961 * * LOC105219093 0.553394 2.890756 2.247317 * * LOC105219094 2.26124 14.76726 11.56811 * * LOC105220158...”

H2KYQ0 UDP-glucuronosyltransferase from Caenorhabditis elegans
25% identity, 93% coverage

• Single-tissue proteomics in <i>Caenorhabditis elegans</i> reveals proteins resident in intestinal lysosome-related organelles
  Tan, Proceedings of the National Academy of Sciences of the United States of America 2024
  • “...3 * 1.50E+06 0 2 Q9N5I1 CYP-35A3 0.22 8.99E+06 5 5 0.42 2.54E+07 5 5 H2KYQ0 UGT-26 0.25 3.42E+07 6 6 0.16 7.58E+07 5 5 Q9N4E2 Y73C8B.3 0.26 3.64E+06 4 6 0.36 3.02E+06 3 4 Q09486 C30G12.2 0.29 3.71E+07 6 6 0.49 2.32E+07 5 4 Q19564...”

LOAG_03428 UDP-glucoronosyl and UDP-glucosyl transferase from Loa loa
29% identity, 65% coverage

• Intestinal UDP-glucuronosyltransferase as a potential target for the treatment and prevention of lymphatic filariasis
  Flynn, PLoS neglected tropical diseases 2019
  • “...identified in WormBase Parasite: Brugia timori (BTMF_0001026401), Wuchereria bancrofti (WBA_0000030501), Brugia pahangi (BPAG_0000208101), Loa loa (LOAG_03428), Dirofilaria immitis (nDi.2.2.2.t06727), Litomosoides sigmodontis (nLs.2.1.2.t00666-RA), Ancylostoma caninum (ANCCAN_05977), Anyclostoma duodenale (ANCDUO_14383), Dictyocaulus viviparous (NDV.1.0.1.g111112), Haemonchus contortus (HCON_00121250), Heligmosomoides polygyrus (HPOL_0001615101), Nippostrongylus brasiliensis (NBR_0001252501), Caenorhabditis elegans (Y37E11AR), Strongyloides ratti (SRAE_2000477000),...”

LOC109426260 UDP-glucosyltransferase 2 from Aedes albopictus
25% identity, 86% coverage

• Insecticide resistance in the field populations of the Asian tiger mosquito <i>Aedes albopictus</i> in Beijing: resistance status and associated detoxification genes
  Zhou, Frontiers in physiology 2024
  • “...2.90* 2.05E-26 UGT49C1a LOC109430808 1.73 14.04 7.07* 1.01E-08 6.31 3.22* 1.35E-04 12.54 5.73* 5.52E-10 UGT49C1b LOC109426260 12.43 58.15 4.56* 1.65E-02 18.99 1.37 4.81E-01 34.03 2.22* 5.97E-11 UGT5 LOC109408672 3.87 17.61 4.40* 4.60E-03 10.07 2.38* 1.87E-02 16.88 3.59* 4.69E-13 ABCs ABCG1 LOC109428250 16.05 46.11 2.63* 6.16E-03 22.86...”

UGT48_CAEEL / Q18081 Putative UDP-glucuronosyltransferase ugt-48; UDPGT 48; EC 2.4.1.17 from Caenorhabditis elegans (see paper)
24% identity, 94% coverage

• catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
  subunit: Interacts with cmd-1 in the presence of Ca(2+).

Q86S61 glucuronosyltransferase from Caenorhabditis elegans
26% identity, 95% coverage

• Single-tissue proteomics in <i>Caenorhabditis elegans</i> reveals proteins resident in intestinal lysosome-related organelles
  Tan, Proceedings of the National Academy of Sciences of the United States of America 2024
  • “...3 * 4.13E+05 0 2 P92016 CEST-1.2 * 1.39E+06 0 3 * 6.34E+06 0 3 Q86S61 UGT-31 * 1.21E+06 0 3 * 1.63E+06 0 5 O45923 TTM-1 * 7.14E+05 0 5 0.432 1.30E+06 1 4 O44649 CYP-35A5 * 6.47E+05 0 3 0.403 3.32E+06 5 4 Q23179...”
• A role for SKN-1/Nrf in pathogen resistance and immunosenescence in Caenorhabditis elegans
  Papp, PLoS pathogens 2012
  • “...P34528, Q17446, Q2PJ68, P34707, P41977, O02364, Q9XUC0, Q86DA5, Q10038, P90794, Q8WRF1, Q9U309, G5EFR9, Q9GR66, G5ECJ8, Q86S61, O76725, Q9N4X8, Q9NAB1, Q23498, Q23564 Human proteins/genes: Q12778, Q16656, Q16236, Q9Y4A8 Supporting Information Figure S1 SKN-1 is required for pathogen resistance against both P. aeruginosa and E. faecalis . (DOC)...”

LOC725997 UDP-glucuronosyltransferase 2C1 from Apis mellifera
25% identity, 86% coverage

• Developmental regulation of ecdysone receptor (EcR) and EcR-controlled gene expression during pharate-adult development of honeybees (Apis mellifera)
  Mello, Frontiers in genetics 2014
  • “...function related to ecdysteroid metabolism (Iida et al., 2007 ). The products of LOC413043 and LOC725997 may regulate ecdysteroid titer and function since the enzymes encoded by these genes catalyze the transfer of glucose from UDP-glucose to ecdysteroids, and thus are possibly related to ecdysteroid inactivation...”

NP_258389 ecdysteroid UDP-glucosyltransferase from Spodoptera litura NPV
26% identity, 93% coverage

• Origin of Ecdysosteroid UDP-glycosyltransferases of Baculoviruses through Horizontal Gene Transfer from Lepidoptera
  Hughes, Coevolution 2013
  • “...residues that were conserved in all baculovirus EGTs analyzed. These conserved positions (numbered as in NP_258389, Spodoptera litura NPV EGT) were G179, N185, and Q280 ( Figure 3 ). In addition to these conserved baculovirus-specific amino acid replacements, baculovirus EGTs differed from lepidopteran UGT33 and UGT34...”
  • “...acid residues conserved in all baculovirus EGTs analyzed: G179, N185, and Q280 (numbered as in NP_258389). Based on the alignment of Ahn et al. (2012) , the G179 and N185 are located in the N-terminal domain of the protein, not far from the catalytic residues. Q280...”