PaperBLAST
PaperBLAST Hits for BRENDA::P45858 citrate synthase (unknown stereospecificity) (EC 2.3.3.16); 2-methylcitrate synthase (EC 2.3.3.5) (Bacillus subtilis) (372 a.a., MEEKQHYSPG...)
Show query sequence
>BRENDA::P45858 citrate synthase (unknown stereospecificity) (EC 2.3.3.16); 2-methylcitrate synthase (EC 2.3.3.5) (Bacillus subtilis)
MEEKQHYSPGLDGVIAAETHISYLDTQSSQILIRGYDLIELSETKSYLELVHLLLEGRLP
EESEMETLERKINSASSLPADHLRLLELLPEDTHPMDGLRTGLSALAGYDRQIDDRSPSA
NKERAYQLLGKMPALTAASYRIINKKEPILPLQTLSYSANFLYMMTGKLPSSLEEQIFDR
SLVLYSEHEMPNSTFAARVIASTHSDLYGALTGAVASLKGNLHGGANEAVMYLLLEAKTT
SDFEQLLQTKLKRKEKIMGFGHRVYMKKMDPRALMMKEALQQLCDKAGDHRLYEMCEAGE
RLMEKEKGLYPNLDYYAAPVYWMLGIPIPLYTPIFFSARTSGLCAHVIEQHANNRLFRPR
VSYMGPRYQTKS
Running BLASTp...
Found 250 similar proteins in the literature:
MMGD_BACSU / P45858 Citrate/2-methylcitrate synthase; 2-methylcitrate synthase; 2-MCS; MCS; Citrate synthase; EC 2.3.3.-; EC 2.3.3.16 from Bacillus subtilis (strain 168) (see 2 papers)
P45858 citrate synthase (unknown stereospecificity) (EC 2.3.3.16); 2-methylcitrate synthase (EC 2.3.3.5) from Bacillus subtilis (see paper)
BSU24140 citrate synthase 3 from Bacillus subtilis subsp. subtilis str. 168
100% identity, 100% coverage
- function: Involved in both the tricarboxylic acid (TCA) and methylcitric acid cycles (PubMed:28956599). Has both 2-methylcitrate synthase and citrate synthase activities. Catalyzes the condensation of propionyl-CoA and oxaloacetate to yield 2-methylcitrate (2-MC) and CoA, and the condensation of acetyl-CoA and oxaloacetate to yield citrate and CoA (PubMed:28956599, PubMed:8759838). Has 2.3-fold higher activity as a 2-methylcitrate synthase (PubMed:28956599). Catalyzes the formation of either (2S,3R)- or (2R,3S)-2-methylcitrate (PubMed:28956599).
catalytic activity: propanoyl-CoA + oxaloacetate + H2O = 2-methylcitrate + CoA + H(+) (RHEA:57492)
catalytic activity: oxaloacetate + acetyl-CoA + H2O = citrate + CoA + H(+) (RHEA:16845) - Genomic signatures of strain selection and enhancement in Bacillus atrophaeus var. globigii, a historical biowarfare simulant
Gibbons, PloS one 2011 - “...BG1997 (09870) SYN Putative phage protein NA T:C 283/584 2029530 BG2096 (10375) PS 2-methylcitrate synthase BSU24140 (78.3) +GA * 197/218 2038809 BG2105 (10420) NS spo0A 2-component response regulator, controls initiation of sporulation BSU24220 (96.6) G:A A:V 225/265 2073239 BG2144/2145 (10615/10610) IG Intergenic - possible promter region...”
BC2285 2-methylcitrate synthase from Bacillus cereus ATCC 14579
72% identity, 99% coverage
BAS2188 citrate synthase MmgD from Bacillus anthracis str. Sterne
72% identity, 99% coverage
ctsA / AAA52231.1 citrate synthase from Bacillus coagulans (see paper)
66% identity, 98% coverage
UH47_10555 citrate synthase from Staphylococcus pseudintermedius
43% identity, 96% coverage
SA1518 citrate synthase from Staphylococcus aureus subsp. aureus N315
SAV1695 citrate synthase from Staphylococcus aureus subsp. aureus Mu50
SAUSA300_1641 citrate synthase II from Staphylococcus aureus subsp. aureus USA300_FPR3757
SACOL1742 citrate synthase from Staphylococcus aureus subsp. aureus COL
RDJ18_RS06585 citrate synthase from Staphylococcus aureus
43% identity, 95% coverage
- Respiration and Small Colony Variants of Staphylococcus aureus
Proctor, Microbiology spectrum 2019 (secret) - Exposure of clinical MRSA heterogeneous strains to β-lactams redirects metabolism to optimize energy production through the TCA cycle
Keaton, PloS one 2013 - “...to isocitrate). SA1244 odhB 2.2 Dihydrolipo-amide acetyltrans-ferase Involved in the TCA cycle and lysine degradation. SA1518 citZ 8.9 citrate synthase Catalyzes the first step in the TCA cycle. SAS1622 citC 11 isocitrate dehydro-genase Involved in the TCA cycle (converts isocitrate to alpha ketoglutarate). SAR1942 citG 2.5...”
- “...TCA cycle genes was found to be up-regulated. These include citrate synthase ( citZ , SA1518), aconitate hydratase ( citB , SA11884), isocitrate dehydrogenase ( citC, SAS1622), and a subunit of -ketoglutarate dehydrogenase ( odhB , SA1244). Another gene related to the TCA cycle also found...”
- Experimental discovery of small RNAs in Staphylococcus aureus reveals a riboregulator of central metabolism
Bohn, Nucleic acids research 2010 - “...SA1434 0.43 AcetylCoA carboxylase SA1435 0.45 AcetylCoA carboxylase SA1517 ( citC ) 0.40 Isocitrate dehydrogenase SA1518 ( citZ ) 0.37 0.48 14.80 Methylcitrate synthase SA1553 ( fhs ) 0.30 f 14.08 Formatetetrahydrofolate ligase SA1858 ( ilvD ) 3.45 1.90 Dihydroxy-acid dehydratase SA1859 ( ilvB ) 2.75...”
- An RpoB mutation confers dual heteroresistance to daptomycin and vancomycin in Staphylococcus aureus
Cui, Antimicrobial agents and chemotherapy 2010 - “...SA1089 SA1131 SA1132 SA1184 SA1244 SA1245 SA1349 SA1517 SA1518 SA1609 sdhC sdhA sdhB sucC sucD Cell envelope and cellular processes SA0111 SA0126 SA0127 citB...”
- Identification and phenotypic characterization of a beta-lactam-dependent, methicillin-resistant Staphylococcus aureus strain
Goldstein, Antimicrobial agents and chemotherapy 2007 - “...dfrA Product or putative function Fold change SA1518 N315, citrate synthase II SA1557 COL, catabolite control protein SA2098 N315, "ORFID:SA2098, hypothetical...”
- Reporter metabolite analysis of transcriptional profiles of a Staphylococcus aureus strain with normal phenotype and its isogenic hemB mutant displaying the small-colony-variant phenotype
Seggewiss, Journal of bacteriology 2006 - “...(citC, SA1517, 0.39-fold), and citrate synthase (citZ, SA1518, 0.42-fold). In addition, intermediate compounds produced by the pyruvate dehydrogenase and the...”
- Golden pigment production and virulence gene expression are affected by metabolisms in Staphylococcus aureus
Lan, Journal of bacteriology 2010 - “...and strain Enhanced pigmentation mutants TCA cycle SAV1695 strain SAV1851 strain SAV2365 strain Oxidative phosphorylation SAV1115 strain SAV1060 strain Purine...”
- Two novel point mutations in clinical Staphylococcus aureus reduce linezolid susceptibility and switch on the stringent response to promote persistent infection
Gao, PLoS pathogens 2010 - “...cytochrome b-558 9.4 SAV1148 sdhA succinate dehydrogenase flavoprotein subunit 2.9 SAV1413 kgd alpha-ketoglutarate decarboxylase 2.1 SAV1695 citZ methylcitrate synthase 5.8 SAV1791 pckA phosphoenolpyruvate carboxykinase 2.3 AMINO ACID METABOLISM: SAV0962 rocD ornithineoxo-acid transaminase 2.64 SAV0986 opp3B oligopeptide transport permease, Opp3B 2.53 SAV0987 opp3C oligopeptide transport permease, Opp3C...”
- Human Urine Alters Methicillin-Resistant Staphylococcus aureus Virulence and Transcriptome
Paudel, Applied and environmental microbiology 2021 (secret) - Growth and Stress Tolerance Comprise Independent Metabolic Strategies Critical for Staphylococcus aureus Infection
Kim, mBio 2021 - “...19354 1011 + + + + SAUSA300_1640 icd 10691 6940 8423 + + + + SAUSA300_1641 gltA 183127 16451 983 + + + + SAUSA300_2067 glyA 137106 9756 987 + + + + 3,250 1,309 ** 267,500 159,262 ** SAUSA300_1231 9244 352227 *** 1022 + +...”
- “...106.6639.93 22.220.98 * 0.530.10 SAUSA300_1640 icd 5.75 1.060.03 **** 3.25 109.2535.93 105.3740.85 40.678.63 0.840.29 ** SAUSA300_1641 gltA 7.5 1.090.03 ** 3.23 108.524.61 119.6325.29 35.076.38 0.60.21 SAUSA300_1246 acnA 4.8 1.020.04 2.51 77.0834.94 * 85.6320.98 29.829.97 0.760.31 * SAUSA300_1014 pyc 5.54 0.830.04 **** 2.85 66.5318.67 **** 145.2136.90 *...”
- Enzymes Catalyzing the TCA- and Urea Cycle Influence the Matrix Composition of Biofilms Formed by Methicillin-Resistant Staphylococcus aureus USA300
De, Microorganisms 2018 - “...NE594 (NR-47137) JE2 Tn mutant (insertion position: 1800430) in citrate synthase II ( gltA , SAUSA300_1641; 1799608-1800729). NARSA repository NE626 (NR-47169) JE2 Tn mutant (insertion position: 1145819) in succinate dehydrogenase, flavoprotein subunit ( sdhA , SAUSA300_1047; 1145459-1147225). NARSA repository NE808 (NR-47351) JE2 Tn mutant (insertion position:...”
- The Staphylococcus aureus α-Acetolactate Synthase ALS Confers Resistance to Nitrosative Stress
Carvalho, Frontiers in microbiology 2017 - “...( fadBDE ), SAUSA300_0235 ( lctE ), SAUSA300_0885-6 ( fabHF ), SAUSA300_1123-4 ( fadDG ), SAUSA300_1641 ( gltA ), SAUSA300_1454 ( zwf ), SAUSA300_1725 ( taI ), SAUSA300_2443 ( gntK ), SAUSA300_2166 ( alsS ), SAUSA300_2444 ( gntR ), SAUSA300_2008 ( ilvN ), SAUSA300_1225 ( thrA...”
- Heparin Mimics Extracellular DNA in Binding to Cell Surface-Localized Proteins and Promoting Staphylococcus aureus Biofilm Formation
Mishra, mSphere 2017 - “...Phosphate acetyltransferase 10 11 41 None SAUSA300_1365 30S ribosomal protein S1 13 7 15 None SAUSA300_1641 Citrate synthase II, GltA 10 7 15 None SAUSA300_0523 50S ribosomal protein L1 4 13 28 None SAUSA300_2078 UDP- N -acetylglucosamine 1-carboxyvinyltransferase 5 5 17 GRFKKC SAUSA300_1331 Alanine dehydrogenase 5...”
- Reversible antibiotic tolerance induced in Staphylococcus aureus by concurrent drug exposure
Haaber, mBio 2015 - “...Metabolism SAUSA300_0684 fruB Fructose 1-phosphate kinase 3.01 SAUSA300_1640 icd ( citC ) Isocitrate dehydrogenase 2.97 SAUSA300_1641 gltA Citrate synthetase 3.75 SAUSA300_2319 Pyridine nucelotide-disulfide oxidoreductase 6.26 SAUSA300_2377 Glycerate kinase 3.64 Transport SAUSA300_1790 prsA Foldase protein PrsA 2.52 SAUSA300_2630 nixA High-affinity nickel transporter 1.81 SAUSA300_2409 nikC Oligopeptide ABC...”
- Staphylococcus aureus gene expression in a rat model of infective endocarditis
Hanses, Genome medicine 2014 - “...4.0 2.2 4.4 2.3 phosphopentomutase deoD SACOL0121 7.1 7.8 8.9 10.0 purine nucleoside phosphorylase gltA SACOL1742 6.9 -6.7 4.8 -9.4 citrate synthase gntK SACOL2515 6.9 4.9 ns ns gluconokinase ilvA SACOL1477 34.0 25.0 28.7 22.7 threonine dehydratase nirB SACOL2398 21.8 19.6 12.8 11.9 nitrite reductase [NAD(P)H],...”
- Genetic changes that correlate with the pine-oil disinfectant-reduced susceptibility mechanism of Staphylococcus aureus
Lamichhane-Khadka, Journal of applied microbiology 2008 - “...acetyltransferase 1.81 SACOL1897 putative protein export protein PrsA, 1.77 sucB SACOL1448 dihydrolipoamide succinyltransferase 1.76 gltA SACOL1742 citrate synthase 1.73 SACOL2569 delta-1-pyrroline-5-carboxylate dehydrogenase 1.72 SACOL1447 conserved hypothetical protein 1.67 SACOL2140 lytic regulatory protein, authentic frameshift 1.62 SACOL1114 Mn2 + /Fe2 + transporter, NRAMP family 1.61 SACOL2246 putative...”
- Multiomics analysis of Staphylococcus aureus ST239 strains resistant to virulent Herelleviridae phages
Kornienko, Scientific reports 2024 - “...of genes encoding tricarboxylic acid cycle enzymes, including class II fumarate hydratase (RDJ18_RS05700), UDP-N-acetylmuramate-L-alanine ligase (RDJ18_RS06585), and malate dehydrogenase (quinone) (RDJ18_RS12615), argues for support of active conversion of pyruvate to lactate. The proteomic analysis data confirmed alterations in the tricarboxylic acid cycle, evidenced by reduced abundance...”
SERP1258 citrate synthase from Staphylococcus epidermidis RP62A
Q5HNL0 Citrate synthase from Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
42% identity, 95% coverage
SE_1371 citrate synthase from Staphylococcus epidermidis ATCC 12228
41% identity, 95% coverage
- Comprehensive Succinylome Profiling Reveals the Pivotal Role of Lysine Succinylation in Energy Metabolism and Quorum Sensing of Staphylococcus epidermidis
Zhao, Frontiers in microbiology 2020 - “...dehydrogenase E1 component subunit alpha, phosphoenolpyruvate carboxykinase [ATP], and 2-oxoglutarate dehydrogenase E1 component. Citrate synthase (SE_1371) converts the oxaloacetate and acetyl-coenzyme A into citrate and coenzyme A, which is the first and rate-limiting step of the Krebs cycle ( Li et al., 2016 ). Five lysine...”
- “...processes. Four proteins were revealed with the higher degree that was over 50, i.e., SE_0967, SE_1371, SE_2160, and formate acetyltransferase (pflB), among which pflB possessed the most succinylated sites (13 sites), implying that this protein may be a pivotal target to understand the deep mechanisms of...”
GYA98_RS12240 citrate synthase from Bacillus velezensis
41% identity, 97% coverage
NP_390792 citrate synthase II from Bacillus subtilis subsp. subtilis str. 168
P39120 Citrate synthase 2 from Bacillus subtilis (strain 168)
BSU29140 citrate synthase from Bacillus subtilis subsp. subtilis str. 168
42% identity, 97% coverage
- Interaction of enzymes of the tricarboxylic acid cycle in Bacillus subtilis and Escherichia coli: a comparative study.
Jung, FEMS microbiology letters 2018 (PubMed)- GeneRIF: In B. subtilis, the genes encoding citrate synthase, isocitrate dehydrogenase and malate dehydrogenase form an operon (citZ-icd-mdh) and predominantly are co-transcribed from a single promoter.
- Two roles for aconitase in the regulation of tricarboxylic acid branch gene expression in Bacillus subtilis.
Pechter, Journal of bacteriology 2013 - GeneRIF: Together, these data suggest that wild-type aconitase binds to and destabilizes the citZ transcript in order to maintain proper cell homeostasis by preventing the overaccumulation of citrate.
- Bacterial cell cycle control by citrate synthase independent of enzymatic activity
Bergé, eLife 2020 - “...CitC (A0A0H3CD20) from C.crescentus , GltA (P0ABH7) from E. coli , CitA (P39119) and CitZ (P39120) from Bacillus subtilis . The histidine and aspartic acid catalytic residues are highlighted in red. Anarrow indicates the alanine or tryptophan substitution thatabolishes the catalytic activity of CitA ( Figure...”
- Pterostilbene, a Methoxylated Resveratrol Derivative, Efficiently Eradicates Planktonic, Biofilm, and Intracellular MRSA by Topical Application.
Yang, Frontiers in microbiology 2017 - “...2.26 0.05 1.42 0.01 0.048 D-glucose 6-phosphate = D-fructose 6-phosphate. 7 Citrate synthase 2 (CISY2) P39120 40,614 10 31% (92) 3.37 0.02 2.17 0.02 0.013 Might regulate the synthesis and function of enzymes involved in later enzymatic steps of Krebs cycle. Loss in activity results in...”
- Correction: Comprehensive Analysis of Temporal Alterations in Cellular Proteome of Bacillus subtilis under Curcumin Treatment
Reddy, PloS one 2015 - “...stress protein 16U YceD 49.74 6 1.05 1.30 1.50 6 0.980 1.294 1.469 TCA cycle P39120 Citrate synthase 2 CitZ 31.18 11 1.20 3.99 7.65 7 1.448 3.869 6.546 P09339 Aconitate hydratase CitB 33.22 25 1.14 3.94 4.56 12 1.449 4.064 3.887 P39126 Isocitrate dehydrogenase [NADP]...”
- Proteomics analyses of Bacillus subtilis after treatment with plumbagin, a plant-derived naphthoquinone
Reddy, Omics : a journal of integrative biology 2015 - “...dehydrogenase [NADP] OS P09339 Aconitate hydratase OS P39120 Citrate synthase 2 OS Electron transport P94551 Electron transfer flavoprotein subunit alpha P80861...”
- Comprehensive analysis of temporal alterations in cellular proteome of Bacillus subtilis under curcumin treatment
Reddy, PloS one 2015 - “...stress protein 16U YceD 49.74 6 1.05 1.30 1.50 6 1.085 1.542 1.672 TCA cycle P39120 Citrate synthase 2 CitZ 31.18 11 1.20 3.99 7.65 7 1.621 3.706 8.131 P09339 Aconitate hydratase CitB 33.22 25 1.14 3.94 4.56 12 2.032 4.297 4.724 P39126 Isocitrate dehydrogenase [NADP]...”
- Propionate catabolism in Salmonella typhimurium LT2: two divergently transcribed units comprise the prp locus at 8.5 centisomes, prpR encodes a member of the sigma-54 family of activators, and the prpBCDE genes constitute an operon
Horswill, Journal of bacteriology 1997 - “...synthases from B. subtilis (GenBank accession number P39120) and Mycobacterium smegmatis (SWISS-PROT accession number P26491) were also homologous to PrpC....”
- Identification of an RNA sponge that controls the RoxS riboregulator of central metabolism in Bacillus subtilis
Durand, Nucleic acids research 2021 - “...BSU28520 0.95 RoxS and FsrA RoxS Electron transfer flavoprotein (alpha subunit) fatty acid degradation, CitZ BSU29140 0.95 RoxS and FsrA RoxS Citrate synthase 2 TCA Cycle OdhB BSU19360 0.87 RoxS TCA Cycle 2-oxoglutarate dehydrogenase complex OdhA BSU19370 0.85 RoxS TCA Cycle 2-oxoglutarate dehydrogenase (E1 subunit) SucC...”
KSO_RS05840 citrate synthase from Bacillus amyloliquefaciens IT-45
41% identity, 97% coverage
A8FG49 Citrate synthase from Bacillus pumilus (strain SAFR-032)
41% identity, 97% coverage
SXYL_01172 citrate synthase from Staphylococcus xylosus
41% identity, 97% coverage
MAV_0344 citrate synthase 2 from Mycobacterium avium 104
41% identity, 95% coverage
- Metabolic pathways that permit Mycobacterium avium subsp. hominissuis to transition to different environments encountered within the host during infection
Abukhalid, Frontiers in cellular and infection microbiology 2023 - “...(AAA) metabolism were detected in the biofilm condition as well ( Figure4 ). Synthesis of MAV_0344, MAV_3180, MAV_3185, MAV_3413, MAV_3415, MAV_3428 proteins involved in the biosynthesis of amino acid pathway were observed during biofilm formation of M. avium . The majority of enzymes of the aromatic...”
- “...biofilm formation. Interestingly, fatty acid metabolism leads to acetyl co-A, and in the presence of MAV_0344 citrate synthase, acetyl-coA is converted to citrate for entry into the TCA cycle ( Figure4 ). It has been previously described that M. tb prefers to metabolize fatty acids rather...”
WP_202320798 citrate/2-methylcitrate synthase from Archaeoglobus neptunius
41% identity, 96% coverage
CISY_HALVD / D4GS06 Citrate synthase; EC 2.3.3.16 from Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) (Halobacterium volcanii) (see paper)
D4GS06 citrate synthase (unknown stereospecificity) (EC 2.3.3.16) from Haloferax volcanii (see paper)
HVO_0466 citrate synthase from Haloferax volcanii DS2
41% identity, 94% coverage
- function: Might regulate the synthesis and function of enzymes involved in later enzymatic steps of Krebs cycle.
catalytic activity: oxaloacetate + acetyl-CoA + H2O = citrate + CoA + H(+) (RHEA:16845)
subunit: Homodimer. - Iron starvation results in up-regulation of a probable Haloferax volcanii siderophore transporter
Sailer, Frontiers in microbiology 2024 - “...density at 650nm, x-axis: time of growth in hours. 3.6 HVO_A0467 forms an operon with HVO_0466 The genomic context of HVO_A0467 was found to be intriguing. HVO_A0467 forms an operon with HVO_A0466 ( Figure 8 ), which encodes an uncharacterized protein that was shown to be...”
Bd0562 hypothetical protein from Bdellovibrio bacteriovorus HD100
39% identity, 94% coverage
- Identification of genes essential for prey-independent growth of Bdellovibrio bacteriovorus HD100
Roschanski, Journal of bacteriology 2011 - “...proteins. Mutant M2.1 possessed two more, genes citZ (Bd0562) and Bd3838 (unknown function), whose putative gene products were largely modified by frameshift...”
- “...Bd0108 hit Bd0108 170,857 521,234 Bd0183 citZ Bd0562 707,368 1,331,024 1,723,594 2,317,782 2,318,005 2,567,148 2,876,738 2,880,920 2,974,067 3,370,837 3,374,202...”
HFX_0432 citrate synthase from Haloferax mediterranei ATCC 33500
39% identity, 94% coverage
SO0344 2-methylcitrate synthase (EC 2.3.3.5) from Shewanella oneidensis MR-1
PRPC_SHEON / Q8EJW2 2-methylcitrate synthase; 2-MCS; MCS; Citrate synthase; EC 2.3.3.5; EC 2.3.3.16 from Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1) (see paper)
SO0344 methylcitrate synthase from Shewanella oneidensis MR-1
41% identity, 98% coverage
- mutant phenotype: Specifically important for utilizing Sodium propionate. Automated validation from mutant phenotype: the predicted function (2.3.3.5) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
- function: Involved in the catabolism of short chain fatty acids (SCFA) via the tricarboxylic acid (TCA)(acetyl degradation route) and via the 2-methylcitrate cycle II (propionate degradation route). Catalyzes the Claisen condensation of propionyl-CoA and oxaloacetate (OAA) to yield 2-methylcitrate (2-MC) and CoA (PubMed:14702315). Catalyzes the condensation of oxaloacetate with acetyl-CoA (By similarity).
catalytic activity: propanoyl-CoA + oxaloacetate + H2O = (2S,3S)-2-methylcitrate + CoA + H(+) (RHEA:23780)
catalytic activity: oxaloacetate + acetyl-CoA + H2O = citrate + CoA + H(+) (RHEA:16845)
subunit: Homodimer. - An empirical strategy for characterizing bacterial proteomes across species in the absence of genomic sequences
Turse, PloS one 2010 - “...2 SO3547 pgi 3 SO3991 fbp 4 3 2 TCA Cycle SO0343 acnA 5 3 SO0344 prpC 4 SO0432 acnB 30 10 3 SO0770 mdh 10 7 5 2 SO0970 SO0970 11 4 SO1484 aceA 2 SO1926 gltA 6 4 2 SO1928 sdhA 5 4 2...”
- “...4 TCA Cycle SO0343 CN32_3646 acn A 4 4 5 3 4 4 4 5 SO0344 CN32_3645 prp C 2 2 3 3 2 3 2 3 SO0432 CN32_3409 acn B 19 13 19 12 14 12 11 12 SO0770 CN32_3219 mdh 6 5 7 5...”
- Snapshot of iron response in Shewanella oneidensis by gene network reconstruction
Yang, BMC genomics 2009 - “...citrate dehydratase (AcnD) 1.19 0.99 0.86 2.23 3.53 8.22 1.14 0.86 0.47 0.21 0.25 0.34 SO0344 methylcitrate synthase (PrpC) 0.81 0.61 0.52 1.77 4.17 8.74 0.90 0.63 0.30 0.11 0.19 0.22 SO0345 2-methylisocitrate lyase (PrpB) 0.73 0.70 0.71 2.54 4.35 8.07 1.05 0.45 0.24 0.15 0.33...”
citZ / Q5UZI9 citrate synthase (EC 2.3.3.3) from Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (see paper)
40% identity, 93% coverage
Q9R6Y4 citrate synthase (unknown stereospecificity) (EC 2.3.3.16) from Nostoc sp. PCC 7120 = FACHB-418 (see paper)
39% identity, 95% coverage
GAH_00258 citrate/2-methylcitrate synthase from Geoglobus ahangari
41% identity, 96% coverage
- The complete genome sequence and emendation of the hyperthermophilic, obligate iron-reducing archaeon "Geoglobus ahangari" strain 234(T)
Manzella, Standards in genomic sciences 2015 - “...present within the G. ahangari All enzymes involved in the formation of oxaloacetate from acetyl-CoA (GAH_00258, GAH_01703, GAH_01110, GAH_02012-02013, GAH_00784-00784, GAH_00779-00782, GAH_00526-00527, and GAH_00039), including putative aconitase proteins (GAH_00857-00858) [ 74 ], were identified in the genome. Also present is a phosphoenolpyruvate carboxylase (GAH_01652), which could...”
SBAL678_RS44375 2-methylcitrate synthase from Shewanella baltica OS678
40% identity, 96% coverage
MMAR_1381 citrate synthase I GltA1 from Mycobacterium marinum M
39% identity, 98% coverage
- Mycobacterium marinum causes a latent infection that can be reactivated by gamma irradiation in adult zebrafish
Parikka, PLoS pathogens 2012 - “...in vitro dormancy microarray data [25] , HspX (MMAR_3484), devr (MMAR_1516), tgs1 (MMAR_1519) and GltA1 (MMAR_1381) were chosen for q-RT-PCR measurements. Of these, only GltA1 , which encodes a metabolic enzyme called citrate synthase, had generally high enough expression levels for reliable quantification from fish with...”
- “...IL-1 : ZDB-GENE-040702-2 IL-6 : ZDB-GENE-120509-1 IL-12 : ZDB-GENE-060724-1 GAPDH: ZDB-GENE-030115-1 M. marinum: GltA1 : MMAR_1381 HspX : MMAR_3484 DevR : MMAR_1516 GltA1 : MMAR_1381 Tgs1 : MMAR_1519 Supporting Information Figure S1 qPCR and plating give similar results. Dilutions (1, 110, 11000) of mycobacterial culture (logarithmic...”
AHA_2266 2-methylcitrate synthase from Aeromonas hydrophila subsp. hydrophila ATCC 7966
42% identity, 95% coverage
- Quantitative proteomics analysis reveals an important role of the transcriptional regulator UidR in the bacterial biofilm formation of Aeromonas hydrophila
Li, Frontiers in cellular and infection microbiology 2024 - “...) were mainly enriched in pyridoxal phosphate (FDR=0.0451), eight DEPs ( AHA_0245 , mmsA-1 , AHA_2266 , pflB , ackA-2 , prpB, AHA_4081 , gldA ) were mostly enriched in glycerolipid metabolism (FDR=0.0059), five DEPs ( AHA_2091 , treC , AHA_1466 , psuG , AHA_0115 )...”
U876_11870 2-methylcitrate synthase from Aeromonas hydrophila NJ-35
42% identity, 95% coverage
BC_4594 citrate synthase from Bacillus cereus ATCC 14579
40% identity, 95% coverage
BA4839 citrate synthase CitZ from Bacillus anthracis str. Ames
BAS4488 citrate synthase CitZ from Bacillus anthracis str. Sterne
40% identity, 97% coverage
BC4594 Citrate synthase from Bacillus cereus ATCC 14579
40% identity, 97% coverage
Q9I5E3 2-methylcitrate synthase (EC 2.3.3.5) from Pseudomonas aeruginosa (see paper)
PaeAG1_04991 2-methylcitrate synthase from Pseudomonas aeruginosa
PA0795 citrate synthase 2 from Pseudomonas aeruginosa PAO1
40% identity, 97% coverage
- Transcriptomic determinants of the response of ST-111 Pseudomonas aeruginosa AG1 to ciprofloxacin identified by a top-down systems biology approach
Molina-Mora, Scientific reports 2020 - “...of secondary metabolites Succinate dehydrogenase and fumarate reductase iron-sulfur family protein COL AZM CIP Cu PaeAG1_04991 prpC (PA0795) 6,485.7 14 1.58 1.7 Turquoise Propanoate metabolism Belongs to the citrate synthase family H 2 O 2 CIP AZM COL PaeAG1_03610 DR97_5412 7,285.4 15 0.9 1.84 Turquoise Phage:...”
- Cold atmospheric pressure plasma-antibiotic synergy in Pseudomonas aeruginosa biofilms is mediated via oxidative stress response
Maybin, Biofilm 2023 - “...(PA4470) (log 2 FC 1.03), aconitate hydratase A (PA1562) (log 2 FC 1.04), citrate synthase (PA0795) (log 2 FC 1.06), and isocitrate lyase (PA2634) (log 2 FC 1.09) (data not shown). Additionally, differential expression at 6h post-treatment suggest recovery from an anoxic state. The glyoxylate cycle...”
- Peptide 1018 inhibits swarming and influences Anr-regulated gene expression downstream of the stringent stress response in Pseudomonas aeruginosa
Wilkinson, PloS one 2021 - “...regulator (sarcosine metabolism) 2.3 NC PA5274 ( rnk ) nucleoside diphosphate kinase regulator -1.6 NC PA0795 prpR propionate catabolism operon regulator 1.8 NC PA4080 rcsB two-component response regulator, CupD activation 1.7 -1.6 Regulators of swarming (of 20 total in S5 Table ) PA4853 ( fis )...”
- Full Transcriptomic Response of Pseudomonas aeruginosa to an Inulin-Derived Fructooligosaccharide
Rubio-Gómez, Frontiers in microbiology 2020 - “...encodes a C4-dicarboxylate transport protein and PA1183 ( dctA ), (2) Central metabolism, like a PA0795 ( prpC ), which regulates a citrate synthase, PA2008 ( fahA ) that controls a fumarylacetoacetase, and PA1585 ( sucA ) encoding a 2- oxoglutatate dehydrogenase, (3) Oxidative stress such...”
- “...VI secretion ATPase 0.9 0.000 0.8 0.000 PA0296 spuI Glutamylpolyamine synthetase 0.6 0.008 0.6 0.007 PA0795 prpC Citrate synthase 2 1.1 0.001 0.9 0.002 PA1069 nd Hypothetical protein 0.7 0.000 0.5 0.003 PA1171 sltB2 Soluble lytic transglycolase 0.7 0.010 0.6 0.008 PA1183 dctA C4-dicarboxylate transport protein...”
- Transcriptomic determinants of the response of ST-111 Pseudomonas aeruginosa AG1 to ciprofloxacin identified by a top-down systems biology approach
Molina-Mora, Scientific reports 2020 - “...metabolites Succinate dehydrogenase and fumarate reductase iron-sulfur family protein COL AZM CIP Cu PaeAG1_04991 prpC (PA0795) 6,485.7 14 1.58 1.7 Turquoise Propanoate metabolism Belongs to the citrate synthase family H 2 O 2 CIP AZM COL PaeAG1_03610 DR97_5412 7,285.4 15 0.9 1.84 Turquoise Phage: JBD44; Tail...”
- The Small RNA ErsA of Pseudomonas aeruginosa Contributes to Biofilm Development and Motility through Post-transcriptional Modulation of AmrZ
Falcone, Frontiers in microbiology 2018 - “...PA0105 coxB -1,70889 -3,269092 PA0106 coxA -1,82114 -3,5336031 PA0792 prpD , propionate catabolism -3,035 -8,1964546 PA0795 prpC , citrate synthase 2 -2,68584 -6,4345978 PA1107 roeA , RoeA -1,57126 -2,9716413 PA1596 htpG , heat shock protein HtpG -1,69763 -3,2436766 PA2663 ppyR , Psl and pyoverdine operon regulator,...”
- Microcolony formation by the opportunistic pathogen Pseudomonas aeruginosa requires pyruvate and pyruvate fermentation
Petrova, Molecular microbiology 2012 - “...Gene Fold change PA0927, ldhA 6.73 PA1580, gltA 24.24 PA5170, arcD 6.68 PA1400 (PycA) 5.12 PA0795, prpC 13.64 PA5171, arcA 3.38 PA0854, fumC2 9.55 PA1562, acnA 39.69 PA5172, arcB 3.18 PA5046 (Mdh) 3.38 PA1787, acnB 10.05 PA5173, arcC 5.28 PA4333 (Fum) 8.33 PA2624, idh 5.07 PA0835...”
- Pseudomonas aeruginosa twitching motility-mediated chemotaxis towards phospholipids and fatty acids: specificity and metabolic requirements
Miller, Journal of bacteriology 2008 - “...PA0506 PA0507 PA0508 PA0743 PA0744 PA0745 PA0746 PA0792 PA0795 PA0796 PA0797 PA0887 PA1137 PA1288 PA1736 PA1737 PA2011 PA2012 PA2013 PA2014 PA2015 PA2142 PA2552...”
- Population structure of Pseudomonas aeruginosa
Wiehlmann, Proceedings of the National Academy of Sciences of the United States of America 2007 - “...genomes with allele 0 in ampC-7 (PA4110), allele 0 in citS2 (PA0795), allele 1 in oprL (PA0973), and the absence of PA2185. The latter gene is part of a genomic...”
- More
6s87D / Q9I5E3 Crystal structure of 2-methylcitrate synthase (prpc) from pseudomonas aeruginosa in complex with oxaloacetate.
40% identity, 96% coverage
- Ligand: oxaloacetate ion (6s87D)
WP_128671493 2-methylcitrate synthase from Pseudomonas aeruginosa
40% identity, 97% coverage
- Two enzymes contribute to citrate production in the mitochondrion of Toxoplasma gondii
Lyu, The Journal of biological chemistry 2024 - “..., CEL66667; Eimeria mitis PrpC , XP_013356372; E.coli PrpC , MRF40902; Pseudomonas aeruginosa PrpC , WP_128671493; Type II CS in Gram-negative bacteria: E.coli GltA , KXL12831; Enterobacteriaceae GltA , WP_077128463; Shigella flexneri GltA , WP_154839470; Acetobacter aceti GltA , AGG68320; P.aeruginosa GltA , KXF33600; All sequence...”
W8Z6B2 Citrate synthase from Bacillus thuringiensis DB27
40% identity, 95% coverage
PVLB_08385 2-methylcitrate synthase from Pseudomonas sp. VLB120
40% identity, 97% coverage
- Expanding Pseudomonas taiwanensis VLB120's acyl-CoA portfolio: Propionate production in mineral salt medium
Neves, Microbial biotechnology 2024 - “...mutase genes scpA , argK and scpB combined with the deletion of the methylcitrate synthase PVLB_08385 was sufficient to observe propionylCoA accumulation in this Pseudomonas . The chassis' capability for oddchain product synthesis was assessed by expressing an acylCoA hydrolase, which enabled propionate synthesis. Three fedbatch...”
- “...reductase; Msr, malonic semialdehyde reductase; 3HPCS, 3hydroxypropionylCoA synthase; 3HPCD, 3hydroxypropionylCoA dehydratase and Acr, acryloylCoA reductase; PVLB_08385, 2methylcitrate synthase; Mcit, 2methylcitrate. The three de novo synthesis pathways for propionylCoA production diverge from different points in the central carbon metabolism and differ in length. The catabolic succinylCoA pathway...”
BUE60_12815 2-methylcitrate synthase from Pseudomonas syringae pv. actinidiae
40% identity, 97% coverage
PP2335 methylcitrate synthase, putative from Pseudomonas putida KT2440
PP_2335, T1E_5347 2-methylcitrate synthase from Pseudomonas putida DOT-T1E
40% identity, 97% coverage
- Bioproduction of propionic acid using levulinic acid by engineered Pseudomonas putida
Tiwari, Frontiers in bioengineering and biotechnology 2022 - “...to promote cell growth. Propionyl-CoA can be consumed through the methylcitrate cycle by methylcitrate synthase (PP2335, prpC ). Moreover, PA can be degraded to propionyl-CoA by propionyl-CoA synthase (PP2351, prpE ). High production of PA requires an accumulation of its precursor, propionyl-CoA. As a result, prpC...”
- ATP-dependent RecG helicase is required for the transcriptional regulator OxyR function in Pseudomonas species
Yeom, The Journal of biological chemistry 2012 - “...(rpoX) PP4621 (hmgA) PP0234 (oprE) PP1206 (oprD) PP0222 PP2335 PP0170 PP4194 (gltA) PP0883 PP0238 (ssuD) PP2441 PP5278 PP3148 PP0235 (lsfA) PP3122 PP0885 PP4402...”
- PpoR is a conserved unpaired LuxR solo of Pseudomonas putida which binds N-acyl homoserine lactones
Subramoni, BMC microbiology 2009 - “...as annotated in P. putida KT2440 Function Fold change 1. PP3433 4-hydroxyphenylpyruvate dioxygenase 18.116 2. PP2335 citrate synthase 12.097 3. PP1743 acetate permease 9.109 4. PP4621 homogentisate 1,2-dioxygenase 7.574 5. PP1742 hypothetical protein 7.057 6. PP4064 isovaleryl-CoA dehydrogenase 6.120 7. PP4065 3-methylcrotonyl-CoA carboxylase, beta subunit, putative...”
- Genome-scale reconstruction and analysis of the Pseudomonas putida KT2440 metabolic network facilitates applications in biotechnology
Puchałka, PLoS computational biology 2008 - “...slow (results not shown). One of these genes (PP5155) has also a weakly annotated isozyme (PP2335). We found out as well that several of the mutants (PP1612, PP4188-9, PP4191-4) grow in silico on glucose, which we confirmed experimentally (results not shown). Altogether, these experimental results assisted...”
- Insights into the susceptibility of Pseudomonas putida to industrially relevant aromatic hydrocarbons that it can synthesize from sugars
García-Franco, Microbial cell factories 2023 - “...(T1E_0537 and T1E_0538). Two citrate synthase genes ( glt A and prp C) (T1E_0434 and T1E_5347) were also induced, leading to an increased ability to channel acetyl-CoA quickly and efficiently into the respiratory chain. Phosphoenolpyruvate carboxylase, which is involved in replenishment of the Krebs cycle intermediate...”
- One major facilitator superfamily transporter is responsible for propionic acid tolerance in Pseudomonas putida KT2440
Ma, Microbial biotechnology 2021 - “...involved in PA metabolic pathways (Fig. 1 ), such as the genes of methylcitrate synthase (PP_2335, prpC ), propionylCoA synthase (PP_2351, prpE ) and Lthreonine aldolase (PP_0321, ltaE ; Ma et al ., 2020 ). Knockout of enzymes responsible for the transformation of intermediates in the...”
- Fatty Acid and Alcohol Metabolism in Pseudomonas putida: Functional Analysis Using Random Barcode Transposon Sequencing
Thompson, Applied and environmental microbiology 2020 (secret)
SSUSC84_1079 citrate synthase from Streptococcus suis SC84
SSU1041 citrate synthase from Streptococcus suis P1/7
41% identity, 97% coverage
AF_1340 citrate/2-methylcitrate synthase from Archaeoglobus fulgidus DSM 4304
AF1340 citrate synthase (citZ) from Archaeoglobus fulgidus DSM 4304
40% identity, 96% coverage
- A novel methoxydotrophic metabolism discovered in the hyperthermophilic archaeon Archaeoglobus fulgidus
Welte, Environmental microbiology 2021 - “...(AF_0409, AF_1623, AF_2129, AF_2366, AF_1417), isocitrate dehydrogenase Icd (AF_0647), aconitase Acn (AF_1963), citrate synthase CitZ (AF_1340), sulfate adenylyltransferase Sat (AF_1667), adenylylsulfate reductase AprAB (AF_166970), dissimilatory sulfite reductase DsrAB (AF_04234), DsrC (AF_2228), quinonemodifying oxidoreductase QmoABC (AF_06613), molybdopterin oxidoreductase DsrMKJOP (AF_0499503), DsrMK(K) (AF_05435), F 420 H 2 :quinone...”
- Identification and functional verification of archaeal-type phosphoenolpyruvate carboxylase, a missing link in archaeal central carbohydrate metabolism
Ettema, Journal of bacteriology 2004 - “...ST1811/ APE0672/ PAE2370/ MDHd 0039/2055 VNG0627G AF1340 VNG2102G MA0249 Meth02000729 MM1527 MTH1726, MTH962 PF0203 Faci02000612, Faci02001586 PTO0889, PTO0169...”
PRPC_MYCTE / H8F0D7 2-methylcitrate synthase; 2-MCS; MCS; Citrate synthase; CS; EC 2.3.3.5; EC 2.3.3.16 from Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) (see paper)
PRPC_MYCTU / I6Y9Q3 2-methylcitrate synthase; 2-MCS; MCS; Citrate synthase; EC 2.3.3.5; EC 2.3.3.16 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 3 papers)
JTY_1165 methylcitrate synthase from Mycobacterium bovis BCG str. Tokyo 172
MT1163 citrate synthase from Mycobacterium tuberculosis CDC1551
BCG_1192 putative citrate synthase I gltA1 from Mycobacterium bovis BCG str. Pasteur 1173P2
Rv1131 citrate synthase from Mycobacterium tuberculosis H37Rv
Mb1162 PROBABLE CITRATE SYNTHASE I GLTA1 from Mycobacterium bovis AF2122/97
38% identity, 93% coverage
- function: Involved in the catabolism of short chain fatty acids (SCFA) via the tricarboxylic acid (TCA)(acetyl degradation route) and via the 2-methylcitrate cycle I (propionate degradation route). Catalyzes the Claisen condensation of propionyl-CoA and oxaloacetate (OAA) to yield 2-methylcitrate (2-MC) and CoA. Also catalyzes the condensation of oxaloacetate with acetyl-CoA.
catalytic activity: propanoyl-CoA + oxaloacetate + H2O = (2S,3S)-2-methylcitrate + CoA + H(+) (RHEA:23780)
catalytic activity: oxaloacetate + acetyl-CoA + H2O = citrate + CoA + H(+) (RHEA:16845)
subunit: Homodimer.
disruption phenotype: Cells lacking both prpC and prpD are unable to grow on propionate media in vitro or in murine bone marrow-derived macrophages infected ex vivo. Paradoxically, bacterial growth and persistence, and tissue pathology, are indistinguishable in mice infected with wild-type. - function: Involved in the catabolism of short chain fatty acids (SCFA) via the tricarboxylic acid (TCA)(acetyl degradation route) and via the 2-methylcitrate cycle I (propionate degradation route). Catalyzes the Claisen condensation of propionyl-CoA and oxaloacetate (OAA) to yield 2-methylcitrate (2-MC) and CoA. Also catalyzes the condensation of oxaloacetate with acetyl-CoA.
catalytic activity: propanoyl-CoA + oxaloacetate + H2O = (2S,3S)-2-methylcitrate + CoA + H(+) (RHEA:23780)
catalytic activity: oxaloacetate + acetyl-CoA + H2O = citrate + CoA + H(+) (RHEA:16845)
subunit: Homodimer.
disruption phenotype: Cells lacking both prpC and prpD genes are unable to grow on propionate or cholesterol as the sole carbon source. - Novel target and cofactor repertoire for the transcriptional regulator JTY_0672 from <i>Mycobacterium bovis</i> BCG
Wang, Frontiers in microbiology 2024 - “...Transcriptional regulator 0.93928 JTY_3742 Bifunctional penicillin-insensitive transglycosylase/penicillin-sensitive transpeptidase ponA2 0.43877 JTY_1164 2-methylcitrate dehydratase PrpD 2.722 JTY_1165 Methylcitrate synthase PrpC 3.1164 JTY_3152 Universal stress protein 2.2968 JTY_3254 Stearoyl-CoA 9-desaturase desA3 1.7857 JTY_3315 L-lysine-epsilon aminotransferase 1.198 JTY_0421 Membrane protein 0.85154 JTY_0696 Membrane protein MmpS5 1.2257 JTY_0773 Acyl-CoA dehydrogenase...”
- Enzymatic activity necessary to restore the lethality due to Escherichia coli RNase E deficiency is distributed among bacteria lacking RNase E homologues
Tamura, PloS one 2017 - “...of MT567 with pLAC-rnjA and by replacing pNRNE4(Sm) in the presence of Ap without Sm. MT1163 and MT1169 were constructed by culturing MT567 and MT570 in the presence of 0.1% L-(+)-arabinose without Sm to dilute out pNRNE4(Sm). MT1173, MT1176, MT1177, MT1479, MT1481, MT1483, MT1485, and MT1487...”
- “...rng ::FRT [pLAC-ymdA] This study MT1158 Same as CM2100 but rng ::FRT [pLAC-rnjA] This study MT1163 Same as CM2100 but rng ::FRT This study MT1167 Same as MT244 but rng ::FRT [pRNG2SH] This study MT1169 Same as MT244 but rng ::FRT This study MT1173 Same as...”
- Transcriptional Profiling of Mycobacterium tuberculosis Exposed to In Vitro Lysosomal Stress
Lin, Infection and immunity 2016 - “...phosphodiesterase 1.77 2.43 0.4 0.5 MT0590 MT0776 MT1162 MT1163 MT1518 MT1983 MT1984 MT2243 MT2599 MT2730 Rv0564c Rv0752c Rv1130 Rv1131 Rv1472 Rv1933c Rv1934c...”
- Reduced immunopathology and mortality despite tissue persistence in a Mycobacterium tuberculosis mutant lacking alternative sigma factor, SigH
Kaushal, Proceedings of the National Academy of Sciences of the United States of America 2002 - “...MT2468 and MT2469 (sulfate ABC transporters); MT1163 (citrate synthase); MT2541 (conserved hypothetical protein containing a glutaredoxin active site);...”
- “...resistance efflux protein); MT1377 (cysteine synthase); MT1163 (citrate synthase); MT0631 (tcrA response regulator); MT0397 (clpB, ATP-binding subunit of...”
- InbR, a TetR family regulator, binds with isoniazid and influences multidrug resistance in Mycobacterium bovis BCG
Yang, Scientific reports 2015 - “...2.47 Rv0974c accD2 acetyl-/propionyl-coa carboxylase subunit beta accD2 11 BCG_1191 6.64 1.40 Rv1130 hypothetical protein BCG_1192 5.64 1.51 Rv1131 gltA1 citrate synthase NA BCG_1193 2.00 1.36 Rv1132 hypothetical protein 12 BCG_1214c 1.38 1.06 Rv1153c omt O-methyltransferase omt NA 13 BCG_1223 1.69 2.32 Rv1161 narG respiratory nitrate...”
- Gene Regulatory Mechanism of Mycobacterium Tuberculosis during Dormancy
Liu, Current issues in molecular biology 2024 - “...and glyoxylate cycle metabolism ( Rv0465c ), and propionate metabolism ( Rv1129c , prpC ( Rv1131 ), prpD ( Rv1130 )). The temporal changes in Mtb gene expression during the intracellular adaptation phase (following day 2) will indicate the metabolic pathways and survival mechanisms required for...”
- PBIT<sub>V3</sub> : A robust and comprehensive tool for screening pathogenic proteomes for drug targets and prioritizing vaccine candidates
Chakraborty, Protein science : a publication of the Protein Society 2024 (secret) - Revolutionizing control strategies against Mycobacterium tuberculosis infection through selected targeting of lipid metabolism
Kim, Cellular and molecular life sciences : CMLS 2023 - “...synCatabolism of short thase chain fatty acid 13 rv1131 Biosynthesis of PDIM Biosynthesis of sulfolipid Biosynthesis of mycolic acids Biosynthesis of mycolic...”
- A Novel Tool to Identify Bactericidal Compounds against Vulnerable Targets in Drug-Tolerant M. tuberculosis found in Caseum
Sarathy, mBio 2023 - “...qcrC 1.12 1.09 Rv1854c ndh 1.01 1.03 Rv3145 nuoA 1.09 1.04 Rv2583c relA 1.09 1.10 Rv1131 gltA1 / prpC 1.12 1.05 Rv3341 metA 1.10 1.02 Rv1130 prpD 1.20 1.05 Transcription Rv2710 sigB 1.14 1.19 Rv3260c whiB2 1.07 1.06 Virulence, detoxification, adaptation Rv2031c hspX 1.05 0.98 Rv3499c...”
- Understanding the Genetic Diversity of Mycobacterium africanum Using Phylogenetics and Population Genomics Approaches
Balamurugan, Frontiers in genetics 2022 - “...L5 and L6 belong to the central carbohydrate metabolism pathway which include His6Tyr (Rv0946c), Glu255Ala (Rv1131), Ala309Gly (Rv2454c), Val425Ala and Ser112Ala (Rv1127c), Gly198Ala (Rv3293) and Ile137Val (Rv0363c), Thr421Ala (Rv0896), Arg442His (Rv1248c), Thr218Ile (Rv1122), and Ser381Leu (Rv1449c), hinting at the differential growth attenuation. Genes harboring multiple (sub)-lineage-specific...”
- Dissecting the Mycobacterium bovis BCG Response to Macrophage Infection to Help Prioritize Targets for Anti-Tuberculosis Drug and Vaccine Discovery
Medley, Vaccines 2022 - “...and methylcitrate dehydratase, encoded by prpC and prpD , respectively ( Mb1162 , Mb1161 ; Rv1131 , Rv1130 ). These were the most highly upregulated genes intracellularly (L2FC 9.24 and 10.42), further highlighting the significance of changing carbon metabolism in intracellular mycobacteria. Unsurprisingly, as identified by...”
- Commonalities of Mycobacterium tuberculosis Transcriptomes in Response to Defined Persisting Macrophage Stresses
Vilchèze, Frontiers in immunology 2022 - “...(PBS plus tyloxypol). The most upregulated were prpD ( Rv1130 , 420-fold) and prpC ( Rv1131 , 270-fold). One hundred nighty eight genes were uniquely upregulated in this condition. Among them were genes encoding proteins involved in the metabolism of nitrogen (nitrite reductases nirBD ), lipids...”
- Dual RNA Sequencing of Mycobacterium tuberculosis-Infected Human Splenic Macrophages Reveals a Strain-Dependent Host-Pathogen Response to Infection
López-Agudelo, International journal of molecular sciences 2022 - “..., prpC , and rv1057 . prpD ( rv1130 , methylcitrate dehydratase) and prpC ( rv1131 , methylcitrate synthase) are genes required for a functional propionyl CoA-assimilating methylcitrate cycle (MCC), and they are controlled by the transcriptional activator prpR ( rv1129c ), which also was up-regulated...”
- More
- Dissecting the Mycobacterium bovis BCG Response to Macrophage Infection to Help Prioritize Targets for Anti-Tuberculosis Drug and Vaccine Discovery
Medley, Vaccines 2022 - “...process requiring methylcitrate synthase and methylcitrate dehydratase, encoded by prpC and prpD , respectively ( Mb1162 , Mb1161 ; Rv1131 , Rv1130 ). These were the most highly upregulated genes intracellularly (L2FC 9.24 and 10.42), further highlighting the significance of changing carbon metabolism in intracellular mycobacteria....”
- Bulk phase biochemistry of PIF1 and RecQ4 family helicases
Rajapaksha, Methods in enzymology 2022 - “...ssDNA bubble flanked by blunt dsDNA arms ( Rogers et al., 2017 ) MB811 GACGCTGCCGAATTCTAGGTTGATTGGATGCTACTCGTCGGCGCCACCTGCAGGTTCACC MB1162 GGGTGAACCTGCAGGTGGGCGGCTGCTCATCGTAGGTTAGTGGTAGAATTCGGCAGCGTC Can be annealed to create a three-stranded D-loop ( Guy & Bolt, 2005 ) MB1163 GACGCTGCCGAATTCTACCATGCCTTGCTAGGACATCTTTGCCCACCTGCAGGTTCACCC MB1165 TAAGAGCAAGATGTTCTATAAAAGATGTCCTAGCAAGGCA...”
- Genome-level analyses of Mycobacterium bovis lineages reveal the role of SNPs and antisense transcription in differential gene expression
Golby, BMC genomics 2013 - “...3 9 3 5 5 possible conserved exported protein Mb1161 Rv1130 2 conserved hypothetical protein Mb1162 Rv1131 gltA1 3 probable citrate synthase Mb1554c Rv1527c pks5 2 probable polyketide synthase Mb1562 Rv1535 2 5 hypothetical protein Mb1619c Rv1593c 2 conserved hypothetical protein Mb1749c Rv1720c 10 19 18...”
- Characterization of two in vivo-expressed methyltransferases of the Mycobacterium tuberculosis complex: antigenicity and genetic regulation
Golby, Microbiology (Reading, England) 2008 - “...25.510 Mb0476 Rv0467 icl 1819.2 Mb0529c Rv0516c nc Mb1058 Rv1029 kdpA nc Mb1086 Rv1057 8.44.7 Mb1162 Rv1131 gltA1 nc Mb1214 Rv1182 papA3 nc Mb1216c Rv1184c 7.32.8 Mb1217c Rv1185c fadD21 4.82.4 Mb1438c Rv1403c 36.516 Mb1439 Rv1404 3.91.9 Mb1440c Rv1405c 325.9138.7 Mb1495 Rv1460 3.31.5 Mb1618c Rv1592c 1.60.8 Mb1709...”
Q59977 citrate synthase (unknown stereospecificity) (EC 2.3.3.16) from Synechocystis sp. PCC 6803 (see paper)
sll0401 citrate synthase from Synechocystis sp. PCC 6803
39% identity, 92% coverage
- Pyruvate kinase 2 from Synechocystis sp. PCC 6803 increased substrate affinity via glucose-6-phosphate and ribose-5-phosphate for phosphoenolpyruvate consumption
Karikomi, Plant molecular biology 2024 - “...TCA cycle have been studied, including those of citrate synthase (CS encoded by gltA , sll0401) (Ito et al. 2019 ), aconitase (Aco encoded by acnB , slr0665) (Nishii et al. 2021 ; de Alvarenga et al. 2020 ), isocitrate dehydrogenase (IDH encoded by icd ,...”
- Biochemical elucidation of citrate accumulation in Synechocystis sp. PCC 6803 via kinetic analysis of aconitase
Nishii, Scientific reports 2021 - “...K number Bits E-value A (ATP-citrate lyase) sll1557 sucD ; succinyl-CoA synthetase K01902 68.2 2e13 sll0401 gltA ; citrate synthase K01647 50.8 1e-07 slr1495 Unknown protein 30.4 0.38 sll0283 Unknown protein 28.1 1.7 sll1174 Unknown protein 27.3 2.4 sll1556 Hypothetical protein K01823 26.2 5.7 sll1858 Unknown...”
- “...3.5 sll1099 tufA ; protein synthesis elongation factor Tu K02358 25.0 8.9 E (citryl-CoA lyase) sll0401 gltA ; citrate synthase K01647 68.2 4e14 slr0733 xerC ; integrase-recombinase protein K03733 27.7 0.65 sll0265 Unknown protein 25.8 2.5 slr0105 Unknown protein 25.4 3.6 slr1350 desA ; fatty acid...”
- Enhancing photosynthesis at high light levels by adaptive laboratory evolution
Dann, Nature plants 2021 - “...m slr2124: 3-oxoacyl-[acyl-carrier protein] reductase L57P x L116H x I126T + F230L x gltA ( sll0401 ): citrate synthase K329M x V387A x ppc ( sll0920 ): phosphoenol-pyruvate carboxylase T252M x R1031C x pykF ( sll1275 ): pyruvate kinase 2 A260V x P406T x spoT (...”
- Environmental Regulation of PndbA600, an Auto-Inducible Promoter for Two-Stage Industrial Biotechnology in Cyanobacteria
Madsen, Frontiers in bioengineering and biotechnology 2020 - “...Forward primer sequence Reverse primer sequence gene (53) (53) slr0211 CCTGCTCCGGGCCTTGG CTGGTATTGAATGGGGCCAC slr0451 GAACAACAGGCCAGGGTAG CGTAGTTCTTGCCGTTGGTG sll0401 GAGAGTAGAAGCCGTTACCC GCTGACGGAGAAGGAGCC slr1697 CCCGATTTAACACCAATGTCC GACTCAATATTGCTGGTAGCC slr0073 GGAATATTGCACTCGTCTGGG GCCAAGGTACGGTAGGAATG slr2144 CAACAGTGACGGTCTGACC CACCACTGCTTGCCCATCC psbA1 CCTGTGGTCACGGTTCTGTT TGCCATCAATATCCACCGGG rnpB GTGAGGACAGTGCCACAGAA GATACTGCTGGTGCGCTCTT ndbA GACAAAAACGGTGCTCTGGG CTCAAATCCGGGTTGACCAC slr1747 GTTGCCCTCCCCTTGGTG GAATATGGCTCGAATCCAACAC Promoter Analyses A 600 bp sequence occurring...”
- Citrate synthase from Synechocystis is a distinct class of bacterial citrate synthase
Ito, Scientific reports 2019 - “...cyanobacterium. In this study, we performed biochemical analyses of Sy CS (encoded by gltA , sll0401) (Fig. 1 ) and compared its properties with those of other bacterial CSs. Results Purification and kinetic analyses of Sy CS For biochemical analysis of Sy CS, glutathione- S -transferase...”
- “...carboxylation of PEP to generate oxaloacetate, a substrate of Sy CS (encoded by gltA , sll0401) and malate dehydrogenase (encoded by citH , sll0891) (Fig. 1 ) 11 . The reaction catalysed by phosphoenolpyruvate carboxylase (encoded by pps , sll0920) (Fig. 1 ) is the rate-limiting...”
- Diurnal Regulation of Cellular Processes in the Cyanobacterium Synechocystis sp. Strain PCC 6803: Insights from Transcriptomic, Fluxomic, and Physiological Analyses
Saha, mBio 2016 - “...(hereafter, Synechococcus PCC 7942) ( 30 ). In the tricarboxylic acid (TCA) cycle, glt ( sll0401 , encoding citrate synthase) did not show any oscillatory behavior. However, the rest of the genes mostly had cycling behavior, even though sometimes with opposite phases. For instance, genes such...”
- Identification of a transporter Slr0982 involved in ethanol tolerance in cyanobacterium Synechocystis sp. PCC 6803
Zhang, Frontiers in microbiology 2015 - “...( sll0745 ), phosphoribulokinase ( sll1525 ), phosphopyruvate hydratase ( slr0752 ), citrate synthase ( sll0401 ) and glutamate dehydrogenase ( slr0710 ). The genes were selected because their enzymatic substrates or products were differentially regulated between the slr0982 mutant and the control under ethanol stress...”
- “...slr0982 -ethanol vs. WT-ethanol 1.452 0.072 slr0752 phosphopyruvate hydratase slr0982 -ethanol vs. WT-ethanol 2.613 0.282 sll0401 citrate synthase slr0982 -ethanol vs. WT-ethanol 2.090 0.297 slr0710 glutamate dehydrogenase slr0982 -ethanol vs. WT-ethanol 1.773 0.323 Untargeted GC-MS metabolomic analysis of the wild-type and the slr0982 strain Following the...”
- rre37 Overexpression alters gene expression related to the tricarboxylic acid cycle and pyruvate metabolism in Synechocystis sp. PCC 6803
Iijima, TheScientificWorldJournal 2014 - “...TCA Cycle in ROX370 The transcripts of 12 genes related to the TCA cycle, gltA (sll0401, encoding a citrate synthase), acnB (slr0665, encoding an aconitate hydratase), icd (slr1289, encoding an isocitrate dehydrogenase), gabD (slr0370, encoding a succinic semialdehyde dehydrogenase), kgd (sll1981, encoding a 2-OG decarboxylase), sucC...”
- More
Q59939 Citrate synthase from Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
SMU_671 citrate synthase from Streptococcus mutans UA159
41% identity, 97% coverage
- S-glutathionylation proteome profiling reveals a crucial role of a thioredoxin-like protein in interspecies competition and cariogenecity of Streptococcus mutans
Li, PLoS pathogens 2020 - “...accC 95, 338 Putative acetyl-CoA carboxylase biotin carboxylase subunit Q8DTF8 pckA 236, 324 Phosphoenolpyruvate carboxykinase Q59939 Carbon metabolism citZ 13 Citrate synthase P72484 tpiA 127, 128, 188 Triosephosphate isomerase Q8DVV3 gapC 153, 157 Glyceraldehyde-3-phosphate dehydrogenase Q8DUP4 Alanine, aspartate and glutamate metabolism carA (pyrA) 76 Carbamoyl-phosphate synthase...”
- Identification of stress-responsive genes in Streptococcus mutans by differential display reverse transcription-PCR
Chia, Infection and immunity 2001 - “...90/119 (75) 126/131 (96) 38/38 (100) G69599 (7) Q59940 (6) Q59939 (6) a The ratio of induction or repression was estimated by the intensity of the bands of RNA...”
- MGcV: the microbial genomic context viewer for comparative genome analysis
Overmars, BMC genomics 2013 - “...by a binding site in the N-terminus encoding part of the gene (Figure 3 C: SMU_671 and SMU_1519), suggesting that this might be a particularity of the regulatory mechanism. Finally, the interactive map provides a convenient overview to determine a possible score threshold for both the...”
- “...the expression data of the GlnR mutant. Most of the top down regulated genes (SMU_1658, SMU_671 and SMU,1519 in Figure 3 C) indeed are preceded by a putative binding site. Conclusion Gene-context conservation is an important genomic property to exploit in genome analyses. Nine years ago...”
VT47_09990 2-methylcitrate synthase from Pseudomonas syringae pv. syringae
39% identity, 97% coverage
- Identification of the Genes of the Plant Pathogen Pseudomonas syringae MB03 Required for the Nematicidal Activity Against Caenorhabditis elegans Through an Integrated Approach
Ali, Frontiers in microbiology 2022 - “...isovaleryl-CoA dehydrogenase (VT47_11890), putative acyl-CoA carboxylase alpha chain (VT47_11875), acyl-CoA carboxyltransferase beta chain (VT47_11885), prpC (VT47_09990), and PrpB (VT47_09985). On the other hand, crfX (VT47_10030), (VT47_19750) and hypothetical protein (VT47_10035) were down regulated ( Table 2 ). Regarding nematicidal genes of PAO1, homologs of 30 genes...”
- “...VT47_11875 Yes Unchanged Up 3-Methylcrotonyl-CoA carboxylase alpha subunit VT47_11885 Yes Unchanged Up Propionyl-CoA carboxylase prpC VT47_09990 Yes Unchanged Up 2-Methylcitrate synthase prpB VT47_09985 Yes Unchanged Up 2-Methylisocitrate lyase cmpX VT47_10035 Yes Unchanged Down Hypothetical protein ibaG VT47_19750 Yes Unchanged Down BolA-like protein VT47_10030 Yes Unchanged Down...”
PSPPH_2057 2-methylcitrate synthase from Pseudomonas syringae pv. phaseolicola 1448A
39% identity, 97% coverage
CYA_1739 2-methylcitrate synthase/citrate synthase II from Synechococcus sp. JA-3-3Ab
39% identity, 96% coverage
CGS9114_RS13295 bifunctional 2-methylcitrate synthase/citrate synthase from Corynebacterium glutamicum S9114
39% identity, 93% coverage
- Improvement in L-ornithine production from mannitol via transcriptome-guided genetic engineering in Corynebacterium glutamicum
Nie, Biotechnology for biofuels and bioproducts 2022 - “...indicated that C. glutamicum MTL01 cultured with mannitol had a strong energy metabolism. In particular, CGS9114_RS13295 , identified as prpC , encoding a bifunctional enzyme that participates in the methyl citric acid cycle and TCA cycle, showed the highest expression change of 20.88-fold (Table 1 )....”
- “...with the tricarboxylic acid cycle and propionic acid metabolism Gene Description Log2(FC) Padjust Regulated type CGS9114_RS13295 ( prpC ) Bifunctional 2-methylcitrate synthase/citrate synthase 4.38 1.11E13 Up CGS9114_RS02685 Methylisocitrate lyase 4.11 9.13E13 Up CGS9114_RS13300 Methylisocitrate lyase 3.79 2.47E09 Up CGS9114_RS02680 MmgE/PrpD family protein 3.48 1.12E16 Up CGS9114_RS01580...”
BAU10_07695 2-methylcitrate synthase from Vibrio alginolyticus
39% identity, 95% coverage
Q9KSC1 2-methylcitrate synthase (EC 2.3.3.5) from Vibrio cholerae (see paper)
VC1337 methylcitrate synthase from Vibrio cholerae O1 biovar eltor str. N16961
39% identity, 96% coverage
- A dual-function RNA balances carbon uptake and central metabolism in Vibrio cholerae
Venkat, The EMBO journal 2021 - “...overexpression did not affect this pattern. Of note, the V.cholerae genome encodes a GltA paralog (VC1337; Heidelberg etal , 2000 ), which might account for the residual citrate synthase activity in the assay (Fig 5B ). GltA from Gramnegative bacteria, such as V.cholerae , is a...”
- A novel phase variant of the cholera pathogen shows stress-adaptive cryptic transcriptomic signatures
Lambert, BMC genomics 2016 - “...amount in N16961SD (Additional file 11 : Table S7). Also, the gene for 2-methylcitrate synthase, VC1337 ( prpC ), which functions in both the TCA cycle and GB, was similarly regulated (Additional file 11 : Table S7). Other TCA/GB genes, including VC2092 ( gltA ), VC1338...”
PRPC1_CORGL / Q8NSH7 2-methylcitrate synthase 1; 2-MCS; MCS; Citrate synthase 1; CS; EC 2.3.3.5; EC 2.3.3.16 from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534) (see paper)
Q8NSH7 2-methylcitrate synthase (EC 2.3.3.5) from Corynebacterium glutamicum (see paper)
cg0798 methylcitrate synthase from Corynebacterium glutamicum ATCC 13032
39% identity, 93% coverage
- function: Catalyzes the Claisen condensation of propionyl-CoA and oxaloacetate (OAA) to yield 2-methylcitrate (2-MC) and CoA. Also catalyzes the condensation of oxaloacetate with propionyl-CoA but with a lower specificity.
catalytic activity: propanoyl-CoA + oxaloacetate + H2O = (2S,3S)-2-methylcitrate + CoA + H(+) (RHEA:23780)
catalytic activity: oxaloacetate + acetyl-CoA + H2O = citrate + CoA + H(+) (RHEA:16845)
subunit: Homodimer. - Physiological Response of Corynebacterium glutamicum to Indole
Walter, Microorganisms 2020 - “...catabolism 2.57 cg0796 prpD1 putative (2-methyl) citrate dehydratase 1.65 cg0797 prpB1 putative (methyl)isocitrate lyase 1.82 cg0798 prpC1 putative (methyl)citrate synthase 1.76 cg1279 putative secreted protein 2.05 cg1327 putative transcriptional regulator, Crp-family 1.53 cg1328 putative heavy-metal ion transporting P-type ATPase 1.72 cg1393 putative acetyltransferase, GNAT family 1.78...”
- Deletion of the aconitase gene in Corynebacterium glutamicum causes strong selection pressure for secondary mutations inactivating citrate synthase
Baumgart, Journal of bacteriology 2011 - “...(13). Later, two methylcitrate synthases were identified, PrpC1 (cg0798) and PrpC2 (cg0762), which also can catalyze the formation of citrate from oxaloacetate...”
- Co-ordinated regulation of gluconate catabolism and glucose uptake in Corynebacterium glutamicum by two functionally equivalent transcriptional regulators, GntR1 and GntR2
Frunzke, Molecular microbiology 2008 - “...1.51 0.86 0.85 0.89 cg0796 2-methylcitrate dehydratase, prpD1 6.34 1.08 0.78 0.93 0.73 0.89 0.81 cg0798 2-methylcitrate synthase, prpC1 6.69 1.14 0.68 1.24 0.88 1.09 1.29 cg0144 Transporter 8.11 1.03 1.87 1.01 0.98 1.17 1.29 cg1589 Hypothetical protein 9.33 1.06 1.21 0.98 1.08 1.15 1.11 cg1643...”
- Adaptation of Corynebacterium glutamicum to ammonium limitation: a global analysis using transcriptome and proteome techniques
Silberbach, Applied and environmental microbiology 2005 - “...cg1737 cg1111 cg3068 cg2613 cg2891 cg1791 cg0949 cg2291 cg1133 cg0798 cg2958 cg2466 cg2291 tal aceE aceE poxB gap atpH aceE aceE aceE acn eno fda mdh poxB...”
CYB_1908 2-methylcitrate synthase/citrate synthase II from Synechococcus sp. JA-2-3B'a(2-13)
39% identity, 96% coverage
A8YCJ7 citrate synthase (unknown stereospecificity) (EC 2.3.3.16) from Microcystis aeruginosa (see paper)
40% identity, 95% coverage
Pf6N2E2_6062 2-methylcitrate synthase (EC 2.3.3.5) from Pseudomonas fluorescens FW300-N2E2
39% identity, 97% coverage
- mutant phenotype: Specifically important for utilizing Sodium propionate. Automated validation from mutant phenotype: the predicted function (2.3.3.5) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
Q5SIM6 citrate synthase (unknown stereospecificity) (EC 2.3.3.16) from Thermus thermophilus (see paper)
TTHA1343 citrate synthase from Thermus thermophilus HB8
41% identity, 94% coverage
BOW65_RS08620 2-methylcitrate synthase from Pseudomonas koreensis
39% identity, 97% coverage
- Bacterial Analogs of Plant Tetrahydropyridine Alkaloids Mediate Microbial Interactions in a Rhizosphere Model System
Lozano, Applied and environmental microbiology 2019 - “...lipoprotein Cell surface 10 BOW65_RS29255 Phospholipid/glycerol acyltransferase Cell surface 11 BOW65_RS28295 Acetylglutamate kinase Metabolism 12 BOW65_RS08620 Methylcitrate synthase Metabolism 13 BOW65_RS24475 Ketol-acid reductoisomerase Metabolism 14 BOW65_RS07790 Succinyl-CoA synthetase subunit alpha Metabolism 15 BOW65_RS08625 2-Methylisocitrate dehydratase Metabolism 16 a BOW65_RS24600 3-Methyl-2-oxobutanoate hydroxymethyltransferase Metabolism 16 a BOW65_RS24605 Pantoate-beta-alanine...”
Q53554 citrate (Si)-synthase (EC 2.3.3.1) from Pyrococcus furiosus (see paper)
PF0203 citrate synthase from Pyrococcus furiosus DSM 3638
38% identity, 97% coverage
- Modular architecture of metabolic pathways revealed by conserved sequences of reactions
Muto, Journal of chemical information and modeling 2013 - “...furiosus , 17 two gene clusters correspond to the reaction module RM001: the gene cluster (PF0203 PF0201 PF0202) for the RCLASS sequence (RC00067 RC00498+RC00618 RC00084+RC00626) in citrate cycle and the gene cluster (PF0937 PF0938+PF0939 PF0940) for the RCLASS sequence (RC00470 RC01041+RC01046 RC00084+RC00577) in leucine biosynthesis. It...”
- “...RC module overall reaction KO module gene cluster example a RM001 oxaloacetate 2-oxoglutarate M00010 (pfu) PF0203 PF0201 PF0202 2-oxoisovalerate 2-oxoisocaproate M00432 (pfu) PF0937 PF0938+PF0939 PF0940 pyruvate 2-oxobutanoate M00535 (bth) BT_1858 BT_1860+BT_1859 BT_1857 RM002 2-aminoadipate lysine M00028 (bsu) BSU11200 BSU11210+BSU11190 BSU11220 glutamate ornithine M00031 (ttr) Tter_0315+Tter_0316 Tter_0320...”
- Novel multiprotein complexes identified in the hyperthermophilic archaeon Pyrococcus furiosus by non-denaturing fractionation of the native proteome
Menon, Molecular & cellular proteomics : MCP 2009 - “...PF0139 PF0146 PF0147 PF0160 PF0161 PF0198 PF0199 PF0202 PF0203 PF0390 PF0391 PF0548 PF0549 PF0639 PF0640 PF0641 PF0642 PF0643 PF0753 PF0754 PF0872 PF0873 PF0972...”
- Impact of substrate glycoside linkage and elemental sulfur on bioenergetics of and hydrogen production by the hyperthermophilic archaeon Pyrococcus furiosus
Chou, Applied and environmental microbiology 2007 - “...3.02 2.42 2.72 2.62 3.32 Glutamate metabolism PF0201 PF0202 PF0203 PF0204 PF0205 PF0206 PF0207 PF0450 PF1602 PF1852 3.42 3.72 5.82 2.82 4.12 2.92 2.12 35.92 4.2...”
- Identification and functional verification of archaeal-type phosphoenolpyruvate carboxylase, a missing link in archaeal central carbohydrate metabolism
Ettema, Journal of bacteriology 2004 - “...AF1340 VNG2102G MA0249 Meth02000729 MM1527 MTH1726, MTH962 PF0203 Faci02000612, Faci02001586 PTO0889, PTO0169 TA0169, TA0819 TVN0239 SSO1254 APE0311 CTLf 2301...”
- Whole-genome DNA microarray analysis of a hyperthermophile and an archaeon: Pyrococcus furiosus grown on carbohydrates or peptides
Schut, Journal of bacteriology 2003 - “...California, Berkeley PF0101 TCA cycle PF0201 PF0202 PF0203 [Glutamate biosynthesis] PF0204 PF0205 PF0206 [Arginine biosynthesis] PF0207 PF0208 PF0209 PF0272...”
- “...synthase, aconitase, and isocitrate dehydrogenase (PF0201 to PF0203). These presumably supply 2-ketoglutarate for glutamate synthesis and are arranged in an...”
1iomA / Q5SIM6 Crystal structure of citrate synthase from thermus thermophilus hb8 (see paper)
41% identity, 95% coverage
- Ligand: carbonate ion (1iomA)
tlr2393 citrate synthase from Thermosynechococcus elongatus BP-1
38% identity, 95% coverage
- Species-specific transcriptomic network inference of interspecies interactions
McClure, The ISME journal 2018 - “...metabolism genes of T. elongatus (fumC, gltA; tll1534, tlr2393) and genes of M. ruber. Finally, there were certain metabolites such as vitamin B12 (i.e.,...”
- Indirect Interspecies Regulation: Transcriptional and Physiological Responses of a Cyanobacterium to Heterotrophic Partnership
Bernstein, mSystems 2017 - “...tlr2340 ), lactate dehydrogenase ( ldhA ; tlr0711 ), and citrate synthase ( gltA ; tlr2393 ). Functions involved in synthesis and export of larger biomolecules (i.e., sugars, peptides, and extracellular polymeric substance [EPS]) also grouped into clusters D and G. These included a putative exopolysaccharide...”
T303_07280 citrate synthase from Streptococcus thermophilus ASCC 1275
39% identity, 97% coverage
- Comparative mRNA-Seq Analysis Reveals the Improved EPS Production Machinery in Streptococcus thermophilus ASCC 1275 During Optimized Milk Fermentation
Wu, Frontiers in microbiology 2018 - “...T303_01340 Amidophosphoribosyltransferase 121 1340-F GATTCGTCGTAGCCATAACC 1340-R TGGATCCAAAGCTGCAATAA T303_01945 CTP synthase 121 1945-F GCTGGACAAGGAATCAAGAA 1945-R TACCCTGAGCCTGCATATTA T303_07280 Citrate synthase 118 7280-F ACACTCATCGGGTGTAAATG 7280-R CAACGCAAATGGAACTCAAG T303_09710 Glutamine synthetase 117 9710-F GGAAGTAGTATGCGTCTTGAG 9710-R GTATTGCCGGTAGTGGTATG Cd3 vs. Cd2 T303_03150 Fructose operon transcriptional repressor 97 3150-F CATGCTGTTAAGCTGGTAGA 3150-R CCAGAGCTGTACTTCCAATAG T303_05205 Cell...”
- Transcriptomic Insights Into the Growth Phase- and Sugar-Associated Changes in the Exopolysaccharide Production of a High EPS-Producing Streptococcus thermophilus ASCC 1275
Padmanabhan, Frontiers in microbiology 2018 - “...be highly expressed at 5h in M17-L. In L10h, genes involved in citrate cycle (T303_07275, T303_07280, T303_07285), trehalose metabolism (T303_00355, T303_00360, T303_00365) and acetyl CoA carboxylase biotin carrier protein and subunits (T303_03105 T303_03115, T303_03120, T303_03125) were significantly upregulated. FIGURE 7 Changes in expression of genes associated...”
Q7U401 Citrate synthase from Parasynechococcus marenigrum (strain WH8102)
40% identity, 90% coverage
WU75_15770 2-methylcitrate synthase from Vibrio parahaemolyticus
39% identity, 95% coverage
- Identification of Antibacterial Components and Modes in the Methanol-Phase Extract from a Herbal Plant Potentilla kleiniana Wight et Arn
Tang, Foods (Basel, Switzerland) 2023 - “...parahaemolyticus ATCC17802 treatment group ( p < 0.05). For example, the DEG ( prpC , WU75_15770 ) encoding a 2-methylcitrate synthase was significantly inhibited (0.435-fold) ( p < 0.05). It has been reported that the strategic inhibition of organic acid catabolism in P. aeruginosa through inhibition...”
- “...pflD 12.853 Pyruvate formate-lyase WU75_00810 gloA 13.536 Glyoxalase Propanoate metabolism WU75_15760 prpF 0.402 3-methylitaconate isomerase WU75_15770 prpC 0.435 Methylcitrate synthase beta-Lactam resistance WU75_09315 acrA 6.699 Hemolysin D WU75_09310 acrB 8.911 Multidrug transporter WU75_09925 acrA 40.366 Hemolysin D ABC transporters WU75_10385 proW 0.106 ABC transporter permease WU75_16175...”
VpaChn25_1638 2-methylcitrate synthase from Vibrio parahaemolyticus
39% identity, 95% coverage
- Genomic and transcriptomic analyses reveal distinct biological functions for cold shock proteins (VpaCspA and VpaCspD) in Vibrio parahaemolyticus CHN25 during low-temperature survival
Zhu, BMC genomics 2017 - “...dehydrogenase VpaChn25A_1036 2.1029 Acyl-CoA dehydrogenase Propanoate metabolism VpaChn25_1376 6.0834 4-aminobutyrate aminotransferase VpaChn25_1635 6.3526 PrpE protein VpaChn25_1638 8.5787 Methylcitrate synthase VpaChn25_1639 6.7065 2-methylisocitrate lyase VpaChn25_2798 3.959 Acetyl-CoA synthetase ABC transporters VpaChn25A_0128 0.4376 ABC transporter substrate-binding protein VpaChn25A_0130 0.428 ABC transporter ATP-binding protein VpaChn25A_0533 3.1521 High-affinity branched-chain amino...”
- “...acid oxidation complex subunit alpha VpaChn25_2076 0.4816 3-ketoacyl-CoA thiolase Propanoate metabolism VpaChn25_1635 2.316 PrpE protein VpaChn25_1638 4.6552 Methylcitrate synthase VpaChn25_1639 3.654 2-methylisocitrate lyase VpaChn25_2433 3.0153 Bifunctional aconitate hydratase 2/2-methylisocitrate dehydratase VpaChn25_2798 2.1035 Acetyl-CoA synthetase Nitrogen metabolism VpaChn25A_0296 4.3124 Oxidoreductase protein VpaChn25A_0917 3.7442 Nitrite reductase large subunit...”
Q7V3C0 Citrate synthase from Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
40% identity, 94% coverage
1aj8A / Q53554 Citrate synthase from pyrococcus furiosus (see paper)
38% identity, 96% coverage
- Ligand: coenzyme a (1aj8A)
VP1647 methylcitrate synthase from Vibrio parahaemolyticus RIMD 2210633
VP_RS07930 2-methylcitrate synthase from Vibrio parahaemolyticus RIMD 2210633
39% identity, 95% coverage
- TssL2 of T6SS2 is required for mobility, biofilm formation, wrinkly phenotype formation, and virulence of Vibrio parahaemolyticus SH112
Bai, Applied microbiology and biotechnology 2024 - “...motB ), and upregulated expression of biofilm-related genes ( cpsQ , aphA ), metabolism-related proteins (VP1647, VP1626, VPA0472), uncharacterized proteins (VP1279, VPA0668, VP1444, VPA1308), and which were consistent with the previous results (Wu et al. 2022 ). Therefore, another mechanism is that TssL2 deficiency changes smooth...”
- A Nonautochthonous U.S. Strain of Vibrio parahaemolyticus Isolated from Chesapeake Bay Oysters Caused the Outbreak in Maryland in 2010
Haendiges, Applied and environmental microbiology 2016 - “...University of California, Berkeley Target VP1807 VPA0532 VPA1445 VPA1674 VP1647 Haendiges et al. TABLE 4 List of genomes in GenBank that belong to the same...”
- Changes in global gene expression of Vibrio parahaemolyticus induced by cold- and heat-stress
Urmersbach, BMC microbiology 2015 - “...biosynthesis of polyamines (VPA0169, VPA0170, VPA1635) and degradation of fatty acids as well as fermentation (VP1647, VP2543, VPA0478, VPA0502, VPA1416) were up-regulated at 42C. Moreover especially sugar metabolism (VP1303, VP2397, VP2398, VP2400, VPA1674, VPA1675, VPA1700, VPA1706) was affected (Additional file 1 ). Genes involved in arabinose...”
- Comparative RNA-Seq based dissection of the regulatory networks and environmental stimuli underlying Vibrio parahaemolyticus gene expression during infection
Livny, Nucleic acids research 2014 - “...homologs of genes down-regulated by Spot 42 in E. coli (e.g. citrate synthase (VP0842 and VP1647), malate dehydrogenase (VP0325) and pyridine nucleotide transhydrogenase (VP2942)), suggesting that V. parahaemolyticus Spot 42 likely regulates similar processes as the E. coli sRNA. Additionally, this result suggests that preferred carbon...”
- Identification of Antibacterial Components in the Methanol-Phase Extract from Edible Herbaceous Plant Rumex madaio Makino and Their Antibacterial Action Modes
Liu, Molecules (Basel, Switzerland) 2022 - “...Formate C-acetyltransferase VP_RS18985 0.119 Acetyl-CoA carboxylase%2C carboxyltransferase subunit beta VP_RS16405 0.240 Aspartate aminotransferase family protein VP_RS07930 2.084 2-methylcitrate synthase VP_RS07925 2.094 Fe/S-dependent 2-methylisocitrate dehydratase AcnD VP_RS20545 2.450 CoA-acylating methylmalonate-semialdehyde dehydrogenase Cationic antimicrobial peptide (CAMP) resistance VP_RS00200 0.120 Multidrug efflux RND transporter permease subunit VmeD VP_RS00205 0.159...”
MSMEG_6647 citrate synthase 2 from Mycobacterium smegmatis str. MC2 155
38% identity, 95% coverage
- The Nitrogen Regulator GlnR Directly Controls Transcription of the prpDBC Operon Involved in Methylcitrate Cycle in Mycobacterium smegmatis
Liu, Journal of bacteriology 2019 - “...involved in the methylcitrate cycle (msmeg_6645, msmeg_6646, and msmeg_6647 products). The prpD(B)C operon plays a key role in assimilation of propionyl-CoA for...”
- “...of more than 680 genes, including MEMEG_6645 and MSMEG_6647 involved in the methylcitrate cycle (21). In this study, a typical nitrogen regulator, GlnR-binding...”
- Quantitative mass spectrometry reveals plasticity of metabolic networks in Mycobacterium smegmatis
Chopra, Molecular & cellular proteomics : MCP 2014 - “...revealed higher abundance of methylcitrate synthase (PrpC, MSMEG_6647) and 2-methylcitrate dehydratase (PrpD, MSMEG_6645), enzymes that play key roles in...”
- “...methylcitrate cycle: methylcitrate synthase (PrpC, MSMEG_6647), methylcitrate dehydratase (PrpD, MSMEG_6645), and 2-methylisocitrate lyase (PrpB, MSMEG_6646)...”
DR0757, DR_0757 citrate synthase from Deinococcus radiodurans R1
37% identity, 88% coverage
- Genome-wide transcriptome and antioxidant analyses on gamma-irradiated phases of deinococcus radiodurans R1
Luan, PloS one 2014 - “...and 77, respectively. As shown in Figure 5 , the genes DR_1540 ( icd ), DR_0757 ( gltA ), and DR_0953 ( shhC ) involved in the TCA pathway were significantly repressed during irradiation and recovery, consistent with the report of Liu, et al [15] ....”
- Oxidative stress resistance in Deinococcus radiodurans
Slade, Microbiology and molecular biology reviews : MMBR 2011 - “...bypass Malate synthase (GlcB) Isocitrate lyase (AceA) DR0757 DR1720 DR1540 DR0287 DR0083 DR1247 DR1248 DR0700 DR0701 DR0698 DR0702 DR0697 DR0699 DR0695...”
- Deinococcus radiodurans PprI switches on DNA damage response and cellular survival networks after radiation damage
Lu, Molecular & cellular proteomics : MCP 2009 - “...R1 strain, including DR1983 (ribosomal protein S1), DR0757 (citrate synthase), DRA0201 (NH3-dependent NAD synthase), and DR0969 (hypothetical protein) (Fig. 6)....”
- “...2-D gels for DR1983 (ribosomal protein S1), DR0757 (citrate synthase), DRA0201 (NH3-dependent NAD synthase), DR0969 (hypothetical protein), and DR2337...”
- Predicted highly expressed and putative alien genes of Deinococcus radiodurans and implications for resistance to ionizing radiation damage
Karlin, Proceedings of the National Academy of Sciences of the United States of America 2001 - “...1.29 1.05 DR1720 DR0828 DR1540 DR0325 DR1247 DR0287 DR2627 DR1248 DR1674 DR0757 DR0083 905 463 430 329 385 955 812 300 332 410 416 2.56 2.19 2.07 1.80 1.71 1.70...”
BP2368 2-methylcitrate synthase from Bordetella pertussis Tohama I
35% identity, 92% coverage
- In Vivo Gene Essentiality and Metabolism in Bordetella pertussis
Gonyar, mSphere 2019 - “.../ wcbA Capsular polysaccharide export protein BP1818 / dadA_1 d -Amino acid dehydrogenase small subunit BP2368 / prpC 2-Methylcitrate synthase BP2644 Glycerol-3-phosphate dehydrogenase BP3228 / minD Septum site-determining protein BP3575 Hypothetical protein BP3671 Glycosyltransferase family protein BP3672 Hypothetical protein BP3679 TetR family transcriptional regulator BP3740 /...”
YP_500307 hypothetical protein from Staphylococcus aureus subsp. aureus NCTC 8325
Q2FXN3 citrate synthase (unknown stereospecificity) from Staphylococcus aureus (strain NCTC 8325 / PS 47)
SAOUHSC_01802 hypothetical protein from Staphylococcus aureus subsp. aureus NCTC 8325
45% identity, 73% coverage
- Effect of Substance P in Staphylococcus aureus and Staphylococcus epidermidis Virulence: Implication for Skin Homeostasis
N'Diaye, Frontiers in microbiology 2016 - “...Coenzyme A binding site, oxalacetate citrate binding site, catalytic triad 205 18 39 42566/6.41 6 YP_500307 Hypothetical protein SAOUHSC_01802 Oxalacetate citrate binding site, coenzyme A binding site, catalytic triad 116 13 33 3237117.17 Substance P increases the biofilm formation activity of S. epidermidis The biofilm formation...”
- Antimicrobial Activity and Mechanism of Action of Dracocephalum moldavica L. Extracts Against Clinical Isolates of Staphylococcus aureus
Yu, Frontiers in microbiology 2019 - “...0.000740 Q2G273 Urease accessory UreG 9.51 0.001393 Q2FYG5 Ubiquinone menaquinone biosynthesis methyltransferase UbiE 7.32 0.006516 Q2FXN3 Citrate synthase (si) CitZ 6.57 0.001923 Q2FY68 Pyrroline-5-carboxylate reductase ProC 6.5 0.000341 G5JHQ8 Nucleoside diphosphate kinase Ndk 5.92 0.000352 Q2FWB7 Non-specific DNA-binding Dps Iron-binding ferritin-like antioxidant Ferroxidase Dps1 5.81 0.000240...”
- Transcriptomic analyses reveal the potential antibacterial mechanism of citral against Staphylococcus aureus
Liao, Frontiers in microbiology 2023 - “...glycolytic pathway ( Hon et al., 2022 ), was significantly up-regulated (3.57-fold). The genes ( SAOUHSC_01802 , icd and SAOUHSC_01614 ) encoding the rate-limiting enzymes in the tricarboxylic acid (TCA) cycle were up-regulated. The gene sucD encoding the succinyl-CoA synthetase subunit alpha which involved only substrate-level...”
- Effect of Substance P in Staphylococcus aureus and Staphylococcus epidermidis Virulence: Implication for Skin Homeostasis
N'Diaye, Frontiers in microbiology 2016 - “...site, oxalacetate citrate binding site, catalytic triad 205 18 39 42566/6.41 6 YP_500307 Hypothetical protein SAOUHSC_01802 Oxalacetate citrate binding site, coenzyme A binding site, catalytic triad 116 13 33 3237117.17 Substance P increases the biofilm formation activity of S. epidermidis The biofilm formation activity of Staphylococci...”
- Advantage of upregulation of succinate dehydrogenase in Staphylococcus aureus biofilms
Gaupp, Journal of bacteriology 2010 - “...E2 (SAOUHSC_01042); CitZ, citrate synthase (SAOUHSC_01802); CitB, aconitate hydratase (SAOUHSC_01347); CitC, isocitrate dehyrogenase (SAOUHSC_01801); OdhA/ Kgd,...”
AN479_RS02845 2-methylcitrate synthase from Serratia marcescens
36% identity, 93% coverage
Q2Z1A8 2-methylcitrate synthase (EC 2.3.3.5) from Cupriavidus necator (see paper)
36% identity, 90% coverage
NMBNZ0533_1819 2-methylcitrate synthase from Neisseria meningitidis NZ-05/33
36% identity, 93% coverage
NMB0431 citrate synthase from Neisseria meningitidis MC58
NMA2054 citrate synthase from Neisseria meningitidis Z2491
36% identity, 93% coverage
- Neisseria meningitidis Sibling Small Regulatory RNAs Connect Metabolism with Colonization by Controlling Propionate Use
Man-Bovenkerk, Journal of bacteriology 2023 (secret) - The Hfq regulon of Neisseria meningitidis
Huis, FEBS open bio 2017 - “...protein L21 Ribosomal proteins 22.9 5.2 NMB0430 prpB 2methylisocitrate lyase Propionate metabolism 9.1 20.4 28.2 NMB0431 prpC Methylcitrate synthase Propionate metabolism 3.8 1.6 23.9 56.7 NMB0432 tuaE f Anion (sulfite) transporter Membrane components & Propionate metabolism 5.9 3.9 NMB0435 ackA1 Acetate kinase Propionate metabolism 14.9 2.0...”
- A large genomic island allows Neisseria meningitidis to utilize propionic acid, with implications for colonization of the human nasopharynx
Catenazzi, Molecular microbiology 2014 - “...(Fig. 2 A), which supports growth and/or limits the toxicity of propionic acid. NMB0430 and NMB0431 are homologues of methylisocitrate lyase ( prpB ) (Grimek et al ., 2003 ) and methylcitrate synthase ( prpC ) (Horswill and Escalante-Semerena, 1999a ) respectively. NMB0433 and NMB0434 are...”
- “...gene cluster) is functional in N. meningitidis , we introduced an antibiotic resistance cassette into NMB0431 ( prpC , the putative methylcitrate synthase). prpC does not contribute to increased growth or propionic acid resistance in N. meningitidis grown in rich media (Fig. 3 A and B)....”
- Analysis of the regulated transcriptome of Neisseria meningitidis in human blood using a tiling array
Del, Journal of bacteriology 2012 - “...As an example, the three genes NMB0429, NMB0430, and NMB0431 were part of the same transcriptional unit containing both probes inside the genes and probes in...”
- “...of 34 amino acids (aa), while NMB0430 and NMB0431 code for PrpB (2-methylisocitrate lyase) and PrpC (methylcitrate synthase), respectively, and were all...”
- In the NadR regulon, adhesins and diverse meningococcal functions are regulated in response to signals in human saliva
Fagnocchi, Journal of bacteriology 2012 - “...3.1E06 9.6E04 ND ND ND ND NMB0431 2 Hypothetical protein, putative regulatory protein Putative carboxyphosphonoenolpyruvate phosphonomutase, prpB Methylcitrate...”
- Role of Hfq in iron-dependent and -independent gene regulation in Neisseria meningitidis
Mellin, Microbiology (Reading, England) 2010 - “...WT vs JM30 Low Upregulated genes Metabolism: NMB0430 prpB 2-Methylisocitrate lyase 20.35 15.32 1.18 1.85 NMB0431 pprC Methylcitrate synthase 23.87 19.69 1.19 1.82 NMB0435 ackA-1 Acetate kinase 13.65 10.26 1.75 2.43 NMB0546 adhP Alcohol dehydrogenase 1.71 3.09 1.15 1.09 NMB1572 acnB Aconitate hydratase 2.71 2.97 1.11...”
- Molecular characterization and identification of proteins regulated by Hfq in Neisseria meningitidis
Pannekoek, FEMS microbiology letters 2009 - “...NMB0430 PrpB W, C + Putative carboxyphosphonoenol pyruvate phosphonomutase Carbohydrate metabolism 31 714 5.0352 4a NMB0431 PrpC C + Methylcitrate synthase Carbohydrate metabolism 42 818 7.1147 NS NMB0546 AdhP W + Alcohol dehydrogenase (propanol preferring) Fermentation 36 547 5.8432 4b NMB0554 DnaK W + Molecular chaperone...”
- The majority of genes in the pathogenic Neisseria species are present in non-pathogenic Neisseria lactamica, including those designated as 'virulence genes'
Snyder, BMC genomics 2006 - “...NMB0227 Neisseria sicca NMB0229 Neisseria sicca NMB0293 Neisseria elongata, Neisseria macacae, Neisseria sicca, Neisseria subflava NMB0431 Neisseria flavescens, Neisseria macacae, Neisseria sicca, Neisseria subflava NMB0435 Neisseria flavescens, Neisseria macacae, Neisseria sicca, Neisseria subflava NMB0473 Neisseria flavescens NMB0474 Neisseria flavescens NMB0486* Neisseria sicca NMB0654 Neisseria polysaccharea, Neisseria...”
- MisR/MisS two-component regulon in Neisseria meningitidis
Tzeng, Infection and immunity 2008 - “...2.7 0.9 ND Metabolism NMA0274 NMA1556 NMA2052 NMA2054 Glycerate dehydrogenase; hprA Dihydrolipoamide dehydrogenase; lpdA Aconitate hydrotase I; acnA Citrate...”
- Comparative genomics identifies the genetic islands that distinguish Neisseria meningitidis, the agent of cerebrospinal meningitis, from other Neisseria species
Perrin, Infection and immunity 2002 - “...NMA2011, NMA2013 NMA2015 to NMA2017 NMA2050, NMA2052, and NMA2054 to NMA2055 Others NMA0020 to NMA0091 NMA0109 to NMA0305A NMA0431 NMA0586 NMA0668 to NMA0678 to...”
Synpcc7942_0612 2-methylcitrate synthase/citrate synthase II from Synechococcus elongatus PCC 7942
39% identity, 95% coverage
- Insufficient Acetyl-CoA Pool Restricts the Phototrophic Production of Organic Acids in Model Cyanobacteria
You, International journal of molecular sciences 2024 - “...rrnb P cpcb300 pepc ( Synpcc7942_2252 ) T rbcl , DOP62_03790:: P rbcl400 gltA ( Synpcc7942_0612 ) T rbcl P rbcl400 SBPase ( Synpcc7942_0505 ) T rbcl KanR, DOP62_11515::GmR P prbcl300M T rbcl yjjP ( POADD2 ) P cpcb200 yjjB ( POADD5 ) T lac 930...”
- “...Synechococcus elongatus PCC 7942-glgc::ppc::gltA 0XN glgc ( Synpcc7942_0603 ) ::ppc ( Synpcc7942_2252 ) ::gltA ( Synpcc7942_0612 ) 0XN 0.435 0.035 mg L 1 [ 58 ] Succinate Synechocystis sp. PCC 6803_sll1625 sll1625 472 mg L 1 [ 59 ] Succinate Synechococcus elongatus PCC 7942 sdhA (...”
- Metabolic engineering of a fast-growing cyanobacterium Synechococcus elongatus PCC 11801 for photoautotrophic production of succinic acid
Sengupta, Biotechnology for biofuels 2020 - “...-Synpcc7002_A2770, SsaD -P25526, and PEPC -Synpcc7942_2252. c Schematic showing homologous recombination of a construct of Synpcc7942_0612 ( gltA ), Synpcc7942_0505 ( SBPase ) at the glgA site. d Schematic showing homologous recombination of E. coli succinate transporter genes, POADD2 ( yjjP ) and POADD5 ( yjjB...”
- “...integrated b The locus tag/Uniprot identifiers as follows OgdA (Synpcc7002_A2770), SsaD (P25526), PEPC (Synpcc7942_2252), gltA (Synpcc7942_0612), Sbpase ( Synpcc7942_0505), yjjP (POADD2) and yjjB (POADD5) Xknockout/disrupted site genes overexpressed The genes overexpressed in PCC 11801 were chromosomally integrated along with antibiotic markers [ 35 ] at one...”
- The essential gene set of a photosynthetic organism
Rubin, Proceedings of the National Academy of Sciences of the United States of America 2015 - “...sdhB (SynPCC7942_1533), fumC (SynPCC7942_1007), gltA (SynPCC7942_0612), maeA (SynPCC7942_1297), and ppc (SynPCC7942_2252). Abbreviations for enzymes that are...”
- Circadian control of global gene expression by the cyanobacterial master regulator RpaA
Markson, Cell 2013 - “...to the abundance of the coding region of synpcc7942_0612 , which shows no enrichment for RpaA occupancy by ChIP-seq. See Extended Experimental Procedures for...”
- “...based on the abundance of the coding region of synpcc7942_0612 , a region showing no enrichment for RpaA binding in ChIP-Seq experiments; for both methods,...”
PRPC_CUPNE / Q937N9 2-methylcitrate synthase; 2-MCS; MCS; Citrate synthase; EC 2.3.3.5; EC 2.3.3.16 from Cupriavidus necator (Alcaligenes eutrophus) (Ralstonia eutropha) (see paper)
Q937N9 2-methylcitrate synthase (EC 2.3.3.5) from Cupriavidus metallidurans (see 2 papers)
35% identity, 94% coverage
- function: Involved in the catabolism of short chain fatty acids (SCFA) via the tricarboxylic acid (TCA)(acetyl degradation route) and via the 2-methylcitrate cycle I (propionate degradation route). Catalyzes the Claisen condensation of propionyl-CoA and oxaloacetate (OAA) to yield 2-methylcitrate (2-MC) and CoA. Also catalyzes the condensation of oxaloacetate with acetyl-CoA but with a lower efficiency.
catalytic activity: propanoyl-CoA + oxaloacetate + H2O = (2S,3S)-2-methylcitrate + CoA + H(+) (RHEA:23780)
catalytic activity: oxaloacetate + acetyl-CoA + H2O = citrate + CoA + H(+) (RHEA:16845)
subunit: Homodimer.
8bp7E / Q31QM5 Citrate-bound hexamer of synechococcus elongatus citrate synthase (see paper)
39% identity, 95% coverage
- Ligand: magnesium ion (8bp7E)
BCAM2702 2-methylcitrate synthase from Burkholderia cenocepacia J2315
36% identity, 93% coverage
- Proteomic profiling of Burkholderia cenocepacia clonal isolates with different virulence potential retrieved from a cystic fibrosis patient during chronic lung infection
Madeira, PloS one 2013 - “...0.5 0.8 0.012 262 Q1BNF8 BCAM1542 Putative aldehyde dehydrogenase 0.6 0.6 1.0 0.052 272 Q1BJI6 BCAM2702 prpC 2-methylcitrate synthase 1.3 1.7 1.7 0.055 276 A9AIN1 BCAL2074 ppsA Phosphoenolpyruvate synthase 0.5 0.5 0.5 0.016 Iron transport 68 B1YXQ3 BCAM0026 Putative siderophore-interacting protein 3.2 1.9 0.6 0.033 202...”
- Burkholderia cenocepacia differential gene expression during host-pathogen interactions and adaptation to the host environment
O'Grady, Frontiers in cellular and infection microbiology 2011 - “...1.86 7.82 BCAL1525 Flp type pilus subunit 11.75 12.95 BCAM2194 mmsA, methylmalonate-semialdehyde dehydrogenase 2.26 1.74 BCAM2702 prpC, 2-methylcitrate synthase 5.88 8.29 pBCA025 traF, putative conjugative transfer protein 7.10 344.86 pBCA045 traK, putative exported protein 12.43 33.26 pBCA053 Putative extracellular solute-binding protein 480.70 10.44 a Derived from...”
- “...aldehyde dehydrogenase 1.5 BCAM2700 prpF, putative membrane protein 1.8 BCAM2701 acnA, aconitate hydratase 1 2.7 BCAM2702 prpC, 2-methylcitrate synthase 5.9 BCAM2703 prpB, probable methylisocitrate lyase 2.8 METAL ION TRANSPORT OR METABOLISM BCAL0269 Oxidoreductase, molybdopterin-binding domain 1.6 BCAL0366 Nitroreductase family protein, metal ion oxidation 1.6 BCAL0580 Putative...”
1a59A / O34002 Cold-active citrate synthase (see paper)
39% identity, 95% coverage
- Ligand: coenzyme a (1a59A)
PRPC_ABDS2 / O34002 2-methylcitrate synthase; 2-MCS; MCS; Citrate synthase; EC 2.3.3.5; EC 2.3.3.16 from Antarctic bacterium DS2-3R (see 3 papers)
O34002 citrate (Si)-synthase (EC 2.3.3.1) from antarctic bacterium DS2-3R (see paper)
39% identity, 94% coverage
- function: Involved in the catabolism of short chain fatty acids (SCFA) via the tricarboxylic acid (TCA)(acetyl degradation route) and via the 2-methylcitrate cycle I (propionate degradation route). Catalyzes the Claisen condensation of propionyl-CoA and oxaloacetate (OAA) to yield 2-methylcitrate (2-MC) and CoA. Also catalyzes the condensation of oxaloacetate with acetyl-CoA but with a lower specificity.
catalytic activity: propanoyl-CoA + oxaloacetate + H2O = (2S,3S)-2-methylcitrate + CoA + H(+) (RHEA:23780)
catalytic activity: oxaloacetate + acetyl-CoA + H2O = citrate + CoA + H(+) (RHEA:16845)
subunit: Homodimer. - Protein signatures as potential surrogate biomarkers for stratification and prediction of treatment response in chronic myeloid leukemia patients.
Alaiya, International journal of oncology 2016 - “...precursor (EC 1.16.3.1) (Ferroxidase) Q61147 19 6.29E-05 5.77271 CML-PBP-No-MMR CML-PBP-TKI-N Ceruloplasmin precursor (EC 1.16.3.1) (Ferroxidase) O34002 1 0.000137 68.1783 CML-PBP-MMR CML-PBP-TKI-Y Citrate synthase (EC 4.1.3.7) P23528 1 6.64E-09 17.4873 CML-PBP-No-MMR CML-PBP-MMR Cofilin, non-muscle isoform (18 kDa phosphoprotein) Q03708 2 2.25E-07 Infinity CML-PBP-MMR CML-PBP-TKI-N Colicin E7 immunity...”
NGO1525 putative citrate synthase from Neisseria gonorrhoeae FA 1090
37% identity, 94% coverage
Avin_23220 2-methylcitrate synthase from Azotobacter vinelandii AvOP
35% identity, 94% coverage
BP1026B_II0230 2-methylcitrate synthase from Burkholderia pseudomallei 1026b
35% identity, 92% coverage
Pro0185 Citrate synthase from Prochlorococcus marinus str. SS120
Q7VE29 Citrate synthase from Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
38% identity, 92% coverage
Q8X694 2-methylcitrate synthase (EC 2.3.3.5) from Escherichia coli (see paper)
36% identity, 92% coverage
LMRG_01400 citrate synthase from Listeria monocytogenes 10403S
NP_465092 citrate synthase from Listeria monocytogenes EGD-e
lmo1567 highly similar to citrate synthase subunit II from Listeria monocytogenes EGD-e
38% identity, 96% coverage
- c-di-AMP modulates Listeria monocytogenes central metabolism to regulate growth, antibiotic resistance and osmoregulation
Whiteley, Molecular microbiology 2017 - “..., lmo1009 , LMRG_02109 ; pycA , lmo1072 , LMRG_00534 ; citZ , lmo1567 , LMRG_01400 ; citC , lmo1566 , LMRG_01401 ; citB , lmo1641 , LMRG_01325 . L. monocytogenes strain construction Strains were constructed by standard methods ( Reniere et al. , 2016 )....”
- CcpC-dependent regulation of citrate synthase gene expression in Listeria monocytogenes.
Mittal, Journal of bacteriology 2009 - GeneRIF: The citrate synthase (citZ) gene and isocitrate dehydrogenase (citC) gene was part of the same operon, and two promoters were shown to drive citZ expression.
- c-di-AMP modulates Listeria monocytogenes central metabolism to regulate growth, antibiotic resistance and osmoregulation
Whiteley, Molecular microbiology 2017 - “...; cbpB , lmo1009 , LMRG_02109 ; pycA , lmo1072 , LMRG_00534 ; citZ , lmo1567 , LMRG_01400 ; citC , lmo1566 , LMRG_01401 ; citB , lmo1641 , LMRG_01325 . L. monocytogenes strain construction Strains were constructed by standard methods ( Reniere et al. ,...”
- “...DP-L6540 transduced with lysate from DP-L6378 This study DP-L6401 citZhimar1 Transposon mutation in citZ (LMRG_01400143, lmo1567) ( Sureka et al. , 2014 ) DP-L6402 dacA-kanR citZhimar1 DP-L6401 transduced with lysate from DP-L6378 This study DP-L6533 dacA-kanR citZhimar1 tRNA Arg pPL2t -citZC DP-L6402 integrated with plasmid from...”
- Global transcriptional analysis of spontaneous sakacin P-resistant mutant strains of Listeria monocytogenes during growth on different sugars
Tessema, PloS one 2011 - “...1.6 10 5 lmo1566 ( citC ) isocitrate dehyrogenases 0.7 10 3 0.7 10 3 lmo1567 ( citZ ) citrate synthase subunit II 0.8 10 5 0.8 10 4 lmo1641 aconitate hydratases 0.8 10 4 0.9 10 5 lmo1957 ( fhuG ) ferrichrome ABC transporter (permease)...”
- Transcriptome analysis of alkali shock and alkali adaptation in Listeria monocytogenes 10403S
Giotis, Foodborne pathogens and disease 2010 - “...LMOf2365_2351 lmo2384 LMOf2365_1426 lmo1406 lmo0210 lmo2458 lmo1567 lmo1641 lmo2122 lmo1293 lmo1538 lmo1407 LMOf2365_1073 lmo1053 lmo2124 4.67 8.21 10.4...”
prpC / Q56063 2-methylcitrate synthase (EC 2.3.3.5) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
PRPC_SALTY / Q56063 2-methylcitrate synthase; 2-MCS; mcs; Citrate synthase; EC 2.3.3.5; EC 2.3.3.16 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
Q56063 2-methylcitrate synthase (EC 2.3.3.5) from Salmonella enterica subsp. enterica serovar Typhimurium (see paper)
STM0369 putative citrate synthase from Salmonella typhimurium LT2
NP_459364 putative citrate synthase from Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
36% identity, 92% coverage
YahS / b0333 2-methylcitrate synthase (EC 2.3.3.5) from Escherichia coli K-12 substr. MG1655 (see 11 papers)
prpC / P31660 2-methylcitrate synthase (EC 2.3.3.5) from Escherichia coli (strain K12) (see 9 papers)
PRPC_ECOLI / P31660 2-methylcitrate synthase; 2-MCS; MCS; (2S,3S)-2-methylcitrate synthase; Citrate synthase; EC 2.3.3.5; EC 2.3.3.16 from Escherichia coli (strain K12) (see 7 papers)
P31660 2-methylcitrate synthase (EC 2.3.3.5) from Escherichia coli (see 4 papers)
prpC / GB|AP_000985.1 2-methylcitrate synthase; EC 2.3.3.5 from Escherichia coli K12 (see 4 papers)
NP_414867 2-methylcitrate synthase from Escherichia coli str. K-12 substr. MG1655
b0333 2-methylcitrate synthase from Escherichia coli str. K-12 substr. MG1655
36% identity, 92% coverage
- function: Involved in the catabolism of short chain fatty acids (SCFA) via the tricarboxylic acid (TCA)(acetyl degradation route) and via the 2-methylcitrate cycle I (propionate degradation route). Catalyzes the Claisen condensation of propionyl-CoA and oxaloacetate (OAA) to yield 2-methylcitrate (2-MC) and CoA. Also catalyzes the condensation of oxaloacetate with acetyl-CoA to yield citrate but with a lower specificity.
catalytic activity: propanoyl-CoA + oxaloacetate + H2O = (2S,3S)-2-methylcitrate + CoA + H(+) (RHEA:23780)
catalytic activity: oxaloacetate + acetyl-CoA + H2O = citrate + CoA + H(+) (RHEA:16845)
subunit: Homodimer. - Identification of regions of the chromosome of Neisseria meningitidis and Neisseria gonorrhoeae which are specific to the pathogenic Neisseria species
Perrin, Infection and immunity 1999 - “...E. coli (P77541) CisZ (citrate synthase), E. coli (P31660) CisZ 8e-91 Coding AF169436 12 8e-28 Coding Coding AF169472 AF169455 35 Homology of ORF SpeA1...”
- Does Escherichia coli possess a second citrate synthase gene?
Patton, European journal of biochemistry 1993 (PubMed)- GeneRIF: N-terminus verified by Edman degradation on mature peptide
- Effect of Global Regulators RpoS and Cyclic-AMP/CRP on the Catabolome and Transcriptome of Escherichia coli K12 during Carbon- and Energy-Limited Growth
Franchini, PloS one 2015 - “...B -3.0 ** prpB b , f b0331 putative carboxyphosphoenolpyruvate mutase 17.0 15.8 prpC f b0333 citrate synthase, propionate metabolism 30.8 * 17.6 prpD f b0334 2-methyl citrate dehydratase 5.6 7.6 prpE f b0335 putative propionyl-CoA synthetase 5.9 yajO b0419 putative NAD(P)H-dependent xylose reductase 3.7 thiJ...”
- Gap-filling analysis of the iJO1366 Escherichia coli metabolic network reconstruction for discovery of metabolic functions
Orth, BMC systems biology 2012 - “...isozymes in the E. coli genome. One predicted isozyme has already been experimentally verified. prpC (b0333), which currently in the model is associated with MCITS (2-methylcitrate synthase), has been confirmed to also be an isozyme of gltA (b0720), catalyzing CS (citrate synthase) [ 34 , 35...”
- “...or alternate pathways Gene Putative Isozyme E-value purK (b0522) purT (b1849) 2.00E-12 gltA (b0720) prpC (b0333) 1.00E-41 aspC (b0928) tyrB (b4054) 4.00E-94 fabH (b1091) none identified pabC (b1096) ilvE (b3770) 7.00E-8 icd (b1136) dmlA (b1800) 3.00E-19 aldA (b1415) gabD (b2661) 1.00E-90 prr (b1444) 3.00E-80 feaB (b1385)...”
- More than just a metabolic regulator--elucidation and validation of new targets of PdhR in Escherichia coli
Göhler, BMC systems biology 2011 - “...0.915 2.065 b0085 murE $ 0.167 3.659 b2505 yfgH 0.820 0.425 b0822 ybiV 0.284 3.653 b0333 prpC 0.729 0.021 b2683 ygaH -0.077 3.628 b0331 prpB 0.713 0.024 b0436 tig -0.260 3.620 b3939 metB 0.677 2.667 b4290 fecB * 0.315 3.561 b3547 yhjX 0.668 2.931 b0083 ftsL...”
- Identification and mapping of self-assembling protein domains encoded by the Escherichia coli K-12 genome by use of lambda repressor fusions
Mariño-Ramírez, Journal of bacteriology 2004 - “...b3019 b2564 b4100 b1020 b3724 b0951 b4201 b0467 b0386 b0333 b1304 b1303 b3763 b3947 b0523 b4389 b0892 b1350 b0472 b1349 b2784 b3903 b0415 b0030 b1234 b3422...”
- Definition of the Escherichia coli MC4100 genome by use of a DNA array
Peters, Journal of bacteriology 2003 - “...b0271, b0349 cynS, cynT, yagC, yagE, yagT, ykfD,a b0331, b0333 eaeH b0323, b0324, b0325, b0350a yagA, yagB, yagJ, yagK, yagP, yagQ, yagR, yagS, yagU, yagV,...”
Q974S5 citrate synthase (unknown stereospecificity) (EC 2.3.3.16) from Sulfurisphaera tokodaii (see paper)
ST0587 373aa long hypothetical citrate synthase from Sulfolobus tokodaii str. 7
35% identity, 95% coverage
- Crystal Structures of Two Isozymes of Citrate Synthase from Sulfolobus tokodaii Strain 7
Murakami, Biochemistry research international 2016 - “...open reading frame (ORF) ST1805 is termed ST1805-CS, and the other, encoded by the ORF ST0587, is termed ST0587-CS. These two isozymes contain the consensus sequence of citrate synthase. Their amino acid sequences show 45% identity despite being derived from the same organism, implying that the...”
- “...Multiple alignment of sequences for microbial CSs. SS; CS from S. solfataricus , ST1805; ST1805-CS, ST0587; ST0587-CS, PF; CS from Pyrococcus furious , DS; CS from Arthrobacter Ds2-3R . The secondary structure elements were indicated and labeled as C to G and I to S for...”
- Identification and functional verification of archaeal-type phosphoenolpyruvate carboxylase, a missing link in archaeal central carbohydrate metabolism
Ettema, Journal of bacteriology 2004 - “...CTLf 2301 APE1713 PAE3585 PAE3586e PAE1689 SSO2589 ST1805, ST0587 CTS 0372 ETTEMA ET AL. Downloaded from http://jb.asm.org/ on February 12, 2017 by University...”
ECO26_0370 2-methylcitrate synthase from Escherichia coli O26:H11 str. 11368
36% identity, 92% coverage
CISY_SACS2 / P80148 Citrate synthase; EC 2.3.3.16 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
P80148 citrate synthase (unknown stereospecificity) (EC 2.3.3.16) from Saccharolobus solfataricus (see 4 papers)
WP_009989299 citrate synthase from Saccharolobus solfataricus
SSO2589 Citrate synthase from Sulfolobus solfataricus P2
37% identity, 96% coverage
- catalytic activity: oxaloacetate + acetyl-CoA + H2O = citrate + CoA + H(+) (RHEA:16845)
subunit: Homodimer - Two enzymes contribute to citrate production in the mitochondrion of Toxoplasma gondii
Lyu, The Journal of biological chemistry 2024 - “...archaebacteria: Thermotoga maritima MSB8 , AKE28092; Metallosphaera sedula DSM 5348 , ABP95678; Saccharolobus solfataricus , WP_009989299; Type I-like CS in parasite: T.gondii PrpC , EPR62453; N.caninum Liverpool PrpC , CEL66667; Eimeria mitis PrpC , XP_013356372; E.coli PrpC , MRF40902; Pseudomonas aeruginosa PrpC , WP_128671493; Type II...”
- Identification and functional verification of archaeal-type phosphoenolpyruvate carboxylase, a missing link in archaeal central carbohydrate metabolism
Ettema, Journal of bacteriology 2004 - “...SSO1254 APE0311 CTLf 2301 APE1713 PAE3585 PAE3586e PAE1689 SSO2589 ST1805, ST0587 CTS 0372 ETTEMA ET AL. Downloaded from http://jb.asm.org/ on February 12, 2017...”
Kole_1230 2-methylcitrate synthase/citrate synthase II from Thermotogales bacterium TBF 19.5.1
Kole_1230 citrate/2-methylcitrate synthase from Kosmotoga olearia TBF 19.5.1
37% identity, 94% coverage
FQU82_00160 2-methylcitrate synthase from Acinetobacter baumannii
34% identity, 93% coverage
- Transcriptomic analysis reveals the regulatory role of quorum sensing in the Acinetobacter baumannii ATCC 19606 via RNA-seq
Xiong, BMC microbiology 2022 - “...FQU82_03635, FQU82_01642 ( paaF ), FQU82_00192, FQU82_00189 ( mmsA ), FQU82_00193, FQU82_00159 ( prpB ), FQU82_00160 ( prpC ), and FQU82_00161 ( acnD ). In purine metabolism, 8 DEGs were downregulated, including FQU82_00576 ( ndk ), FQU82_02944 ( purL ), FQU82_02508 ( purH ), FQU82_02833 (...”
MA0249 citrate (si)-synthase from Methanosarcina acetivorans C2A
36% identity, 92% coverage
MIM_c31350 2-methylcitrate synthase from Advenella mimigardefordensis DPN7
34% identity, 95% coverage
- Proteomic analysis of organic sulfur compound utilisation in Advenella mimigardefordensis strain DPN7T
Meinert, PloS one 2017 - “...MIM_c31310, hypothetical protein; MIM_c31320, methylisocitrate lyase; MIM_c31330, putative AcnD-accessory protein PrpF; MIM_c31340, Fe/S-dependent 2-methylisocitrate dehydratase; MIM_c31350, 2-methylcitrate synthase; MIM_c31360, transcriptional regulator, XRE family ; MIM_c31370, transcriptional regulator, LysR family ; MIM_c31380, acyl-CoA transferase, family III; MIM_c31390, desulfinase Acd; MIM_c31400, 3-mercaptopropionate dioxygenase Mdo; MIM_c31410, alkylhydroperoxidase AhpD core...”
CGS9114_RS02690 bifunctional 2-methylcitrate synthase/citrate synthase from Corynebacterium glutamicum S9114
37% identity, 93% coverage
Sfum_2105 Citrate (Si)-synthase from Syntrophobacter fumaroxidans MPOB
36% identity, 90% coverage
- Complete genome sequence of Syntrophobacter fumaroxidans strain (MPOB(T))
Plugge, Standards in genomic sciences 2012 - “...part of a larger gene cluster that contains genes predicted for aconitase (Sfum_2106), citrate synthase (Sfum_2105), fumarase (Sfum_2102) and a ubiquinone prenyl transferase (Sfum_2101). These enzymes most likely function to supply biosynthetic intermediates. A 348 bp hypothetical protein (Sfum_2100) was also detected as part of this...”
Q8ZWP2 citrate synthase (unknown stereospecificity) (EC 2.3.3.16) from Pyrobaculum aerophilum (see paper)
PAE1689 citrate synthase from Pyrobaculum aerophilum str. IM2
37% identity, 87% coverage
BBD29_03720 bifunctional 2-methylcitrate synthase/citrate synthase from Corynebacterium glutamicum
36% identity, 93% coverage
PRPC2_CORGL / Q8NSL1 2-methylcitrate synthase 2; 2-MCS; MCS; Citrate synthase 2; CS; EC 2.3.3.5; EC 2.3.3.16 from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534) (see paper)
Q8NSL1 2-methylcitrate synthase (EC 2.3.3.5) from Corynebacterium glutamicum (see paper)
cg0762 methylcitrate synthase from Corynebacterium glutamicum ATCC 13032
NCgl0630 bifunctional 2-methylcitrate synthase/citrate synthase from Corynebacterium glutamicum ATCC 13032
36% identity, 93% coverage
- function: Involved in the catabolism of short chain fatty acids (SCFA) via the tricarboxylic acid (TCA)(acetyl degradation route) and via the 2-methylcitrate cycle I (propionate degradation route). Catalyzes the Claisen condensation of propionyl-CoA and oxaloacetate (OAA) to yield 2-methylcitrate (2-MC) and CoA. Also catalyzes the condensation of oxaloacetate with acetyl-CoA but with a lower specificity.
catalytic activity: propanoyl-CoA + oxaloacetate + H2O = (2S,3S)-2-methylcitrate + CoA + H(+) (RHEA:23780)
catalytic activity: oxaloacetate + acetyl-CoA + H2O = citrate + CoA + H(+) (RHEA:16845)
subunit: Homodimer. - Physiological Response of Corynebacterium glutamicum to Indole
Walter, Microorganisms 2020 - “...dehydratase, involved in propionate catabolism 2.38 cg0760 prpB2 methylisocitrate lyase, involved in propionate metabolism 2.53 cg0762 prpC2 methylcitrate synthase, involved in propionate catabolism 2.57 cg0796 prpD1 putative (2-methyl) citrate dehydratase 1.65 cg0797 prpB1 putative (methyl)isocitrate lyase 1.82 cg0798 prpC1 putative (methyl)citrate synthase 1.76 cg1279 putative secreted...”
- Comprehensive Analysis of C. glutamicum Anaplerotic Deletion Mutants Under Defined d-Glucose Conditions
Kappelmann, Frontiers in bioengineering and biotechnology 2020 - “...CAF20674 cg2560 aceA Isocitrate lyase 23.94 3.79e-44 CAF20673 cg2559 aceB Malate synthase 9.45 6.63e-41 CAF19365 cg0762 prpC2 2-methylcitrate synthase 6.49 4.73e-18 CAF19364 cg0760 prpB2 2-methylcitrate lyase 5.05 1.07e-21 CAF21548 cg1737 acn Aconitase 3.86 8.53e-37 CAF20774 cg3047 ackA Acetate kinase 3.75 7.39e-28 CAF21597 cg1792 whiA Putative transcriptional...”
- “...in C. glutamicum (Claes et al., 2002 ), namely 2-methylcitrate synthase (PrpC2) encoded by prpC2 (cg0762), 2-methylcitrate dehydratase (PrpD2) encoded by prpD2 (cg0759) and 2-methylcitrate lyase (PrpB2) encoded by prpB2 (cg0760) ( Table 3 ). Together with the activities of AK and PTA this cycle is...”
- Physiology and Transcriptional Analysis of (p)ppGpp-Related Regulatory Effects in Corynebacterium glutamicum
Ruwe, Frontiers in microbiology 2019 - “...0.145052 R A R cg3399 6.34 0 0.6 0.435792 cg3391 idhA1 5.90 7.57E91 4.84 1.22E24 cg0762 prpC2 5.76 0 1.58 A cg0760 prpB2 5.66 1.3E118 1.65 0.02341 A cg0012 ssuR 5.57 6.7E296 0.19 0.81453 R A cg3390 5.53 1.08E97 4.95 4.6E28 cg3280 5.49 0 4.67 0...”
- The copper-deprivation stimulon of Corynebacterium glutamicum comprises proteins for biogenesis of the actinobacterial cytochrome bc1-aa3 supercomplex
Morosov, The Journal of biological chemistry 2018 - “...ssb ctiP ftn ppmA tagA1 cg0133 cg0759 cg0760 cg0762 cg0899 cg0924 cg0952 cg0953 cg1293 cg1836 cg2403a cg2406a cg2546 cg2557 cg2836 cg2837 cg3022 cg3195 cg3335...”
- Deletion of the aconitase gene in Corynebacterium glutamicum causes strong selection pressure for secondary mutations inactivating citrate synthase
Baumgart, Journal of bacteriology 2011 - “...synthases were identified, PrpC1 (cg0798) and PrpC2 (cg0762), which also can catalyze the formation of citrate from oxaloacetate and acetylCoA (47)....”
- Citrate utilization by Corynebacterium glutamicum is controlled by the CitAB two-component system through positive regulation of the citrate transport genes citH and tctCBA
Brocker, Journal of bacteriology 2009 - “...cg2504 cg2181 cg2182 cg2183 cg2184 cg3151 cg0759 cg0760 cg0762 cg2938 cg2940 cg2836 cg2837 cg3047 cg3048 cg0961 cg2426 cg1612 cg2610 cg3107 cg3195 NCgl0067...”
- Functional genomics of pH homeostasis in Corynebacterium glutamicum revealed novel links between pH response, oxidative stress, iron homeostasis and methionine synthesis
Follmann, BMC genomics 2009 - “...lyase 2 0 -1.54 -0.80 - 3.2 0.9 -0.4 0.8 - - - - 35 cg0762 prpC2 2-methylcitrate synthase 2 0 -1.39 n.d. - 1.7 0.8 - - - - - - 36 cg0832 ABC-type transporter, permease components 5 -1.33 -0.40 - - - -0.4 -...”
- Two-component systems of Corynebacterium glutamicum: deletion analysis and involvement of the PhoS-PhoR system in the phosphate starvation response
Kocan, Journal of bacteriology 2006 - “...cg0470 cg0500 cg0569 cg0589 cg0590 cg0591 cg0759 cg0760 cg0762 cg0767 cg0768 cg0769 cg0771 Annotation c TWO-COMPONENT SIGNAL TRANSDUCTION IN C. GLUTAMICUM VOL....”
- The role of the transcriptional repressor CssR in Corynebacterium glutamicum in response to phenolic compounds
Zhang, Heliyon 2024 - “...1.31 1.93E-03 NCgl0609 D-methionine transport system ATP-binding protein 1.7 6.35E-04 NCgl0629 Methylisocitrate lyase 1.48 1.20E-06 NCgl0630 Citrate synthase 1.28 9.92E-05 NCgl0653 Hypothetical protein 4.56 2.06E-04 NCgl0664 2-methylcitrate dehydratase 1.25 6.60E-05 NCgl0704 Helicase 1.18 1.71E-03 NCgl0760 Hypothetical protein 1.16 7.42E-03 NCgl0822 Hypothetical ABC transport system ATP-binding protein...”
- Citrate utilization by Corynebacterium glutamicum is controlled by the CitAB two-component system through positive regulation of the citrate transport genes citH and tctCBA
Brocker, Journal of bacteriology 2009 - “...NCgl1915 NCgl1916 NCgl1917 NCgl1918 NCgl2131 NCgl0629 NCgl0630 NCgl2563 NCgl2565 NCgl2476 NCgl2477 NCgl2656 NCgl2657 NCgl0805 NCgl1368 NCgl2294 NCgl2709...”
- Two-component systems of Corynebacterium glutamicum: deletion analysis and involvement of the PhoS-PhoR system in the phosphate starvation response
Kocan, Journal of bacteriology 2006 - “...NCgl0465 NCgl0482 NCgl0483 NCgl0484 NCgl0628 NCgl0629 NCgl0630 NCgl0635 NCgl0636 NCgl0637 NCgl0639 cg0812 cg0921 cg0922 NCgl0678 NCgl0773 NCgl0774 cg0924...”
- Global expression profiling and physiological characterization of Corynebacterium glutamicum grown in the presence of L-valine
Lange, Applied and environmental microbiology 2003 - “...NCgl0629 Methylisocitrate lyase prpB2 (C. glutamicum) 1162e NCgl0630 Methyl citrate synthase prpC2 (C. glutamicum) 1204e NCgl0664 Methylaconitase prpD1 (C....”
Rru_A2319 2-methylcitrate synthase/citrate synthase II from Rhodospirillum rubrum ATCC 11170
34% identity, 93% coverage
- The metabolic pathways of carbon assimilation and polyhydroxyalkanoate production by Rhodospirillum rubrum in response to different atmospheric fermentation
Tang, PloS one 2024 - “...2.305 Rru_A2318 2-methylcitrate dehydratase 1.72E-49 5.708 4.62E-28 3.536 Rru_A2320 Phosphoenolpyruvate phosphomutase 6.41E-28 4.305 6.84E-11 1.857 Rru_A2319 2-methylcitrate synthase/Citrate synthase 4.49E-15 5.863 8.30E-11 2.855 ethylmalony-CoA (EMC) pathway Rru_A1201 Mesaconyl-CoA hydratase ND ND 0.00013 0.8 Rru_A3062 Methylmalonyl-CoA mutase 1.63E-08 1.338 1.21E-16 1.947 Rru_A3063 Crotonyl-CoA carboxylase/reductase 2.38E-08 1.800 3.65E-54...”
- Effects of Mixing Volatile Fatty Acids as Carbon Sources on Rhodospirillum rubrum Carbon Metabolism and Redox Balance Mechanisms
Cabecas, Microorganisms 2021 - “...when butyrate was simultaneously present in the medium. On the other hand, the citrate synthase (Rru_A2319) and the 2-methylcitrate dehydratase (Rru_A2318) were more abundant during the propionate assimilation phase under binary mixture conditions (Rru_A2318, fold change: 0.47; Rru_A2319, fold change: 0.53) ( Figure 3 ). The...”
- “...than when this VFA was provided as a sole carbon source (Rru_A2318, fold change: 0.61; Rru_A2319, fold change: 0.52). These enzymes are involved in the methylcitrate cycle, a metabolic pathway involved the assimilation of propionate [ 27 ]. The data, thus, indicate a potential change in...”
6abyA / A4YGX6 Crystal structure of citrate synthase (msed_1522) from metallosphaera sedula in complex with oxaloacetate (see paper)
35% identity, 96% coverage
- Ligands: oxaloacetate ion; acetyl coenzyme *a (6abyA)
A4YGX6 citrate synthase (unknown stereospecificity) (EC 2.3.3.16) from Metallosphaera sedula (see 2 papers)
35% identity, 96% coverage
Pden_1347 2-methylcitrate synthase/citrate synthase II from Paracoccus denitrificans PD1222
PDEN_RS06655 2-methylcitrate synthase from Paracoccus denitrificans
33% identity, 93% coverage
A5904_RS00855 citrate synthase from Acidithiobacillus caldus
36% identity, 93% coverage
- Study on the intracellular adaptative mechanism of Acidithiobacillus caldus MTH-04 to NaCl stress
Li, Microbial cell factories 2023 - “...for qRT-PCR verification of the transcriptome results, and the results showed that seven up-regulated genes (A5904_RS00855, RS00870, RS00355, RS00850, RS00845, RS07760, RS11110) and seven down-regulated genes (A5904_ RS02335, RS09435, RS09355, RS06535, RS01710, RS11185, RS11965) showed the same up- and down-regulation trends in both sets of experiments,...”
CTN_RS01940 citrate synthase/methylcitrate synthase from Thermotoga neapolitana DSM 4359
38% identity, 96% coverage
- CO2-Induced Transcriptional Reorganization: Molecular Basis of Capnophillic Lactic Fermentation in Thermotoga neapolitana
d'Ippolito, Frontiers in microbiology 2020 - “...the whole pathway. However, we found a significant upregulation of the expression of citrate synthase (CTN_RS01940) and isocitrate dehydrogenase (CTN_RS07145) ( Table 2 ). TABLE 2 List of DEGs related to carbon metabolism. Locus Fold change Description Glycolysis EmbdenMeyerhofParnas CTN_RS05065 2.18 Glucokinase CTN_RS01845 1.84 Glucose-6-phosphate isomerase...”
- “...CTN_RS08085 2.66 Transketolase. N-terminal subunit CTN_RS07710 5.74 Fructose-6-phosphate aldolase CTN_RS01915 NDE Fructose-6-phosphate aldolase Other genes CTN_RS01940 6.16 Citrate synthase CTN_RS07145 6.35 Isocitrate dehydrogenase CTN_RS09470 2.92 Fumarate hydratase class I CTN_RS00600 1.81 Fumarate hydratase. C-terminal subunit CTN_RS00605 2.54 Fumarate hydratase. N-terminal subunit CTN_RS01300 2.01 2-Oxoglutarate ferredoxin oxidoreductase....”
Tneu_0713 2-methylcitrate synthase/citrate synthase II from Thermoproteus neutrophilus V24Sta
37% identity, 88% coverage
GYA98_RS03820 citrate synthase/methylcitrate synthase from Bacillus velezensis
37% identity, 96% coverage
- Comparative transcriptome analysis reveals the biocontrol mechanism of Bacillus velezensis E68 against Fusarium graminearum DAOMC 180378, the causal agent of Fusarium head blight
Liang, PloS one 2023 - “...genes associated to these terms included the enzymes of the TCA cycle: 2 citrate synthases (GYA98_RS03820, 12240), aconitase (GYA98_RS08030), isocitrate dehydrogenase (GYA98_RS12235), 2-oxoglutarate dehydrogenase (GYA98_RS08685, 08690), succinate dehydrogenase (GYA98_RS11900, 11905), succinyl-CoA ligase (GYA98_RS07090, 07095) and fumarate dehydrogenase (GYA98_RS14210), as well as a citrate/malate transporter (GYA98_RS17095) (...”
XP_001447471 uncharacterized protein from Paramecium tetraurelia
38% identity, 96% coverage
- The 2-methylcitrate cycle is implicated in the detoxification of propionate in Toxoplasma gondii
Limenitakis, Molecular microbiology 2013 - “...NCLIV_033680 ETH_00021115 PF08_0031 cgd1_600 TP02_0450 Abbreviations Bb Pm Pt Tt PrpE XP_001460124 XP_001025576 PrpC XP_002787782 XP_001447471 XP_001023516 PrpD EER04808 XP_001457033 EAS06482 PrpB XP_002772756 XP_001459690 EAR89396 Acn BBOV_III011790 XP_002765934 XP_001451848 XP_001016756 BBOV_III005160 XP_002768944 XP_001431858 XP_001031896 Tg , Toxoplasma gondii ; Nc , Neospora caninum ; Et ,...”
Dpo_20c00240 citrate/2-methylcitrate synthase from Desulfotignum phosphitoxidans DSM 13687
35% identity, 90% coverage
MM1527 Citrate synthase from Methanosarcina mazei Goe1
35% identity, 92% coverage
XP_001023516 2-methylcitrate synthase/citrate synthase II from Tetrahymena thermophila SB210
36% identity, 96% coverage
XP_002787782 2-methylcitrate synthase, putative from Perkinsus marinus ATCC 50983
36% identity, 90% coverage
- The 2-methylcitrate cycle is implicated in the detoxification of propionate in Toxoplasma gondii
Limenitakis, Molecular microbiology 2013 - “...TP01_1050 NCLIV_033680 ETH_00021115 PF08_0031 cgd1_600 TP02_0450 Abbreviations Bb Pm Pt Tt PrpE XP_001460124 XP_001025576 PrpC XP_002787782 XP_001447471 XP_001023516 PrpD EER04808 XP_001457033 EAS06482 PrpB XP_002772756 XP_001459690 EAR89396 Acn BBOV_III011790 XP_002765934 XP_001451848 XP_001016756 BBOV_III005160 XP_002768944 XP_001431858 XP_001031896 Tg , Toxoplasma gondii ; Nc , Neospora caninum ; Et...”
V6E02_06885 citrate synthase from Thiobacter aerophilum
35% identity, 94% coverage
- <i>Thiobacter aerophilum</i> sp. nov., a Thermophilic, Obligately Chemolithoautotrophic, Sulfur-Oxidizing Bacterium from a Hot Spring and Proposal of <i>Thiobacteraceae</i> fam. nov
Dukat, Microorganisms 2024 - “...genome of the strain AK1 T encodes for the tricarboxylic acid cycle including citrate synthase (V6E02_06885), aconitate hydratase (V6E02_07900), isocitrate dehydrogenase (V6E02_11500), 2-oxoacid/ferredoxin oxidoreductases (V6E02_02945-V6E02_02960), succinyl-CoA synthetase (V6E02_03145 and V6E02_06280), succinate dehydrogenase (V6E02_00295-V6E02_00310), and class II fumarate hydratase (V6E02_07515). The gene encoding NAD-dependent malate dehydrogenase was...”
Q96ZM7 citrate synthase (unknown stereospecificity) (EC 2.3.3.16) from Sulfurisphaera tokodaii (see paper)
ST1805 378aa long hypothetical citrate synthase from Sulfolobus tokodaii str. 7
36% identity, 95% coverage
- Crystal Structures of Two Isozymes of Citrate Synthase from Sulfolobus tokodaii Strain 7
Murakami, Biochemistry research international 2016 - “...hypothetic CS [ 15 ]. One of them encoded by an open reading frame (ORF) ST1805 is termed ST1805-CS, and the other, encoded by the ORF ST0587, is termed ST0587-CS. These two isozymes contain the consensus sequence of citrate synthase. Their amino acid sequences show 45%...”
- “...Figure 1 Multiple alignment of sequences for microbial CSs. SS; CS from S. solfataricus , ST1805; ST1805-CS, ST0587; ST0587-CS, PF; CS from Pyrococcus furious , DS; CS from Arthrobacter Ds2-3R . The secondary structure elements were indicated and labeled as C to G and I to...”
- Identification and functional verification of archaeal-type phosphoenolpyruvate carboxylase, a missing link in archaeal central carbohydrate metabolism
Ettema, Journal of bacteriology 2004 - “...APE0311 CTLf 2301 APE1713 PAE3585 PAE3586e PAE1689 SSO2589 ST1805, ST0587 CTS 0372 ETTEMA ET AL. Downloaded from http://jb.asm.org/ on February 12, 2017 by...”
D7TMQ2 Citrate synthase from Vitis vinifera
34% identity, 70% coverage
CISY2_ARATH / Q9LXS6 Citrate synthase 2, peroxisomal; EC 2.3.3.16 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
NP_191434 citrate synthase 2 from Arabidopsis thaliana
AT3G58750 CSY2 (citrate synthase 2); citrate (SI)-synthase from Arabidopsis thaliana
34% identity, 70% coverage
- function: Peroxisomal citrate synthase required for the fatty acid respiration in seedlings, citrate being exported from peroxisomes into mitochondria during respiration of triacylglycerol (TAG). Indeed, complete respiration requires the transfer of carbon in the form of citrate from the peroxisome to the mitochondria.
catalytic activity: oxaloacetate + acetyl-CoA + H2O = citrate + CoA + H(+) (RHEA:16845) - Reduced peroxisomal citrate synthase activity increases substrate availability for polyhydroxyalkanoate biosynthesis in plant peroxisomes.
Tilbrook, Plant biotechnology journal 2014 (PubMed)- GeneRIF: Reduced peroxisomal citrate synthase activity in a peroxisomal polyhydroxyalkanoate (PHA)-producing Arabidopsis line increases PHA accumulation
- Proteome and Interactome Linked to Metabolism, Genetic Information Processing, and Abiotic Stress in Gametophytes of Two Woodferns
Ojosnegros, International journal of molecular sciences 2023 - “...Q9SGY2 ACLA-1 ATP-CITRATE SYNTHASE ALPHA CHAIN PROTEIN 1 46.8 10 2 4 0 Lipids 211149-128_1_ORF1 Q9LXS6 CSY2 CITRATE SYNTHASE 2 57.9 2 0 1 0 Amino acids 47558-369_4_ORF2 P46643 ASP1 ASPARTATE AMINOTRANSFERASE 51.5 5 0 5 0 Amino acids 72506-296_4_ORF1 Q94AR8 IIL1 3-ISOPROPYLMALATE DEHYDRATASE LARGE SUBUNIT...”
- Identification of bZIP Transcription Factors That Regulate the Development of Leaf Epidermal Cells in Arabidopsis thaliana by Single-Cell RNA Sequencing
Wu, International journal of molecular sciences 2024 - “...for some of the selected genes are as follows: AT5G08330 (TCP21), AT3G53800 (FES1B), AT3G54620 (bZIP25), AT3G58750 (CSY2), AT3G62420 (bZIP53), AT1G32550 (FDC2), AT3G11340 (UGT76B1), AT2G28110 (FRA8/IRX7), AT4G12970 (STOMAGEN/EPFL9), AT1G12920 (ERF1-2), AT2G42790 (CSY3), AT4G37925 (NDHM), AT2G32180 (PTAC18), AT1G69480 (PHO1-H10), AT1G70820, AT5G16030, AT2G29290, AT1G64355, AT5G02590, AT3G48020, AT4G18422, AT3G10530, AT2G35480,...”
- The versatility of plant organic acid metabolism in leaves is underpinned by mitochondrial malate-citrate exchange
Lee, The Plant cell 2021 - “...accession numbers: DIC1 (At2g22500), DIC2 (At4g25470), DIC3 (At5g09470), VDAC1 (At3g01280), SAND (At2g28390), EF-1 (At5g60390), CSY2 (At3g58750), CSY3 (At2g42790), ACLA-1 (At1g10670), ACLA-2 (At1g60810), ACLA-3 (At1g09430), ACLB-1 (At3g06650), ACLB-2 (At5g49460), SEN1 (At4g35770), WRKY53 (At2g28390), and SAG101 (At5g14930). All data generated or analyzed during this study are included in...”
- Multilevel Regulation of Peroxisomal Proteome by Post-Translational Modifications
Sandalio, International journal of molecular sciences 2019 - “...ac; nt; ps AT3G21720 isocitrate lyase na; nt AT3G58740 citrate synthase 1 ac; nt; ph AT3G58750 citrate synthase 2 ac; no; nt; ph; ps AT5G03860 malate synthase na; nt AT5G09660 peroxisomal NAD-malate dehydrogenase 2 ac; mo; no; nt; ph; ro; ps; ntyr LIPID METABOLISM- OXIDATION AT4G16760...”
- iTRAQ Mitoproteome Analysis Reveals Mechanisms of Programmed Cell Death in Arabidopsis thaliana Induced by Ochratoxin A
Wang, Toxins 2017 - “...(2.6) AT1G01090 Pyruvate dehydrogenase E1 alpha 2.4 (1.2) AT2G44350 ATP citrate synthase (ATCS) 3.8 (1.9) AT3G58750 Citrate synthase 2 (CSY2) 2.0 (1.0) AT2G17130 Isocitrate dehydrogenase subunit 2 (IDH2) 9.1 (3.2) AT3G09810 Isocitrate dehydrogenase, putative 5.2 (2.4) AT5G03290 Isocitrate dehydrogenase, putative 4.7 (2.4) AT4G26910 2-oxoacid dehydrogenase family...”
- Arabidopsis uses two gluconeogenic gateways for organic acids to fuel seedling establishment
Eastmond, Nature communications 2015 - “...0.47 0.02 0.14 PMDH2 At5g09660 0.12 0.45 0.63* 1.01 1.58 4.59 0.22 0.08 0.01 CSY2 At3g58750 0.13 0.98* 1.22* 0.82 7.45 6.83 0.32 0.00 0.00 CSY3 At2g42790 0.20 0.78* 0.92* 0.61 2.41 3.44 0.46 0.02 0.03 SDP2 At3g27820 0.46 0.36 0.45 1.45 1.12 1.58 0.09 0.18...”
- The circadian clock and defence signalling in plants
Sharma, Molecular plant pathology 2015 (secret) - Permeability of the peroxisomal membrane: lessons from the glyoxylate cycle
Kunze, Frontiers in physiology 2013 - “...synthase CIT1 YNR001C Mitochondrial CIT1 CaO19.11871 Mitochondrial CSY1 At3g58740 PTS2 CIT2 YCR005C Peroxisomal Q59ZZ5 CSY2 At3g58750 Peroxisomal CIT3 YPR001W Mitochondrial CSY3 At2g42790 Peroxisomal CSY4 At2g44350 Mitochondrial CSY5 At3g60100 Mitochondrial Aconitase ACO1 YLR304C Mitochondrial ACO1 CaO19.13742 MITO ACO1 At4g35830 Mitochondrial ACO2 YJL200C Mitochondrial ACO2 CaOrf19.6632 MITO ACO2...”
- Loss of the DNA methyltransferase MET1 Induces H3K9 hypermethylation at PcG target genes and redistribution of H3K27 trimethylation to transposons in Arabidopsis thaliana
Deleris, PLoS genetics 2012 - “...(At3g23130 and At2g42410, E-value 8e-26, 23% identity) and Citrate Synthase 1 and 2 (At3g58740 and At3g58750, E-value 1e-54, 54,3% identity) (shown in Figure S5C ). F. Small RNA analysis by Northern Blot. The existence of SUP-hybridizing siRNAs (2427 nt) in wild-type plants was confirmed by 2...”
- “...retrieved as dispersed repeats by Repeat Masker, CITRATE SYNTHASE 1 and 2 genes (At3g58740 and At3g58750). These examples suggest that in the genome-wide analysis shown in Figure 3E , the proportion of genes H3K9m2 hypermethylated in met1 that correspond to duplicated/paralogous/related genes is underestimated and must...”
- More
XP_013356372 Citrate synthase, related from Eimeria mitis
35% identity, 90% coverage
- Two enzymes contribute to citrate production in the mitochondrion of Toxoplasma gondii
Lyu, The Journal of biological chemistry 2024 - “...in parasite: T.gondii PrpC , EPR62453; N.caninum Liverpool PrpC , CEL66667; Eimeria mitis PrpC , XP_013356372; E.coli PrpC , MRF40902; Pseudomonas aeruginosa PrpC , WP_128671493; Type II CS in Gram-negative bacteria: E.coli GltA , KXL12831; Enterobacteriaceae GltA , WP_077128463; Shigella flexneri GltA , WP_154839470; Acetobacter aceti...”
LOC108986174 citrate synthase, glyoxysomal from Juglans regia
34% identity, 70% coverage
- Combined transcriptomic and metabolomic analysis of the mechanism by which <i>Bacillus velezensis</i> induces resistance to anthracnose in walnut
Wang, Frontiers in microbiology 2024 - “...DEM down D-ribulose-5-phosphate; scopolin; ,-trehalose; adenylosuccinic acid; D-sedoheptulose 7-phosphate; L-saccharopine Dihydromyricetin LOC108985009; LOC108989739; LOC108995063; LOC109007871; LOC108986174; LOC109004608; LOC108982574; LOC108979677; LOC109009364; LOC109002958; LOC108989204; LOC109001012; LOC109006536; LOC108994846; LOC109012505; LOC108979480; LOC109008648 LOC109006259; LOC109014012; LOC109008672; LOC109000742; LOC109012911; LOC109012913; LOC108998095; LOC109006298; LOC109006299; LOC109004165; LOC109004164; LOC109004162; LOC108980812; LOC108999688; LOC108988418; LOC109008231; LOC109010986 DEM...”
CISY_BACSU / P39119 Citrate synthase 1; Citrate synthase I; EC 2.3.3.16 from Bacillus subtilis (strain 168) (see paper)
BSU09440 citrate synthase I from Bacillus subtilis subsp. subtilis str. 168
35% identity, 97% coverage
- function: Might regulate the synthesis and function of enzymes involved in later enzymatic steps of Krebs cycle. Loss in activity results in sporulation defect.
catalytic activity: oxaloacetate + acetyl-CoA + H2O = citrate + CoA + H(+) (RHEA:16845)
subunit: Homodimer. - Identification of an RNA sponge that controls the RoxS riboregulator of central metabolism in Bacillus subtilis
Durand, Nucleic acids research 2021 - “...utilization GudB BSU22960 0.78 Glutamate dehydrogenase, trigger enzyme glutamate utilization, control of GltC activity CitA BSU09440 0.78 FsrA and RoxS Minor citrate synthase Unknown SucD BSU16100 0.76 RoxS Succinyl-CoA synthetase (alpha subunit) TCA Cycle YpbR/DynA BSU22030 0.73 RoxS Dynamin-like protein fusion of membranes YkrA BSU14550 0.62...”
- ecBSU1: A Genome-Scale Enzyme-Constrained Model of Bacillus subtilis Based on the ECMpy Workflow
Wu, Microorganisms 2023 - “...information was obtained by parsing the Interaction information in UniProt [ 17 ]. For example, P39119 is described in UniProt as a homodimer, so its subunit number is 2 (all corresponding information is listed in Table S1 ). The k cat values were obtained from the...”
- Bacterial cell cycle control by citrate synthase independent of enzymatic activity
Bergé, eLife 2020 - “...CitB (A0A0H3CCE2) and CitC (A0A0H3CD20) from C.crescentus , GltA (P0ABH7) from E. coli , CitA (P39119) and CitZ (P39120) from Bacillus subtilis . The histidine and aspartic acid catalytic residues are highlighted in red. Anarrow indicates the alanine or tryptophan substitution thatabolishes the catalytic activity of...”
2c6xA / P39119 Structure of bacillus subtilis citrate synthase
35% identity, 97% coverage
- Ligand: coenzyme a (2c6xA)
W8SRJ8 Citrate synthase from Nicotiana tabacum
33% identity, 70% coverage
citA / CAA74489.1 Citrate synthase I from Bacillus subtilis (see 3 papers)
35% identity, 97% coverage
LOC101258079 citrate synthase 3, peroxisomal-like from Solanum lycopersicum
34% identity, 70% coverage
CISY3_ARATH / Q9SJH7 Citrate synthase 3, peroxisomal; EC 2.3.3.16 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
NP_181807 citrate synthase 3 from Arabidopsis thaliana
AT2G42790 CSY3 (citrate synthase 3); citrate (SI)-synthase from Arabidopsis thaliana
33% identity, 71% coverage
- function: Peroxisomal citrate synthase required for the fatty acid respiration in seedlings, citrate being exported from peroxisomes into mitochondria during respiration of triacylglycerol (TAG). Indeed, complete respiration requires the transfer of carbon in the form of citrate from the peroxisome to the mitochondria.
catalytic activity: oxaloacetate + acetyl-CoA + H2O = citrate + CoA + H(+) (RHEA:16845) - Reduced peroxisomal citrate synthase activity increases substrate availability for polyhydroxyalkanoate biosynthesis in plant peroxisomes.
Tilbrook, Plant biotechnology journal 2014 (PubMed)- GeneRIF: Reduced peroxisomal citrate synthase activity in a peroxisomal polyhydroxyalkanoate (PHA)-producing Arabidopsis line increases PHA accumulation
- Identification of the Candidate Proteins Related to Oleic Acid Accumulation during Peanut (Arachis hypogaea L.) Seed Development through Comparative Proteome Analysis
Liu, International journal of molecular sciences 2018 - “...1.97 Q9SLA8 MOD1 fatty acid biosynthetic process Araip.10010555.1 1.83 Q9ZRA2 HGO lipid oxidation Araip.10003244.1 1.8 Q9SJH7 CSY3 lipid oxidation Araip.10039800.1 1.8 Q8RU07 EMB3147 fatty acid biosynthetic process Araip.10007633.1 1.79 Q06327 LOX1 fatty acid biosynthetic process Araip.10037915.1 1.68 Q9SQI8 LTA2 lipid biosynthetic process Araip.10038396.1 1.66 Q9FLW9 PKP2...”
- “...process Araip.10037854.1 1.44 Q42134 PAE2 lipid oxidation Araip.10032974.1 1.11 P42742 PBF1 lipid oxidation Araip.10005498.1 1.25 Q9SJH7 CSY3 lipid oxidation Araip.10020218.1 1.34 Q96329 ACX4 lipid oxidation Araip.10008534.1 1.46 Q94FY7 VTE1 fat-soluble vitamin metabolic process Araip.10030492.1 1.6 Q9T0A0 LACS4 fatty acid biosynthetic process Araip.10036992.1 1.64 Q9CAP8 LACS9 fatty...”
- Identification of bZIP Transcription Factors That Regulate the Development of Leaf Epidermal Cells in Arabidopsis thaliana by Single-Cell RNA Sequencing
Wu, International journal of molecular sciences 2024 - “...(bZIP25), AT3G58750 (CSY2), AT3G62420 (bZIP53), AT1G32550 (FDC2), AT3G11340 (UGT76B1), AT2G28110 (FRA8/IRX7), AT4G12970 (STOMAGEN/EPFL9), AT1G12920 (ERF1-2), AT2G42790 (CSY3), AT4G37925 (NDHM), AT2G32180 (PTAC18), AT1G69480 (PHO1-H10), AT1G70820, AT5G16030, AT2G29290, AT1G64355, AT5G02590, AT3G48020, AT4G18422, AT3G10530, AT2G35480, AT4G23620, and AT1G04945. ScRNA-seq data are available at the following web address: https://dataview.ncbi.nlm.nih.gov/object/PRJNA577177 ,...”
- The Integration of Data from Different Long-Read Sequencing Platforms Enhances Proteoform Characterization in Arabidopsis
García-Campa, Plants (Basel, Switzerland) 2023 - “...PROTEIN (AA3; AT3G48990), ACONITASE 1 (ACO1; AT4G35830), CATALASE 3 (CAT3; AT1G20620) and CYTRATE SYNTHASE (CSY3; AT2G42790) ( Supplemental Table S6 ). In addition, 93 Iso-Seq proteoforms from 76 protein families, included in AtRTD3, were associated with leaf senescence according to LSD 4.0 ( Supplemental Table S6...”
- Integrative Analysis of Transcriptomic and Proteomic Changes Related to Cytoplasmic Male Sterility in Spring Stem Mustard (Brassica juncea var. tumida Tsen et Lee)
Shen, International journal of molecular sciences 2022 - “...(ubiquinone) AT5G11770 UP DEG BjuA017841 K01647 citrate synthase - DOWN DEG novel.10587 K01647 citrate synthase AT2G42790 DOWN DEG BjuA012893 K01681 aconitate hydratase - DOWN DEG BjuB043684 K01681 aconitate hydratase AT4G26970 DOWN DEG BjuA015174 K00417 ubiquinol-cytochrome c reductase subunit 7 AT5G25450 DOWN DEG novel.1027 K01535 H +...”
- “...component - DOWN DEG BjuA017841 K01647 citrate synthase - DOWN DEG novel.10587 K01647 citrate synthase AT2G42790 DOWN DEG BjuA015968 K00026 malate dehydrogenase AT2G22780 DOWN DEG BjuA023314 K00234 succinate dehydrogenase AT2G18450 DOWN DEG BjuA026416 K00235 succinate dehydrogenase AT5G40650 DOWN DEG BjuB043684 K01681 aconitate hydratase AT4G26970 DOWN DEG...”
- The versatility of plant organic acid metabolism in leaves is underpinned by mitochondrial malate-citrate exchange
Lee, The Plant cell 2021 - “...DIC1 (At2g22500), DIC2 (At4g25470), DIC3 (At5g09470), VDAC1 (At3g01280), SAND (At2g28390), EF-1 (At5g60390), CSY2 (At3g58750), CSY3 (At2g42790), ACLA-1 (At1g10670), ACLA-2 (At1g60810), ACLA-3 (At1g09430), ACLB-1 (At3g06650), ACLB-2 (At5g49460), SEN1 (At4g35770), WRKY53 (At2g28390), and SAG101 (At5g14930). All data generated or analyzed during this study are included in this published...”
- Iron insufficiency in floral buds impairs pollen development by disrupting tapetum function
Huang, The Plant journal : for cell and molecular biology 2021 - “...acid degradation. We found that the transcript levels of ACX2 , KAT2 , and CSY3 (AT2G42790) were upregulated and MS2 and KAT5 (AT5G48880) were downregulated in Fedeficient anthers (Figure 4d,e ). Although KATs participate in fatty acid degradation, KAT5 is highly correlated with genes associated with...”
- Multilevel Regulation of Peroxisomal Proteome by Post-Translational Modifications
Sandalio, International journal of molecular sciences 2019 - “...AT1G54340 isocitrate dehydrogenase na; no; ro; ps AT2G22780 peroxisomal NAD-malate dehydrogenase 1 no; nt; ps AT2G42790 citrate synthase 3 ac; nt; ph; ub; ps AT3G16910 acyl-activating enzyme 7 ac; nt; ps AT3G21720 isocitrate lyase na; nt AT3G58740 citrate synthase 1 ac; nt; ph AT3G58750 citrate synthase...”
- A Conserved Carbon Starvation Response Underlies Bud Dormancy in Woody and Herbaceous Species
Tarancón, Frontiers in plant science 2017 - “...-AMYLASE 1 (BAM 1) II At5g65110 ACX2 III At5g55700 BAM 4 II-III At3g51840 ACX4 IV At2g42790 CITRATE SYNTHASE 3 II-III At1g68620 CARBOXYLESTERASE 6 II-III At2g47180 GALACTINOL SYNTHASE 1 (GOLS 1) II At1g48320 1,4-D1HYDROXY-2-NAPHTHOYL-COA III At1g56600 GOLS 2 II THIOESTERASE 1 At1g08940 PHOSPHOGLYCERATE MUTASE AT74H III At5g18640...”
- Transcriptome analysis of lentil (Lens culinaris Medikus) in response to seedling drought stress
Singh, BMC genomics 2017 - “...PCR validation Gene Primer Forward sequence Reverse sequence ALDH2B4 ALDH2 At3g48000 T17F15.130 DR_LC_01 TTCAACCAGGGGCAATGTTG ATGCGCGTGCCTTTGATTTC At2g42790 DR_LC_02 GCGCTTTCCATCTTTCATCCTG AGCTGCTGCAATTGTTGGTG MT2A At3g09390 F3L24.28 DR_LC_03 ACTTTTGTCTTGGGCGTTGC ATCCACACTTGCAAGCATCG SRG1 At1g17020 F20D23.28 F6I1.30 DR_LC_04 AACCCCTCCCAAATGCTTTC AATTCACAACTCCGCGATGC HSP17.6B At2g29500 F16P2.12 DR_LC_07 TTACGAGGAGGTTTAGGTTGCC AACACACCATTCTCCATCGC LEA4-5 At5g06760 DR_LC_12 ACACATCAGATGTCGGCTCTG TCCAGTGTTCCTTCCAATCGG SDH1-1 At5g66760 MSN2.16...”
- “...To validate the data, ten DEGs with log2fold change above 4 (ALDH2B4 ALDH2 At3g48000 T17F15.130, At2g42790, MT2A At3g09390 F3L24.28, SRG1 At1g17020 F20D23.28 F6I1.30, HSP17.6B At2g29500 F16P2.12, LEA4-5 At5g06760, SDH1-1 At5g66760 MSN2.16, SHMT1 STM At4g37930 F20D10.50, AFP3 At3g29575 MWE13.5 and At2g38470) were selected for RT- PCR analysis....”
- More
HFX_6170 citrate synthase/methylcitrate synthase from Haloferax mediterranei ATCC 33500
34% identity, 96% coverage
M1AD15 Citrate synthase from Solanum tuberosum
34% identity, 70% coverage
- Quantitative Proteomics of Potato Leaves Infected with Phytophthora infestans Provides Insights into Coordinated and Altered Protein Expression during Early and Late Disease Stages
Xiao, International journal of molecular sciences 2019 - “...connections, Q8LK04, FC = 1.20), involved in glycolysis and gluconeogenesis; citrate synthase protein (32 connections, M1AD15, FC = 1.38); histidine kinase/HSP90-like ATPase (32 connections, M1C5D1, FC = 1.21); thioredoxin (28 connections, M1CXH6, FC = 1.24); and glutathione peroxidase (20 connections, M1AWZ7, FC = 1.37). The late...”
XP_021800150 citrate synthase, glyoxysomal from Prunus avium
33% identity, 70% coverage
- Two enzymes contribute to citrate production in the mitochondrion of Toxoplasma gondii
Lyu, The Journal of biological chemistry 2024 - “...C.primus CS2 , QDZ25721;Peroxisomal CS in plants: A.thaliana CYS2 , OAP06763; Prunus avium CS2 , XP_021800150; Type I CS in archaebacteria: Thermotoga maritima MSB8 , AKE28092; Metallosphaera sedula DSM 5348 , ABP95678; Saccharolobus solfataricus , WP_009989299; Type I-like CS in parasite: T.gondii PrpC , EPR62453; N.caninum...”
B9F4F6 Citrate synthase from Oryza sativa subsp. japonica
34% identity, 75% coverage
- Proteomic Analysis of MeJa-Induced Defense Responses in Rice against Wounding
Bertini, International journal of molecular sciences 2019 - “...1.58 0.02 Q33E23 LOC_Os04g45970 Glutamate dehydrogenase 2, mitochondrial 1.33 0.024 Q40707 LOC_Os12g36880 PBZ1 1.26 0.01 B9F4F6 no code Citrate synthase 1.1 0.046 Q9ATR3 no code Glucanase 1.07 0.0012 Q0JG75 LOC_Os01g71190 Photosystem II reaction center Psb28 protein 1.09 0.002 C5MRM9 no code PsbA (Fragment) 1.09 0.019 A2YVX9...”
- “...0.013 Q6ZI95 LOC_Os08g41880 Purple acid phosphatase 1.6 0.036 Q0D3V1 no code Os07g0664300 protein 1.6 0.046 B9F4F6 no code Citrate synthase 1.6 0.024 S4U072 LOC_Os04g39150 OSJNBb0048E02.12 protein 1.0 0.023 Q10A54 LOC_Os10g05069 Alpha-mannosidase 2.3 0.047 ijms-20-02525-t004_Table 4 Table 4 Priming-regulated proteins. Log2 fold-change after MeJA+wounding, compared to wounding...”
HBZC1_01560 citrate/2-methylcitrate synthase from Helicobacter bizzozeronii CIII-1
37% identity, 97% coverage
6abwA / A4YDF6 Crystal structure of citrate synthase (msed_0281) from metallosphaera sedula in complex with acetyl-coa (see paper)
34% identity, 95% coverage
- Ligand: acetyl coenzyme *a (6abwA)
XP_001695571 uncharacterized protein from Chlamydomonas reinhardtii
32% identity, 73% coverage
PSLF89_893 citrate synthase from Piscirickettsia salmonis LF-89 = ATCC VR-1361
33% identity, 84% coverage
- Nutrient Scarcity in a New Defined Medium Reveals Metabolic Resistance to Antibiotics in the Fish Pathogen Piscirickettsia salmonis
Ortiz-Severín, Frontiers in microbiology 2021 - “...for all the reactions in the CMMAB medium, with the exception of citrate synthase (CS, PSLF89_893). Genes encoding enzymes of the synthesis of glutamine, an amino acid that can also fuel the TCA cycle, were also downregulated [glutaminase (GLUN, PSLF89_1767, and PSLF89_307), glutamine synthase (GLNS, PSLF89_179),...”
CISYC_DICDI / Q86AV6 Citrate synthase; EC 2.3.3.16 from Dictyostelium discoideum (Social amoeba) (see paper)
DDB_G0276965 citrate synthase from Dictyostelium discoideum AX4
33% identity, 71% coverage
- catalytic activity: oxaloacetate + acetyl-CoA + H2O = citrate + CoA + H(+) (RHEA:16845)
- Oryzines A & B, Maleidride Congeners from Aspergillus oryzae and Their Putative Biosynthesis
Wasil, Journal of fungi (Basel, Switzerland) 2018 - “...alpha, Aspergillus nidulans , Q5B7V0 (99%/46%) oryE XP_001827205 Citrate synthase Citrate synthase, Dictyostelium discoideum , Q86AV6 (97%/38%) oryF XP_001827204 Transporter Efflux pump VrtL, Penicillium aethiopicum , D7PHY8 (95%/39%) oryG XP_001827203 Alpha-ketoglut- -arate dependent dioxygenase Alpha-ketoglutarate-dependent sulfonate dioxygenase, Saccharomyces cerevisiae , Q12358 (88%/32%) oryH XP_023094065 Lactonase Gluconolactonase,...”
- Sociogenomics of self vs. non-self cooperation during development of Dictyostelium discoideum
Li, BMC genomics 2014 - “...E3 ubiquitin-protein ligase DDB_G0279681 n.a. Calcium-binding EF-hand domain-containing protein DDB_G0293704 n.a Seven transmembrane domain protein DDB_G0276965 gltA Citrate synthase DDB_G0290527 n.a. DDB_G0283091 n.a. FNIP repeat-containing protein DDB_G0289549 n.a. DDB_G0280865 n.a. DDB_G0293522 ponA Actin binding protein; ponticulin DDB_G0283089 n.a. DDB_G0275439 cad2 Putative adhesion molecule n.a, not applicable....”
cce_1900 citrate synthase from Cyanothece sp. ATCC 51142
33% identity, 95% coverage
- Analysis of Protein Complexes in the Unicellular Cyanobacterium Cyanothece ATCC 51142
Aryal, Journal of proteome research 2018 - “...pathway enzymes were also identified as complexes ( Figure 8B ). The citrate synthase; GltA (cce_1900), succinate dehydrogenase iron-sulfur protein subunit; SdhB (cce_3244), aconitase; AcnB (cce_3280), isocitrate dehydrogenase; Icsd (cce_3202), fumarate hydratase; FumC (cce_0396) and malate dehydrogenase; Mdh (cce_1850), and all but Icd, GabD and Mdh...”
- “...ribulose-phosphate 3-epimerase (cce_0798), TalA; transaldolase (cce_4687), TktA; transketolase (cce_4627), Pkt; phosphoketolase (cce_2225), GltA; citrate synthase (cce_1900), AcnB; aconitate hydratase 2 (cce_3280), Icd; isocitrate dehydrogenase (cce_3202), GabD; succinate-semialdehyde dehydrogenase (cce_4228), SucC; succi nyl-CoA synthetase (cce_2357), SdhB; succinate dehydrogenase iron-sulfur protein subunit (cce_3244), FumC; fumarate hydratase (cce_0396), Mdh;...”
I1KY39 Citrate synthase from Glycine max
32% identity, 70% coverage
Alvin_3052 citrate synthase I from Allochromatium vinosum DSM 180
34% identity, 84% coverage
Q7NZ52 Citrate synthase from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
33% identity, 83% coverage
- The influence of iron on the proteomic profile of Chromobacterium violaceum
Lima, BMC microbiology 2014 - “...metabolism Q7NZ60 2.01267122691591 0.3865 Malate dehydrogenase (Mdh) 76 Q7NY63 2.12401648386714 0.4413 Formate C-acetyltransferase (PflB) 139 Q7NZ52 2.52323856021444 0.1701 Citrate synthase (GtlA) 30 Q7NQM5 3.90695002871913 0.2484 Fumarate hydratase class II (AspA) 35 Q7NZ50 3.90695002871913 0.2054 Dihydrolipoamide succinyltransferase E2 component (SucB) 21 Proteins of unknown function Q7NZQ3 3.32090752441126...”
PMI0564 citrate synthase GltA from Proteus mirabilis HI4320
32% identity, 84% coverage
LT988_13005 citrate synthase from Thiocapsa bogorovii
34% identity, 84% coverage
CISYP_DICDI / Q8MQU6 Citrate synthase, peroxisomal; EC 2.3.3.16 from Dictyostelium discoideum (Social amoeba) (see paper)
30% identity, 74% coverage
- function: Peroxisomal protein involved in the cellular biosynthesis of citrate, and required primarily for cell growth and modulation of multicellular development.
catalytic activity: oxaloacetate + acetyl-CoA + H2O = citrate + CoA + H(+) (RHEA:16845)
MSMEG_5672 citrate synthase I from Mycobacterium smegmatis str. MC2 155
MSMEG_5672 citrate synthase from Mycolicibacterium smegmatis MC2 155
32% identity, 83% coverage
- The Benefits of Toxicity: M. smegmatis VapBC TA Module Is Induced by Tetracycline Exposure and Promotes Survival
Zamakhaev, Microorganisms 2023 - “...shunt (transketolase MSMEG_3103) of carbohydrate metabolism. At the same time, the abundance of citrate synthase MSMEG_5672, which is involved in glyoxylate shunt, was increased, whereas isocitrate lyase MSMEG_0911 was replaced by isoenzyme MSMEG_3706. A similar phenomenon was observed for gamma-aminobutyric acid shunt, i.e., succinate-semialdehyde dehydrogenase MSMEG_6452...”
- The Effect of Antimicrobial Photodynamic Inactivation on the Protein Profile of Dormant Mycolicibacterium smegmatis Containing Endogenous Porphyrins
Shashin, International journal of molecular sciences 2023 - “...the Krebs cycle, only two enzymes, aconitase ( MSMEG_3143 ) and citrate synthase I ( MSMEG_5672 ), were light-resistant. The majority of enzymes of the tricarboxylic acid cycle were found to be sensitive even to a small (5 min) light dose: isocitrate dehydrogenase ( MSMEG_1654 ),...”
- Surface proteome of "Mycobacterium avium subsp. hominissuis" during the early stages of macrophage infection
McNamara, Infection and immunity 2012 - “...MSMEG_1019 NA NA NA NA NA NA MSMEG_4323 MSMEG_5672 NA, not applicable. factor of infectious mycobacteria in both macrophage and animal models (56, 59),...”
- Gene Expression, Bacteria Viability and Survivability Following Spray Drying of Mycobacterium smegmatis
Lauten, Materials (Basel, Switzerland) 2010 - “...12.9 0.00 99% MSMEG_4262 ubiquinol-cytochrome c reductase iron-sulfur subunit 1.5 13.5 0.00 99% Energy Metabolism MSMEG_5672 citrate synthase I gltA 1.4 12.2 0.00 99% MSMEG_5415 enolase eno 1.8 12.2 0.00 100% MSMEG_3084 glyceraldehyde-3-phosphate dehydrogenase, type I gap 1.9 12.1 0.00 100% MSMEG_1654 isocitrate dehydrogenase, NADP-dependent 1.8...”
PL78_01430 citrate synthase from Yersinia entomophaga
33% identity, 84% coverage
AYM39_09355 citrate synthase from Methylomonas sp. DH-1
32% identity, 81% coverage
YPO1108 citrate synthase GltA from Yersinia pestis CO92
32% identity, 84% coverage
FAD_1100 citrate synthase from Ferroplasma acidiphilum
34% identity, 97% coverage
- Metabolic and evolutionary patterns in the extremely acidophilic archaeon Ferroplasma acidiphilum YT
Golyshina, Scientific reports 2017 - “...(FAD_1044); 4, NAD-binding malic enzyme/malate dehydrogenase (FAD_0703); 5, pyruvate: ferredoxin oxidoreductase (FAD_05670568); 6, citrate synthase (FAD_1100); 7, aconitate hydratase (FAD_0701); 8, isocitrate dehydrogenase (FAD_1632); 9,2-oxoglutarate:ferredoxin oxidoreductase (FAD_07120713); 10, succinyl-CoA synthetase (FAD_0709710); 11, succinate dehydrogenase (FAD_07140717); 12, fumarate hydratase (FAD_1630); 13, malate dehydrogenase (FAD_0718); 14, glutamate dehydrogenase...”
CISY1_ARATH / Q9LXS7 Citrate synthase 1, peroxisomal; EC 2.3.3.16 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
AT3G58740 CSY1 (CITRATE SYNTHASE 1); citrate (SI)-synthase/ transferase, transferring acyl groups, acyl groups converted into alkyl on transfer from Arabidopsis thaliana
31% identity, 75% coverage
- catalytic activity: oxaloacetate + acetyl-CoA + H2O = citrate + CoA + H(+) (RHEA:16845)
- Proteomic analysis on roots of Oenothera glazioviana under copper-stress conditions
Wang, Scientific reports 2017 - “...1 subunit beta Arabidopsis thaliana Q940P8 CCT2 2 0.21 1.7E-07 Carbohydrate and Energy Metabolism 19 Q9LXS7 Citrate synthase 1 Arabidopsis thaliana Q9LXS7 CSY1 2 3.17 8.9E-08 20 S8E148 Pyruvate dehydrogenase E1 component subunit alpha Genlisea aurea P52901 M569_08768 1 2.68 0.00052 21 P93819 Malate dehydrogenase, cytoplasmic...”
- Multilevel Regulation of Peroxisomal Proteome by Post-Translational Modifications
Sandalio, International journal of molecular sciences 2019 - “...ph; ub; ps AT3G16910 acyl-activating enzyme 7 ac; nt; ps AT3G21720 isocitrate lyase na; nt AT3G58740 citrate synthase 1 ac; nt; ph AT3G58750 citrate synthase 2 ac; no; nt; ph; ps AT5G03860 malate synthase na; nt AT5G09660 peroxisomal NAD-malate dehydrogenase 2 ac; mo; no; nt; ph;...”
- Permeability of the peroxisomal membrane: lessons from the glyoxylate cycle
Kunze, Frontiers in physiology 2013 - “...At5g43330 MDH7/MDHC3 AT5G56720 cMDH8/MDHP1 At3g47520 Chloroplast Citrate synthase CIT1 YNR001C Mitochondrial CIT1 CaO19.11871 Mitochondrial CSY1 At3g58740 PTS2 CIT2 YCR005C Peroxisomal Q59ZZ5 CSY2 At3g58750 Peroxisomal CIT3 YPR001W Mitochondrial CSY3 At2g42790 Peroxisomal CSY4 At2g44350 Mitochondrial CSY5 At3g60100 Mitochondrial Aconitase ACO1 YLR304C Mitochondrial ACO1 CaO19.13742 MITO ACO1 At4g35830 Mitochondrial...”
- Loss of the DNA methyltransferase MET1 Induces H3K9 hypermethylation at PcG target genes and redistribution of H3K27 trimethylation to transposons in Arabidopsis thaliana
Deleris, PLoS genetics 2012 - “...sequence similarity (At3g23130 and At2g42410, E-value 8e-26, 23% identity) and Citrate Synthase 1 and 2 (At3g58740 and At3g58750, E-value 1e-54, 54,3% identity) (shown in Figure S5C ). F. Small RNA analysis by Northern Blot. The existence of SUP-hybridizing siRNAs (2427 nt) in wild-type plants was confirmed...”
- “...were not retrieved as dispersed repeats by Repeat Masker, CITRATE SYNTHASE 1 and 2 genes (At3g58740 and At3g58750). These examples suggest that in the genome-wide analysis shown in Figure 3E , the proportion of genes H3K9m2 hypermethylated in met1 that correspond to duplicated/paralogous/related genes is underestimated...”
SMDB11_0505 citrate synthase from Serratia marcescens subsp. marcescens Db11
32% identity, 83% coverage
- Metabolic characterization of the chitinolytic bacterium Serratia marcescens using a genome-scale metabolic model
Yan, BMC bioinformatics 2019 - “...condition, those corresponding genes under glucose or glycerol condition are generally higher. In particular, the SMDB11_0505 gene, which encodes a citric acid synthase that converts acetyl-CoA to citric acid, may play the key role in determining the model prediction since under glucose or glycerol condition, the...”
- “...SMDB11_0505 mRNA level are both above the high threshold, while under N -acetylglucosamine condition, the SMDB11_0505 mRNA level is below the high threshold. Fig. 4 a Mapping of TCA cycle metabolism pathway genes mRNA level under N -acetylglucosamine, glucose or glycerol condition. b Intracellular citric acid...”
A0A170J878 Citrate synthase from Klebsiella quasipneumoniae
32% identity, 84% coverage
BHE81_19460, VK055_1802 citrate synthase from Klebsiella pneumoniae subsp. pneumoniae
32% identity, 84% coverage
- Transcriptome Analysis Reveals Cr(VI) Adaptation Mechanisms in Klebsiella sp. Strain AqSCr
Lara, Frontiers in microbiology 2021 - “...ORF Log 2 FC 2 Ct sulP (BHE81_25425) 4.57 3.81 rpoE (BHE81_12570) 1.61 2.85 gltA2 (BHE81_19460) 1.48 3.11 cybB (BHE81_07325) 1.88 14.88 cybC (BHE81_25140) 1.48 2.66 recN (BHE81_12780) 1.54 3.97 lpdA (BHE81_01240) 0.64 2.13 pflB (BHE81_12590) 5.21 0.03 cydB (BHE81_19515) 2.62 0.19 gltA1 (BHE81_03385) 4.35 0.03...”
- “...the differential transcription of genes involved in energy metabolism. We found that the gene gltA2 (BHE81_19460), encoding a citrate synthase, was upregulated with a log 2 FC = 1.48 (slightly below cutoff level) ( Supplementary Table 5 ), while its ortholog gltA1 (BHE81_03385) was downregulated with...”
- The Klebsiella pneumoniae citrate synthase gene, gltA, influences site specific fitness during infection
Vornhagen, PLoS pathogens 2019 - “...The molecular function of 17 (39.5%) of these genes has not been characterized. Three genes (VK055_1802, VK055_3697, and VK055_4417) enriched in the Lcn2 -/- background were previously identified as fitness factors during Kp lung infection [ 26 ] ( S1 Data , in italics). Five genes...”
- “...value less than 10 300 ( Table 1 , S1 Fig , S1 Data ). VK055_1802 is annotated as gltA , which encodes the citric acid cycle enzyme citrate (Si)-synthase [ 30 ]. Together, these data indicate that metabolism is critical for the interaction between KPPR1...”
DJ41_3568 citrate synthase from Acinetobacter baumannii ATCC 19606 = CIP 70.34 = JCM 6841
33% identity, 85% coverage
- Gene Expression of Ethanol and Acetate Metabolic Pathways in the Acinetobacter baumannii EmaSR Regulon
Huang, Microorganisms 2024 - “...and acetate metabolism. RNA-seq analysis further revealed that DJ41_568-571 , DJ41_2796 , DJ41_3218 , and DJ41_3568 regulatory gene clusters potentially participate in ethanol and acetate metabolism under the control of EmaSR. Methods: This study fused the EmaSR regulon promoter segments with reporter genes and used fluorescence...”
- “...pyruvate metabolic pathways ( Figure 1 ), including DJ41_568-571 , DJ41_2796 , DJ41_3218 , and DJ41_3568 [ 18 ]. Considering that the presence of ethanol, which is widely used in hospital environments as a disinfectant, has been reported to induce stress responses in A. baumannii that...”
- Metabolic Responses to Polymyxin Treatment in Acinetobacter baumannii ATCC 19606: Integrating Transcriptomics and Metabolomics with Genome-Scale Metabolic Modeling
Zhu, mSystems 2019 - “...most of the genes were upregulated after 2-mg/liter colistin treatment at 1h, including citrate synthase (DJ41_3568, 1.5-fold), aconitate hydratase (DJ41_1103, 2.7-fold), 2-oxoglutarate dehydrogenase (DJ41_3573 and DJ41_3574, 1.9 and 2.5-fold, respectively), succinyl-CoA ligase (DJ41_3576 and DJ41_3577, 2.1-fold for both), fumarate hydratase (DJ41_227, 2.6-fold), and malate dehydrogenase (DJ41_3006,...”
t2146 citrate synthase from Salmonella enterica subsp. enterica serovar Typhi Ty2
STY0773 citrate synthase from Salmonella enterica subsp. enterica serovar Typhi str. CT18
31% identity, 84% coverage
ACIAD2886 citrate synthase from Acinetobacter sp. ADP1
33% identity, 85% coverage
FZF21_03400 citrate synthase from Enterobacter sp. LU1
31% identity, 84% coverage
WP_077128463 citrate synthase from Escherichia coli
31% identity, 84% coverage
- Two enzymes contribute to citrate production in the mitochondrion of Toxoplasma gondii
Lyu, The Journal of biological chemistry 2024 - “..., WP_128671493; Type II CS in Gram-negative bacteria: E.coli GltA , KXL12831; Enterobacteriaceae GltA , WP_077128463; Shigella flexneri GltA , WP_154839470; Acetobacter aceti GltA , AGG68320; P.aeruginosa GltA , KXF33600; All sequence alignments were done with Clustal W. Phylogenetic analyses were performed with MEGA 11, using...”
IZU87_01890 citrate synthase from Cobetia sp. MC34
34% identity, 84% coverage
- High natural PHA production from acetate in Cobetia sp. MC34 and Cobetia marina DSM 4741T and in silico analyses of the genus specific PhaC2 polymerase variant
Christensen, Microbial cell factories 2021 - “...(EC 6.2.1.17) prpE + IZU87_15385* + BFX80_09760 + C8233_03035 Citrate synthase (EC 2.3.3.1) gltA + IZU87_01890 + BFX80_14605 + C8233_08570 Aconitate hydratase (EC 4.2.1.3) acnA/acnB +/+ IZU87_02425/IZU87_05790 +/+ BFX80_01545/BFX80_04820 +/+ C8233_12860/C8233_16190 Isocitrate lyase (EC 4.1.3.1) AceA + IZU87_14450 + BFX80_03560 + C8233_14950 Malate synthase (EC 2.3.3.9)...”
- “...it starts with conversion of acetyl-CoA to citrate by the citrate synthase GltA ( gltA, IZU87_01890) and via isocitrate by aconitate hydratases AcnA/B ( acnA/B, IZU87_02425/IZU87_05790) to glyoxylate by isocitrate lyase AceA ( aceA, IZU87_14450), before malate is formed by addition of an acetyl-CoA molecule by...”
SPC_0727 citrate synthase from Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
31% identity, 84% coverage
- Antibacterial Components and Modes of the Methanol-Phase Extract from Commelina communis Linn
Liu, Plants (Basel, Switzerland) 2023 - “...beta SPC_0734 0.227 Dihydrolipoamide acetyltransferase SPC_0736 0.25 Succinyl-CoA synthetase alpha subunit SPC_3569 0.296 Phosphoenolpyruvate carboxykinase SPC_0727 0.5 Citrate synthase SPC_0164 3.325 Dihydrolipoamide acetyltransferase SPC_0163 4.714 Pyruvate dehydrogenase E1 component Glycolysis/Gluconeogenesis SPC_3760 0.06 Aldehyde dehydrogenase B SPC_4566 0.241 Fructose-1-bisphosphatase SPC_4282 0.417 Glucose-6-phosphate isomerase SPC_1226 2.146 Glucose-specific PTS...”
STM0730 citrate synthase from Salmonella typhimurium LT2
31% identity, 84% coverage
ECs0745 citrate synthase from Escherichia coli O157:H7 str. Sakai
31% identity, 84% coverage
WP_154839470 citrate synthase from Shigella flexneri
31% identity, 84% coverage
- Two enzymes contribute to citrate production in the mitochondrion of Toxoplasma gondii
Lyu, The Journal of biological chemistry 2024 - “...in Gram-negative bacteria: E.coli GltA , KXL12831; Enterobacteriaceae GltA , WP_077128463; Shigella flexneri GltA , WP_154839470; Acetobacter aceti GltA , AGG68320; P.aeruginosa GltA , KXF33600; All sequence alignments were done with Clustal W. Phylogenetic analyses were performed with MEGA 11, using the maximum likelihood method based...”
JHW33_RS09960, WP_013576444 citrate synthase from Rahnella aceris
32% identity, 84% coverage
Z0873 citrate synthase from Escherichia coli O157:H7 EDL933
31% identity, 84% coverage
GluT / b0720 citrate synthase (EC 2.3.3.16; EC 2.3.3.1) from Escherichia coli K-12 substr. MG1655 (see 5 papers)
gltA / P0ABH7 citrate synthase (EC 2.3.3.3) from Escherichia coli (strain K12) (see 45 papers)
P0ABH7 citrate synthase (unknown stereospecificity) (EC 2.3.3.16) from Escherichia coli (see 2 papers)
NP_415248 citrate synthase from Escherichia coli str. K-12 substr. MG1655
UTI89_C0715 citrate synthase from Escherichia coli UTI89
b0720 citrate synthase from Escherichia coli str. K-12 substr. MG1655
c0796 Citrate synthase from Escherichia coli CFT073
31% identity, 84% coverage
- Functional Prediction of Biological Profile During Eutrophication in Marine Environment
Sbaoui, Bioinformatics and biology insights 2022 - “...phage-like element; putative endoglucanase with Zn-dependent exopeptidase domain GlpX P0A9C9 Fructose-1,6-bisphosphatase 1 class 2 GltA P0ABH7 Citrate synthase GpmB P0A7A2 Putative phosphoglyceromutase 2 GuaC P60560 GMP reductase HcaF Q47140 Putative 3-phenylpropionate/cinnamate dioxygenase subunit Hcp P75825 Hydroxylamine oxidoreductase-like protein HemH P23871 Ferrochelatase HemW P52062 Heme chaperone Hha...”
- Quantitative proteomic analysis reveals the influence of plantaricin BM-1 on metabolic pathways and peptidoglycan synthesis in Escherichia coli K12
Wang, PloS one 2020 - “...0.004198 AceE Enzyme; Energy metabolism, carbon: Pyruvate dehydrogenase Pyruvate dehydrogenase, decarboxylase component E1, thiamine triphosphate-binding P0ABH7 Citrate synthase -1.33 0.000768 GltA Enzyme; Energy metabolism, carbon: TCA cycle P61889 -1.24 0.000474 Mdh Malate dehydrogenase, NAD(P)-binding Enzyme; Energy metabolism, carbon: TCA cycle P25516 -2.10 0.000075 AcnA Aconitate hydratase...”
- Computational Proteome-Wide Study for the Prediction of Escherichia coli Protein Targeting in Host Cell Organelles and Their Implication in Development of Colon Cancer
Khan, ACS omega 2020 - “...the first step of GMP biosynthesis from IMP. Induced by low pH during anaerobic growth P0ABH7 citrate synthase 48014.99 6.21 peroxisome 87 involved in the tricarboxylic acid cycle and is allosterically inhibited by NADH P0AD96 Leu/Ile/Val-binding protein 36772.53 5.28 peroxisome 82 component of the leucine, isoleucine,...”
- Bacterial cell cycle control by citrate synthase independent of enzymatic activity
Bergé, eLife 2020 - “...active site of CitA (A0A0H3C985) with CitB (A0A0H3CCE2) and CitC (A0A0H3CD20) from C.crescentus , GltA (P0ABH7) from E. coli , CitA (P39119) and CitZ (P39120) from Bacillus subtilis . The histidine and aspartic acid catalytic residues are highlighted in red. Anarrow indicates the alanine or tryptophan...”
- Comprehensively Characterizing the Thioredoxin Interactome In Vivo Highlights the Central Role Played by This Ubiquitous Oxidoreductase in Redox Control
Arts, Molecular & cellular proteomics : MCP 2016 - “...P0A796 P0A799 P0AD61 P16095 P00350 P0A870 P0ABH7 P08200 P61889 P0A836 P0AGE9 Acetate kinase Lactaldehyde dehydrogenase Phosphopentomutase Deoxyribose-phosphate...”
- Mass spectrometry-based workflow for accurate quantification of Escherichia coli enzymes: how proteomics can play a key role in metabolic engineering
Trauchessec, Molecular & cellular proteomics : MCP 2014 - “...13.4 Uniprot accession number P0A9B2 P22259 P0A9G6 P0AC53 P0ABH7 P76558 P0A6V8 P00864 P33570 P0A6T1 P0AC41 P0A9P0 P61889 P0A836 P0A955 P62707 P0A858 P08200...”
- The Escherichia coli proteome: past, present, and future prospects
Han, Microbiology and molecular biology reviews : MMBR 2006 - “...GlpR P0ACL0 5.82/28,047.84 5.82/28,724 GltA P0ABH7 Glycerol-3-phosphate regulon repressor Citrate synthase 6.21/48,014.99 6.85/45,571 GltD P09832 Glutamate...”
- Engineered citrate synthase alters Acetate Accumulation in Escherichia coli.
Tovilla-Coutiño, Metabolic engineering 2020 (PubMed)- GeneRIF: Engineered citrate synthase alters Acetate Accumulation in Escherichia coli.
- Interaction of enzymes of the tricarboxylic acid cycle in Bacillus subtilis and Escherichia coli: a comparative study.
Jung, FEMS microbiology letters 2018 (PubMed)- GeneRIF: GltA, icd and mdh do not form a transcription unit, are scattered around the chromosome and are expressed from different promoters.
- Essential dynamics sampling study of adenylate kinase: comparison to citrate synthase and implication for the hinge and shear mechanisms of domain motions.
Snow, Proteins 2007 (PubMed)- GeneRIF: For citrate synthase the change in the number of interdomain contacting atoms upon closure remained largely the same, suggesting that the domain faces slide over each other during closure
- Amino acid sequence of Escherichia coli citrate synthase.
Bhayana, Biochemistry 1984 (PubMed)- GeneRIF: N-terminus verified by Edman degradation on mature peptide
- Glycosuria Alters Uropathogenic Escherichia coli Global Gene Expression and Virulence
Islam, mSphere 2022 - “...Malate synthase A TCA cycle UTI89_C0131 acnB 0.0358 1.5379* 1.4844* Bifunctional aconitate hydratase 2/2-methylisocitrate dehydratase UTI89_C0715 gltA 0.5582 1.3136* 1.8526* Citrate (Si)-synthase UTI89_C0717 sdhC 0.8090 4.4294* 5.2186* Succinate dehydrogenase cytochrome b556 subunit UTI89_C0718 sdhD 0.7750 4.8307* 5.5868* Succinate dehydrogenase membrane anchor subunit UTI89_C0719 sdhA 0.5266 4.2492*...”
- Automated characterization and analysis of expression compatibility between regulatory sequences and metabolic genes in Escherichia coli
Wen, Synthetic and systems biotechnology 2024 - “...Encoded enzyme b0008 talB Transaldolase b0114 aceE Pyruvate dehydrogenase E1 component b0420 dxs 1-Deoxy-d-xylulose-5-phosphate synthase b0720 gltA Citrate synthase b0754 aroG 3-Deoxy-7-phosphoheptulonate synthase b1136 icd Isocitrate dehydrogenase b1207 prs Ribose-phosphate diphosphokinase b1603 pntA Proton-translocating NAD(P)+transhydrogenase subunit alpha b1676 pykF Pyruvate kinase b1702 ppsA Phosphoenolpyruvate synthase b1761...”
- Engineering the transmission efficiency of the noncyclic glyoxylate pathway for fumarate production in Escherichia coli
Chen, Biotechnology for biofuels 2020 - “...using plasmids pTrcHisA- Af PYC as template [ 7 ]. Citrate synthase ( Ec CS, b0720), aconitase ( Ec ACN, b0118) and isocitrate lyase ( Ec ICL, b4015) genes from E. coli were amplified from plasmids pET28a- Ec CS, pET28a- Ec ACN, and pET28a- Ec ICL,...”
- Tracing the phylogenetic history of the Crl regulon through the Bacteria and Archaea genomes
Santos-Zavaleta, BMC genomics 2019 - “...glnH PQ IHF(+), NtrC(+/) + GEA, IMP [ 11 ] transport, amino acid transport gltA b0720 gltA ArcA(), CRP(+), IHF(+) + GEA, IMP [ 11 ] tricarboxylic acid cycle, metabolic process, cellular carbohydrate metabolic process grxB b1064 grxB + GEA, IMP [ 11 ] cell redox...”
- Effect of Global Regulators RpoS and Cyclic-AMP/CRP on the Catabolome and Transcriptome of Escherichia coli K12 during Carbon- and Energy-Limited Growth
Franchini, PloS one 2015 - “...xylose reductase 3.7 thiJ b0424 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis 6.1 gltA c , f , g b0720 citrate synthase 6.9 sdhD a , b , i b0722 succinate dehydrogenase, hydrophobic subunit -3.1 sdhB f , g , i b0724 succinate dehydrogenase, iron sulfur protein 7.2 sucA c...”
- Quantitative assessment of thermodynamic constraints on the solution space of genome-scale metabolic models
Hamilton, Biophysical journal 2013 - “...b0474 adk Lethal Lethal Nonlethal Lethal Nonlethal Lethal b0720 gltA Lethal Lethal Nonlethal Lethal Nonlethal Lethal b1207 dnaR Lethal Lethal Nonlethal Lethal...”
- Gap-filling analysis of the iJO1366 Escherichia coli metabolic network reconstruction for discovery of metabolic functions
Orth, BMC systems biology 2012 - “...associated with MCITS (2-methylcitrate synthase), has been confirmed to also be an isozyme of gltA (b0720), catalyzing CS (citrate synthase) [ 34 , 35 ]. Table 6 False negative model predictions that suggest changes to i JO1366 model GPRs Gene GPR correction hisH (b2023) not essential...”
- “...missing isozymes or alternate pathways Gene Putative Isozyme E-value purK (b0522) purT (b1849) 2.00E-12 gltA (b0720) prpC (b0333) 1.00E-41 aspC (b0928) tyrB (b4054) 4.00E-94 fabH (b1091) none identified pabC (b1096) ilvE (b3770) 7.00E-8 icd (b1136) dmlA (b1800) 3.00E-19 aldA (b1415) gabD (b2661) 1.00E-90 prr (b1444) 3.00E-80...”
- Accurate estimation of nucleic acids by amplification efficiency dependent PCR
Chatterjee, PloS one 2012 - “...(F=2) (A) Ace/Glu (F cal ) (B) Ace/Glu (Oh et al data [40] ) (C) b0720 citrate synthase 1.92 1.93 1.95 1.96 1.79 b1276 aconitate hydratase, acnA 1.90 1.80 4.66 1.06 1.25 b0118 aconitate hydratase, acnB 1.95 1.96 1.26 1.32 2.17 b1136 isocitrate dehydrogenase 1.80 1.87...”
- Control and benefits of CP4-57 prophage excision in Escherichia coli biofilms
Wang, The ISME journal 2009 - “...1.6 Alactoside transport and galactose taxis mglC b2148 1.7 Alactoside transport and galactose taxis gltA b0720 2.1 Citrate synthetase fumA b1612 1.6 Fumarate hydratase class I fumC b1611 1.7 SoxRS regulon, fumarate hydratase class II acs b4069 1.7 Acetyl-CoA synthetase aldA b1415 1.7 Aldehyde dehydrogenase, NAD...”
- More
- F1C fimbriae play an important role in biofilm formation and intestinal colonization by the Escherichia coli commensal strain Nissle 1917
Lasaro, Applied and environmental microbiology 2009 - “...J17B9 W28B11 W30G11 W21E1 mdh (c3991) gltA (c0796) sdhA (c0801) sdhC (c0798) Malate dehydrogenase Type II citrate synthase Succinate dehydrogenase flavoprotein...”
Atu5306 citrate synthase 2 from Agrobacterium tumefaciens str. C58 (Cereon)
35% identity, 97% coverage
DIP0785 type II citrate synthase from Corynebacterium diphtheriae NCTC 13129
31% identity, 83% coverage
- Development and use of a selectable, broad-host-range reporter transposon for identifying environmentally regulated promoters in bacteria
Spinler, FEMS microbiology letters 2009 - “...shift assays and DNAse I footprinting Predicted DtxR-binding regions from dip0163 , dip0620 , and dip0785 were amplified from their respective pCR2.1-clones ( Table 1 ) using the specific forward and reverse primers, DIP0163F/DIP0163R, DIP0620F2/DIP0620R2, and DIP0785F/DIP0785R, respectively ( Table S1 ). Mobility shift and DNase...”
- “...DtxR boxes are located within 300 bp upstream of the start codons for dip0620 and dip0785 , but dip0163 has no putative upstream DtxR box ( Table 2 ). In electrophoretic mobility shift assays, DtxR at 250 nM or greater retarded the mobility of the DNA...”
4jaeA / P0ABH7 Structural determination of the a50t:s279g:s280k:v281k:k282e:h283n variant of citrate synthase from e. Coli complexed with s- carboxymethyl-coa (see paper)
31% identity, 84% coverage
- Ligand: carboxymethyl coenzyme *a (4jaeA)
VDA_002504 citrate synthase from Photobacterium damselae subsp. damselae CIP 102761
31% identity, 84% coverage
Bphy_5205 citrate synthase from Paraburkholderia phymatum STM815
Bphy_5205 type II citrate synthase from Burkholderia phymatum STM815
32% identity, 84% coverage
BFX80_14605 citrate synthase from Cobetia marina
33% identity, 84% coverage
NMB0954 citrate synthase from Neisseria meningitidis MC58
31% identity, 84% coverage
- The Hfq regulon of Neisseria meningitidis
Huis, FEBS open bio 2017 - “...Isocitrate dehydrogenase TCA cycle 5.8 1.4 5.0 NMB0946 prx Peroxiredoxin 2 protein/glutaredoxin Oxidoreductases 1.4 2.0 NMB0954 gltA Citrate synthase TCA cycle 5.9 2.0 4.4 NMB1055 glyA Serine hydroxymethyltransferase Amino acid metabolism 6.5 3.0 5.4 NMB1306 zapE ATPase Cell division 2.6 2.8 NMB1378 iscR f Ironsulfur cluster...”
- Analysis of the regulated transcriptome of Neisseria meningitidis in human blood using a tiling array
Del, Journal of bacteriology 2012 - “...amplicon size, 380 bp. (2) cis-antisense RNA to NMB0954; expected amplicon size, 1,014 bp. (3) cis-antisense RNA to NMB0884; expected amplicon size, 650 bp....”
- “...upregulated, for example, the type II citrate synthase NMB0954 (Fig. 5B2). Among cases where only the antisense RNA was differentially expressed, an interesting...”
- The Hfq-dependent small noncoding RNA NrrF directly mediates Fur-dependent positive regulation of succinate dehydrogenase in Neisseria meningitidis
Metruccio, Journal of bacteriology 2009 - “...as well as the three downstream genes (nmb0952 to nmb0954) and sodB and fumB genes, which are further studied below. Furthermore, through S1 nuclease protection...”
- “...of the three downstream concomitant genes nmb0952 to nmb0954 span 4,952 bp. The downstream genes also were significantly regulated in the Fur mutant but...”
- Molecular characterization and identification of proteins regulated by Hfq in Neisseria meningitidis
Pannekoek, FEMS microbiology letters 2009 - “..., 4b NMB0946 W, OM + Peroxiredoxin 2 family protein Unknown 26 912 4.5382 4b NMB0954 GltA W, C + Type II citrate synthase Tricarboxylic acid cycle 48 121 6.7886 4a NMB1320 RplI W + 50S ribosomal protein L9 Ribosomal protein synthesis and modification 15 747...”
- The RNA chaperone Hfq is involved in stress response and virulence in Neisseria meningitidis and is a pleiotropic regulator of protein expression
Fantappiè, Infection and immunity 2009 - “...G Phosphoenolpyruvate synthase NMB1572 (acnB) NMB0920 (icd) NMB0954 (gltA) NMB431 (pprC) NMB0435 (ackA-1) NMB1388 (pgi-2) Aconitase hydratase 2 Isocitrate...”
- Reverse transcriptase-PCR differential display analysis of meningococcal transcripts during infection of human cells: up-regulation of priA and its role in intracellular replication
Talà, BMC microbiology 2008 - “...a thiol-disulfide oxidoreductase (DsbC) and the ATP-binding protein of an unknown ABC-type transporter (YbjZ), and NMB0954 (band n sequence) encoding GltA, the putative meningococcal citrate synthase (Fig. 1C ). Fig. 1C also shows the genes surrounding priA (NMB0551). Upstream from NMB0549 ( ybjZ ) a gene...”
Q5F873 Citrate synthase from Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
NGO0918 putative citrate synthase from Neisseria gonorrhoeae FA 1090
31% identity, 84% coverage
- Comparative Proteomics of Extended-Spectrum Cephalosporin-Resistant Neisseria gonorrhoeae Isolates Demonstrates Altered Protein Synthesis, Metabolism, Substance Transport, and Membrane Permeability
Diao, Frontiers in microbiology 2020 - “...Uncharacterized protein K 0 N 5.49 Q5F6V3 adhP Ethanolactive dehydrogenase/acetaldehydeactive reductase G 0 N 4.18 Q5F873 gltA Citrate synthase C 0 N 2.13 Q5F8G6 ilvD Dihydroxyacid dehydratase EG 0 N 1.73 Q5F9V2 NGO_0286 Uncharacterized protein S 0 N 1.75 A0A0M3GXE9 M736_02645 Conjugal transfer protein TrbB UW...”
- “...degradation (ngk00280) ( P < 0.05) ( Table 3 ). Six differentially expressed proteins (Q5F8G6, Q5F873, D6H9Y3, A0A1D3IB26, A0A1D3FF29, and D6HBH4) were involved in the three enrichment pathways, and all of the 6 proteins were downregulated. The function of Q5F873 (citrate synthase) was associated with energy...”
- Transcriptome-guided metabolic network analysis reveals rearrangements of carbon flux distribution in Neisseria gonorrhoeae during neutrophil co-culture
Potter, mSystems 2023 - “...GMP synthase guaA Gc cultured without PMNs NGO0214 Phosphate acetyltransferase pta NGO0562 Dihydrolipoamide dehydrogenase dldH NGO0918 Citrate synthase gltA NGO0925 Dihydrolipoamide dehydrogenase dldH NGO1082 Isocitrate dehydrogenase Idh NGO1231 Aconitate hydratase acnB NGO1325 Glycine dehydrogenase gcvP NGO1404 Glycine cleavage system protein H gcvH NGO1406 Glycine cleavage system...”
- Deep sequencing-based analysis of the anaerobic stimulon in Neisseria gonorrhoeae
Isabella, BMC genomics 2011 - “...KHG-KDPG bifunctional aldolase rpeC NGO0758 -4.8 -3.8 Ribulose-phosphate 3-epimerase fdx NGO0825 -5.3 -5.3 Ferredoxin cisY NGO0918 -3.6 -3.8 Type II citrate synthase Lrp sdhB NGO0920 -2.9 -4.2 Succinate dehydrogenase, iron-sulfur protein Lrp sdhA NGO0921 -3.7 -3.4 Succinate dehydrogenase, flavoprotein subunit Lrp sdhD NGO0922 -2.9 -3.4 Succinate...”
- Manganese regulation of virulence factors and oxidative stress resistance in Neisseria gonorrhoeae
Wu, Journal of proteomics 2010 - “...NGO1310 guanylate kinase / GMP kinase Gmk/kguA F 23412 NGO1668 glucose-6-phosphate isomerase pgi I 60308 NGO0918 citrate synthase cisY/gltA I 48110 NGO0912 succinyl-CoA synthetase, alpha subunit sucD I 30536 NGO1743 NADH dehydrogenase I chain I nuol I 18790 NGO0116 protein-export protein subunit SecB secB C 16317...”
ECHWAK_RS04305 citrate synthase from Ehrlichia chaffeensis str. Wakulla
33% identity, 86% coverage
Mvan_5022 citrate synthase I from Mycobacterium vanbaalenii PYR-1
31% identity, 83% coverage
- Dynamic Response of Mycobacterium vanbaalenii PYR-1 to BP Deepwater Horizon Crude Oil
Kim, Applied and environmental microbiology 2015 - “...the pace-making enzymes, citrate synthase (Mvan_5022 and Mvan_ 5025), isocitrate dehydrogenase (Mvan_3212), and -ketoglutarate dehydrogenase (Mvan_3964...”
- “...of upregulation of the first step, citrate synthase (Mvan_5022 and Mvan_5025), is intriguing, since Applied and Environmental Microbiology July 2015 Volume 81...”
cg0949 type II citrate synthase from Corynebacterium glutamicum ATCC 13032
P42457 Citrate synthase from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
NCgl0795 citrate synthase from Corynebacterium glutamicum ATCC 13032
31% identity, 82% coverage
- Thermo-adaptive evolution of Corynebacterium glutamicum reveals the regulatory functions of fasR and hrcA in heat tolerance
Li, Microbial cell factories 2024 - “...825,222 cg0892 Hypothetical protein 377CA P126H 870,566 cg0938 cspB Cold shock protein 158CG A53G 880,237 cg0949 gltA Citrate synthase 929GA R310H 1,383,111 cg1487 leuC 3-Isopropylmalate dehydratase large subunit 1205CT A402V 1,960,344 cg2066 Uncharacterized low-complexity protein 469AG S157G 1,995,801 cg2106 Hypothetical protein 331GA E111K 2,396,549 cg2516 hrcA...”
- Metabolic Engineering of Corynebacterium glutamicum for the Production of Flavonoids and Stilbenoids
Chu, Molecules (Basel, Switzerland) 2024 - “...downregulated by exchanging its native promoter to weaker promoter variants citrate synthase (CS) coding gltA (cg0949), sdhCAB (cg0445-47) operon encoding the succinate dehydrogenase complex ( SDH ) Naringenin 24 CGXII medium glucose [ 54 ] C. glutamicum Res1_C7 STS from Arachis hypogaea, 4CL from Petroselinum crispum,...”
- Droplet-Based Microfluidic High Throughput Screening of Corynebacterium glutamicum for Efficient Heterologous Protein Production and Secretion
Balasubramanian, Frontiers in bioengineering and biotechnology 2021 - “...Tauch, 2003 pECXKBGL pEC-XK99E vector containing the SD sequence of the tpiA gene, signal peptide Cg0949, and gene coding -glucosidase This work pECXCAmy pEC-XC99E vector containing the SD sequence of the tpiA gene, signal peptide Cg0949, and gene coding -amylase gene This work Media and Culture...”
- CRISPRi-Library-Guided Target Identification for Engineering Carotenoid Production by Corynebacterium glutamicum
Göttl, Microorganisms 2021 - “...plasmid carrying the gapA (cg1791) sgRNA This work pS_dCas9_ gltA pS_dCas9 plasmid carrying the gltA (cg0949) sgRNA This work pS_dCas9_ glxR pS_dCas9 plasmid carrying the glxR (cg0350) sgRNA This work pS_dCas9_ gnd pS_dCas9 plasmid carrying the gnd (cg1643) sgRNA This work pS_dCas9_ icd pS_dCas9 plasmid carrying...”
- Molecular Basis of Growth Inhibition by Acetate of an Adenylate Cyclase-Deficient Mutant of Corynebacterium glutamicum
Wolf, Frontiers in microbiology 2020 - “...position 877553 (A to G) located in the intergenic region of serC (cg0948) and gltA (cg0949) and one at position 1548741 (G to C) located in the intergenic region of gpt (cg1659) and cg1660 This study C. glutamicum cyaB _sup3 C. glutamicum cyaB suppressor mutant carrying...”
- “...but two point mutations in intergenic regions, one between promoters P1 and P2 of gltA (cg0949; citrate synthase) ( van Ooyen et al., 2011 ) at position 877553 (A to G, frequency 100%) and the other one 39 bp upstream of the start codon of cg1660,...”
- Tailoring Corynebacterium glutamicum towards increased malonyl-CoA availability for efficient synthesis of the plant pentaketide noreugenin
Milke, Microbial cell factories 2019 - “...Previously, reduction of the activity of citrate synthase (CS, encoded by the gene gltA , cg0949) to 10% compared to wild-typeCS activity by promoter replacement enabled increased plant polyphenol production with C. glutamicum due to a reduced flux of acetyl-CoA in the TCA cycle and thus...”
- Understanding the high L-valine production in Corynebacterium glutamicum VWB-1 using transcriptomics and proteomics
Zhang, Scientific reports 2018 - “...546.35 1167.85 NC 18 NCgl2521 cg2891 poxB Pyruvate dehydrogenase 5.34/61950.39 0.00 1770.94 8.9 21 NCgl0795 cg0949 gltA Titrate synthase 5.19/48929.41 2369.38 8992.08 4.4 23 NCgl2476 cg2836 sucD Succinyl-CoA synthetase subunit alpha 5.31/30259.75 1792.09 0.00 53.2 29 NCgl2167 cg2466 aceE Pyruvate dehydrogenase subunit E1 5.25/102826.2 6609.52 1984.81...”
- A New Strategy for Production of 5-Aminolevulinic Acid in Recombinant Corynebacterium glutamicum with High Yield
Yang, Applied and environmental microbiology 2016 - “...pEC-RS, pEC-GS, pEC-SC, and pEC-AT. The genes cg0949 (gltA), cg0766 (icd), cg1280-cg2421-cg0441 (odhA-sucBlpd), and cg1132 (coaA) were amplified by PCR with...”
- More
- A type III polyketide synthase cluster in the phylum Planctomycetota is involved in alkylresorcinol biosynthesis
Milke, Applied microbiology and biotechnology 2024 - “...members of the phylum Planctomycetota . The sequences of citrate synthase of C. glutamicum (Uniprot-ID P42457) and FtsZ of E. coli K12 (Uniprot-ID P0A9A6) were used as outgroup. Bootstrap values obtained after 1000 re-samplings were calculated, and values of>90% are indicated by open circles on the...”
- “...of type III PKS protein sequences. The sequences of citrate synthase of C. glutamicum (Uniprot-ID P42457) and FtsZ of E. coli K12 (Uniprot-ID P0A9A6) were used as outgroup. Bootstrap values obtained after 1000 re-sampling are shown on the nodes (in %). The Uniprot-ID of the used...”
- Accelerated Growth of Corynebacterium glutamicum by Up-Regulating Stress- Responsive Genes Based on Transcriptome Analysis of a Fast-Doubling Evolved Strain
Park, Journal of microbiology and biotechnology 2020 - “...sdhB Succinate: menaquinone oxidoreductase 5.72 NCgl0634 icd Isocitrate dehydrogenase 0.95 NCgl0659 pyc Pyruvate carboxylase 1.15 NCgl0795 gltA Citrate synthase 0.73 NCgl0967 fum Fumarase 1.44 NCgl1084 odhA(kgd) OGDHC (oxoglutarate dehydrogenase complex) E1o subunit 0.99 NCgl1482 acn Aconitase 3.95 NCgl1523 ppc PEP Carboxylase 0.72 NCgl1926 mqo Malate: quinone...”
- Recent Advances of L-ornithine Biosynthesis in Metabolically Engineered Corynebacterium glutamicum
Wu, Frontiers in bioengineering and biotechnology 2019 - “...gap ( NCgl0900 ), pyk ( NCgl2008 ), pyc ( NCgl0659 ), and glt ( NCgl0795 ) on L-ornithine production was investigated in the C. glutamicum AP strain. Modulating the expression of enzymes involved in the glycolytic pathway, such as Pgi, PfkA, GapA, and Pyk, improved...”
- Metabolome analysis-based design and engineering of a metabolic pathway in Corynebacterium glutamicum to match rates of simultaneous utilization of D-glucose and L-arabinose
Kawaguchi, Microbial cell factories 2018 - “...pCH gltA Km r ; pCH with PCR fragment containing C. glutamicum ATCC31831 gltA gene (NCgl0795) encoding citrate synthase pCH pfk Km r ; pCH with PCR fragment containing C. glutamicum ATCC31831 pfk gene (NCgl1202) encoding phosphofructokinase pCH pyk Km r ; pCH with PCR fragment...”
- “...E. coli C. glutamicum shuttle vector pCH [ 40 ] was used to overexpress gltA (NCgl0795), pfk (NCgl1202), and pyk (NCgl2008) genes encoding C. glutamicum ATCC 13032 citrate synthase, 6-phosphofructokinase, and pyruvate kinase, respectively. DNA fragments encoding the gltA and pyk genes were amplified by PCR...”
- Understanding the high L-valine production in Corynebacterium glutamicum VWB-1 using transcriptomics and proteomics
Zhang, Scientific reports 2018 - “...5.37/74679.26 546.35 1167.85 NC 18 NCgl2521 cg2891 poxB Pyruvate dehydrogenase 5.34/61950.39 0.00 1770.94 8.9 21 NCgl0795 cg0949 gltA Titrate synthase 5.19/48929.41 2369.38 8992.08 4.4 23 NCgl2476 cg2836 sucD Succinyl-CoA synthetase subunit alpha 5.31/30259.75 1792.09 0.00 53.2 29 NCgl2167 cg2466 aceE Pyruvate dehydrogenase subunit E1 5.25/102826.2 6609.52...”
- Altered acetylation and succinylation profiles in Corynebacterium glutamicum in response to conditions inducing glutamate overproduction
Mizuno, MicrobiologyOpen 2016 - “...(NCgl1512); Tal, transaldolase (NCgl1513); AceE, pyruvate dehydrogenase subunit E1 (NCgl2167); GltA, type II citrate synthase (NCgl0795); Acn, aconitate hydratase (NCgl1482); Icd, monomeric isocitrate dehydrogenase (NADP + ) (NCgl0634); Kgd, alphaketoglutarate decarboxylase (NCgl1084); AceF, dihydrolipoamide acetyltransferase (NCgl2126); Lpd, dihydrolipoamide dehydrogenase (NCgl0355); SdhA, succinate dehydrogenase flavoprotein subunit (NCgl0360);...”
- Adaptation of Corynebacterium glutamicum to ammonium limitation: a global analysis using transcriptome and proteome techniques
Silberbach, Applied and environmental microbiology 2005 - “...NCgl2167 NCgl1482 NCgl0935 NCgl2673 NCgl2297 NCgl2521 NCgl1526 NCgl0795 NCgl2008 NCgl0954 NCgl0666 NCgl2582 NCgl2167 NCgl2008 cg1776 cg2466 cg2466 cg2891 cg1791...”
ECHLIB_RS04290, ECHWP_RS04265, ECH_RS00505 citrate synthase from Ehrlichia chaffeensis str. West Paces
33% identity, 86% coverage
- Comparative Genomics of the Zoonotic Pathogen Ehrlichia chaffeensis Reveals Candidate Type IV Effectors and Putative Host Cell Targets
Noroy, Frontiers in cellular and infection microbiology 2016 - “...0 0 0 0 0 0 0 0 1 0 1 0 1 IBRs ECH_RS00505 ECHLIB_RS04290 ECHWAK_RS04305 ECHWP_RS04265 Citrate (Si)-synthase 73 1 0 0 0 0 0 0 0 0 0 1 0 1 1 GDRs ECH RS03555 ECHLIB RS01255 ECHWAK RS01260 ECHWP RS03425 Hypothetica l...”
- “...adhesion, and growth (Table S2 ). Finally, four other cytoplasmic E. chaffeensis T4Es (ECHLIB_RS01605, ECHLIB_RS02855, ECHLIB_RS04290, ECHLIB_RS01280) were predicted to interact with one or two proteins involved in reticulum catabolic processes (HERP2), protein folding (SACS), cytoskeleton organization (INF2) and transcriptional repression (ARI4B), or in immune response...”
- “...0 0 0 0 0 0 1 0 1 0 1 IBRs ECH_RS00505 ECHLIB_RS04290 ECHWAK_RS04305 ECHWP_RS04265 Citrate (Si)-synthase 73 1 0 0 0 0 0 0 0 0 0 1 0 1 1 GDRs ECH RS03555 ECHLIB RS01255 ECHWAK RS01260 ECHWP RS03425 Hypothetica l protein 72...”
- “...1 0 0 0 0 0 0 0 0 1 0 1 0 1 IBRs ECH_RS00505 ECHLIB_RS04290 ECHWAK_RS04305 ECHWP_RS04265 Citrate (Si)-synthase 73 1 0 0 0 0 0 0 0 0 0 1 0 1 1 GDRs ECH RS03555 ECHLIB RS01255 ECHWAK RS01260 ECHWP RS03425 Hypothetica...”
VC2092 citrate synthase from Vibrio cholerae O1 biovar eltor str. N16961
31% identity, 84% coverage
- A novel phase variant of the cholera pathogen shows stress-adaptive cryptic transcriptomic signatures
Lambert, BMC genomics 2016 - “...and GB, was similarly regulated (Additional file 11 : Table S7). Other TCA/GB genes, including VC2092 ( gltA ), VC1338 ( acnA ), VC0604 ( acnB ) and VC1141 ( icd ), or TCA only genes VC2086 ( sucB ) and VC2085 ( sucC ), were...”
- A communal bacterial adhesin anchors biofilm and bystander cells to surfaces
Absalon, PLoS pathogens 2011 - “...of 18 proteins could not be predicted with certainty ( Table 2 ). Citrate synthase (VC2092) and a putative acetyl CoA synthase homolog (VCA0139), which were predicted to have transmembrane domains, are most likely in the inner membrane. No additional inner membrane proteins were identified. NusA...”
- Characterization of Vibrio cholerae RyhB: the RyhB regulon and role of ryhB in biofilm formation
Mey, Infection and immunity 2005 - “...synthasec ...................................................................................................................VC2092 (3.3) Ubiquinol-cytochrome c...”
WP_015439438 citrate synthase from Corynebacterium glutamicum K051
31% identity, 82% coverage
- Two-Component-System RspA1/A2-Dependent Regulation on Primary Metabolism in Streptomyces albus A30 Cultivated With Glutamate as the Sole Nitrogen Source
Zhang, Frontiers in microbiology 2020 - “...Saccharopolyspora erythraea with CSs from Escherichia coli (GltA,YP_006128080), Bacillus subtilis (CitZ,WP_003223555; CitA,WP_003244745), Corynebacterium glutamicum (GltA, WP_015439438), Saccharomyces cerevisiae (CIT1, EDN62808; CIT2, EDN62126; CIT3, EDN61138), and Streptomyces coelicolor (CitA, CAB66275). The phylogenic tree was generated using the Phylogeny.fr platform ( Dereeper et al., 2008 ). (B) The...”
WP_000763930 citrate synthase from Vibrio cholerae O1 str. 2011EL-1137
31% identity, 84% coverage
BBD29_04605 citrate synthase from Corynebacterium glutamicum
31% identity, 82% coverage
TASI_1018 citrate synthase from Taylorella asinigenitalis MCE3
32% identity, 82% coverage
- Genomic characterization of the Taylorella genus
Hébert, PloS one 2012 - “...participating in major reactions are numbered thus: 1. pyruvate dehydrogenase (TASI_0903, TEQUI_1387); 2. Citrate synthase (TASI_1018, TEQUI_1584); 3. aconitase (TASI_0659, TEQUI_1215); 4. isocitrate dehydrogenase (TASI_0396, TEQUI_1024); 5. -ketoglutarate dehydrogenase (TASI_0983, TEQUI_1309); 6. Succinyl-CoA synthetase (TASI_0746, TEQUI_1545); 7. succinate dehydrogenase (TASI_1020, TEQUI_1586); 8. fumarate hydratase (TASI_0400, TEQUI_1028);...”
TGME49_003110, TGME49_203110 citrate synthase, putative from Toxoplasma gondii ME49
31% identity, 71% coverage
- Genomic and Proteomic Evidence for the Presence of a Peroxisome in the Apicomplexan Parasite Toxoplasma gondii and Other Coccidia
Moog, Genome biology and evolution 2017 - “...). Interestingly, T. gondii contains at least two putative citrate synthase isoenzymes of which one (TGME49_203110) is an oocyst/sporozoite-specific protein ( Possenti et al. 2013 ). By analyzing the protein primary sequence for the presence of potential targeting signals, we identified a predicted PTS2 (RLSVINAHL) in...”
- “...al. 2013 ). Peroxisomal acetyl-CoA might be converted to citrate via a putative citrate synthase (TGME49_203110), which according to our results contains a putative PTS2, prior export into the cytoplasm and further transport to the mitochondrion ( fig. 2 ). Interestingly, this enzyme is an oocyst/sporozoite-specific...”
- BCKDH: the missing link in apicomplexan mitochondrial metabolism is required for full virulence of Toxoplasma gondii and Plasmodium berghei
Oppenheim, PLoS pathogens 2014 - “...to citrate in the cytosol via the ATP-citrate lyase or the second putative citrate lyase (TGME49_203110, www.toxodb.org ) present in the genome of T. gondii . Interestingly, significant labelling of glycolytic intermediates and hexose-phosphate was detected in 13 C-glutamine-fed Tg e1a_ko tachyzoites, which was absent in...”
- Global proteomic analysis of the oocyst/sporozoite of Toxoplasma gondii reveals commitment to a host-independent lifestyle
Possenti, BMC genomics 2013 - “...4 3 2.16E-07 TGME49_071210 4-alpha-glucanotransferase, putative 2.4.1.25/3.2.1.33 starch and glucose metabolism 5 254 26 1.11E-15 TGME49_003110 citrate synthase, putative 2.3.3.1 TCA cycle 35 5 7 6.32E-09 metabolism TGME49_003340 alkyl sulfatase, putative 3.5.2.6 - 8 <2 2 2.10E-05 TGME49_003580 NAD-binding domain-containing protein - - n.a. n.a. n.a....”
- “...analysis identified two differentially expressed isoforms of citrate synthase, TGME49_068890, detected also in tachyzoites and TGME49_003110, which is specific to the oocyst stage. Citrate synthase is a rate-determining enzyme converting oxaloacetate into citrate in the first step of the TCA cycle, therefore, the stage-specific expression of...”
CISY_PSEAE / P14165 Citrate synthase; EC 2.3.3.16 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
PA1580 citrate synthase from Pseudomonas aeruginosa PAO1
NP_250271 citrate synthase from Pseudomonas aeruginosa PAO1
PA14_44070 citrate synthase from Pseudomonas aeruginosa UCBPP-PA14
32% identity, 84% coverage
- catalytic activity: oxaloacetate + acetyl-CoA + H2O = citrate + CoA + H(+) (RHEA:16845)
subunit: Homohexamer - Proteome profiling of Pseudomonas aeruginosa PAO1 identifies novel responders to copper stress
Wright, BMC microbiology 2019 - “...2.3 0.008 2 Ferric uptake regulation protein Cytoplasmic [Class 1]; Cytoplasmic [Class 3] Class 1 PA1580 2.3 0.009 5 Citrate synthase Cytoplasmic [Class 3] Class 1 PA4360 2.4 0.008 2 Hypothetical protein Unknown [Class 3]; Outer Membrane Vesicle [Class 1] Class 4 PA1608 2.5 0.008 2...”
- Bacterial Metabolism During Biofilm Growth Investigated by 13C Tracing
Wan, Frontiers in microbiology 2018 - “...of qPCR experiments. The target samples were seven selected genes (PA4732, PA5110, PA3131, PA5192, PA5435, PA1580, and PA2828) related to glucose metabolism of P. aeruginosa (Figure 3 ). The reference sample was housekeeping gene proC ( Savli et al., 2003 ). FIGURE 3 Expression fold change...”
- “...Fructose-1,6-bisphosphatase), PA3131 ( eda Aldolase), PA5192 ( pckA Phosphoenolpyruvate carboxykinase), PA5435 ( oadA Transcarboxylase subunit), PA1580 ( gltA Citrate synthase), PA2828 (probable aminotransferase ), proC (housekeeping Pyrroline-5-carboxylate reductase) in biofilm cells compared to planktonic cells. Each target gene was tested in triplicate. A housekeeping gene proC...”
- Protein complex formation during denitrification by Pseudomonas aeruginosa
Borrero-de, Microbial biotechnology 2017 - “...like malate: quinone oxidoreductase (PA3452), succinate dehydrogenase (PA1582 to PA1584), isocitrate dehydrogenase (PA2624), citrate synthase (PA1580), succinylcoenzyme A (succinylCoA) synthetase (PA1588) and 2oxoglutarate dehydrogenase (PA1585), were also found to be part of the supercomplex, as were enzymes related to the pyruvate metabolism, such as various subunits...”
- Additive Effects of Quorum Sensing Anti-Activators on Pseudomonas aeruginosa Virulence Traits and Transcriptome
Asfahl, Frontiers in microbiology 2017 - “...NC PA1303 signal peptidase 2.4 NC NC NC PA1542 hypothetical protein 1.8 NC 1.7 1.9 PA1580 gltA citrate synthase ( cisY ) 1.6 NC NC NC PA1595 hypothetical protein 1.9 NC NC NC PA1757 thrH homoserine kinase 2.0 NC NC NC PA1791 hypothetical protein 1.9 NC...”
- Protein Network of the Pseudomonas aeruginosa Denitrification Apparatus
Borrero-de, Journal of bacteriology 2016 - “...(PA1588), isocitrate dehydrogenase (PA2624), citrate synthase (PA1580), 2-oxoglutarate dehydrogenase (PA1585), and enzymes of the pyruvate knot, including...”
- Microcolony formation by the opportunistic pathogen Pseudomonas aeruginosa requires pyruvate and pyruvate fermentation
Petrova, Molecular microbiology 2012 - “...conditions Arginine fermentation Gene Fold change Gene Fold change Gene Fold change PA0927, ldhA 6.73 PA1580, gltA 24.24 PA5170, arcD 6.68 PA1400 (PycA) 5.12 PA0795, prpC 13.64 PA5171, arcA 3.38 PA0854, fumC2 9.55 PA1562, acnA 39.69 PA5172, arcB 3.18 PA5046 (Mdh) 3.38 PA1787, acnB 10.05 PA5173,...”
- The novel two-component regulatory system BfiSR regulates biofilm development by controlling the small RNA rsmZ through CafA
Petrova, Journal of bacteriology 2010 - “...5-kinase Dihydrolipoamide acetyltransferase ATP synthase delta chain PA1580 PA1584 PA4565 PA5016 PA5557 aceF atpH Transport and secretion PA4175 PA4502 piv...”
- Structure-function aspects of PstS in multi-drug-resistant Pseudomonas aeruginosa
Zaborina, PLoS pathogens 2008 - “...7900HT System using SYBR Green qPCR SuperMix-UDG (Invitrogen), cDNA, and respective primers: for citrate synthase PA1580 gene gltA , PA1580434 5' TCTACCACGACTCCCTGGAC 3' and PA1580590 5' TTTTCCGCGTAGTTCAGGTC 3'; for PstS PA5369 gene pstS , PA5369148 5' ACTCTGGCCAACCTGATGAC 3' and PA5369335 5'CCGTACTTCTGCTCGAAAGC 3'; for phosphate uptake regulator...”
- More
- Structure-function aspects of PstS in multi-drug-resistant Pseudomonas aeruginosa
Zaborina, PLoS pathogens 2008 - “...phosphate uptake regulatory protein ( Pseudomonas aeruginosa PAO1), NP_254052; citrate synthase ( Pseudomonas aeruginosa PAO1), NP_250271; Pseudomonas aeruginosa PAO1, complete genome, NC_002516; ExoU ( Pseudomonas aeruginosa ), AAC16023; human plasma phosphate-binding protein (HPBP), P85173. In the present study: PstS ( Pseudomonas aeruginosa MDR1), EF601157; PstS (...”
- Dynorphin activates quorum sensing quinolone signaling in Pseudomonas aeruginosa
Zaborina, PLoS pathogens 2007 - “...numbers for the P. aeruginosa PAO1 gene products discussed in this paper are citrate synthase (NP_250271), GacA (NP_251276), LasI (NP_250123), LasR (NP_250121), MvfR (NP_249694), PA-I galactophilic lectin (NP_251260), RhlI (NP_252166), and RhlR (NP_252167). The Entrez Nucleotide ( http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=Nucleotide ) accession number for the P. aeruginosa PAO1...”
- Proteomic approach to identify host cell attachment proteins provides protective Pseudomonas aeruginosa vaccine antigen FtsZ
Jurado-Martín, NPJ vaccines 2024 - “...22.517.8 48.3 5.74 Q9HTT7 Uroporphyrinogen-III synthase O (HemX) LES 431, 57P31PA 3 37.519.9 40.8 4.99 P14165 Citrate synthase (GltA) LES 431, A5803 3 22.715.2 47.7 6.47 Q9HV43 Chaperone protein (DnaK) LES 431, 57P31PA 3 33.323.9 68.4 4.79 Q9HYZ3 Probable M18 family aminopeptidase 2 (ApeB) LES 431,...”
- Proteomic Analysis of Resistance of Gram-Negative Bacteria to Chlorhexidine and Impacts on Susceptibility to Colistin, Antimicrobial Peptides, and Ceragenins
Hashemi, Frontiers in microbiology 2019 - “...quinone to form oxaloacetate and a reduced quinone. Ethanol oxidation, tricarboxylic acid cycle. 923.77 31 P14165 Citrate Synthase (GltA) Catalyzes the formation of citrate (and CoA) from oxaloacetate and acetyl-CoA. Tricarboxylic acid cycle 316.01 32 Q9I3F5 Aconitate hydratase A (AcnA) Catabolism of short chain fatty acids...”
- Pseudomonas aeruginosa core metabolism exerts a widespread growth-independent control on virulence
Panayidou, Scientific reports 2020 - “...PA14_38510 ( hmgA ) + + NT 16* PA14_40980 (enoyl-CoA hydratase) + + + 17 PA14_44070 ( gltA ) + + NT 18 PA14_45010 ( hyi ) + + NT 19 PA14_52050 ( purN ) + NT 20 PA14_52610 (hypothetical protein) + + NT 21 PA14_52800...”
A1S_2710 hypothetical protein from Acinetobacter baumannii ATCC 17978
33% identity, 93% coverage
- Insights Into Mechanisms of Biofilm Formation in Acinetobacter baumannii and Implications for Uropathogenesis
Colquhoun, Frontiers in cellular and infection microbiology 2020 - “...1.71 ATCC 17978 Rumbo-Feal et al., 2013 4.94 ATCC 17978 Kentache et al., 2017 gltA A1S_2710 citrate synthase I 3.33 ATCC 17978 Penesyan et al., 2019 PSM 33 A061 Nait Chabane et al., 2014 acs A1S_3309 acetyl-coA synthetase 4.17 ATCC 17978 Rumbo-Feal et al., 2013 2.89...”
- genetic determinants of intrinsic colistin tolerance in Acinetobacter baumannii
Hood, Infection and immunity 2013 - “...Malate dehydrogenase TCA cycle 31A2 Gene A1S_2710 Citrate synthase Cofactor biosynthesis 14G3a Gene A1S_0807 8-Amino-7-oxononanoate synthase Multidrug efflux...”
- Molecular mechanisms of ethanol-induced pathogenesis revealed by RNA-sequencing
Camarena, PLoS pathogens 2010 - “...0.066 flavoprotein involved in K+ transport COG2072 A1S_3301 4.1 0.107 Predicted membrane protein, COG3162 2.1 A1S_2710 2.5 0.076 Type II Citrate synthase(gltA) A1S_0179 3.1 0.121 Predicted flavodoxin, COG0655 A1S_3008 4.8 0.115 acetyl-CoA carboxylase, COG4799 A1S_0359 3.9 0.108 Predicted -lactamase, COG1680 A1S_0618 2.5 0.126 MarR transcriptional regulator,...”
- “..., [35] , [42] , [43] . We observed that the genes encoding citrate synthase (A1S_2710), and malate synthase G (A1S_1601) were induced 2.5 and 2.7 fold respectively but with a p-value above the threshold ( Table 2 ). qRT-PCR experiments verified that both genes are...”
MS2371 GltA protein from Mannheimia succiniciproducens MBEL55E
MS2371 citrate synthase from [Mannheimia] succiniciproducens MBEL55E
31% identity, 84% coverage
XAC3388 citrate synthase from Xanthomonas axonopodis pv. citri str. 306
32% identity, 84% coverage
- Proteomics-based identification of differentially abundant proteins reveals adaptation mechanisms of Xanthomonas citri subsp. citri during Citrus sinensis infection
Moreira, BMC microbiology 2017 - “...hmgA 0.14 0.00 0.17 A/L/PURPIR 100 XAC1533 Dihydrolipoamide dehydrogenase ldp 0.98 0.61 0.95 ENER-MET 101 XAC3388 Citrate synthase gltA 1.74 0.06 0.28 ENER-MET 103 XAC3688 D-amino acid dehydrogenase subunit dadA 0.00 0.09 1.39 A/L/PURPIR 108 XAC2012 3-ketoacyl-coa thiolase fadA 0.78 0.49 0.86 A/L/PURPIR 109 XAC0265 Acyl-coa...”
- Insights into xanthomonas axonopodis pv. citri biofilm through proteomics
Zimaro, BMC microbiology 2013 - “...69.0/6.5 9/10% +1.8 235 Citrate synthase 218 Q3BPS8_XANC5 X . c . pv . vesicatoria XAC3388 47.9/5.97 68.0/6.6 8/20% +2.6 591 Succinate dehydrogenase flavoprotein subunit 206 Q3BTD_XANC5 X . c . pv . vesicatoria XAC2077 65.8/5.89 55.0/4.4 18/22% 7.4 02.45 Energy conversion and regeneration 02.45.15 Energy...”
- “...and energy requirements. The three differentially expressed enzymes of the TCA cycle are citrate synthase (XAC3388, spot 235), malate dehydrogenase (XAC1006, spot 98) and dihydrolipoamide S-succinyltransferase (XAC1534, spot 121). Citrate synthase catalyzes the first reaction in the TCA cycle converting oxaloacetate and acetyl-coenzyme A into citrate...”
Q6L0M8 Citrate synthase from Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3)
31% identity, 96% coverage
- Identification of Binding Partners of CsaA - An Archaeal Chaperonic Protein of Picrophilus torridus
Singhal, Protein and peptide letters 2021 (PubMed)- “...Q6L132), nascent polypeptide-associated complex protein (Q6L1N3), elongation factor 1-alpha (Q6L202), uncharacterized protein (Q6L0Y6), citrate synthase (Q6L0M8), asparaginyl- tRNA synthetase (Q6L0M5), succinyl-CoA synthetase beta chain (Q6L0B4), pyruvate ferredoxin oxidoreductase alpha and beta chain proteins (Q6KZA7 and Q6KZA6, respectively), malate dehydrogenase (Q6L0C3) and reversed fumarylacetoacetase (Q6KZ97). Functional categorization...”
Cj1682c citrate synthase from Campylobacter jejuni subsp. jejuni NCTC 11168
CJE1851 citrate synthase from Campylobacter jejuni RM1221
30% identity, 85% coverage
- Survival of Campylobacter jejuni 11168H in Acanthamoebae castellanii Provides Mechanistic Insight into Host Pathogen Interactions
Nasher, Microorganisms 2022 - “...6 Cj1668c Periplasmic protein 2.168892 2.44 10 10 Cj0967 Periplasmic protein 2.103994 1.08 10 4 Cj1682c gltA Citrate synthase 2.097224 1.27 10 20 Cj0920c hisM Putative ABC-type amino-acid transporter permease protein 2.09015 9.49 10 16 Cj0864 Putative periplasmic protein-thioredoxin-like protein 2.063197 1.12 10 3 Cj0728 Putative...”
- Survival of Campylobacter jejuni in Acanthamoebae castellanii provides mechanistic insight into host pathogen interactions
Nasher, 2022 - The CJIE1 prophage of Campylobacter jejuni affects protein expression in growth media with and without bile salts
Clark, BMC microbiology 2014 - “...1.400.53 1.000.44 Two-component regulator (DNA binding response regulator), putative Cj1608 gi|218563197 0.070.31 2.501.65 Citrate synthase Cj1682c gi|157415898 0.800.36 0.730.21 50S ribosomal protein L2 Cj1704c gi|121612340 0.470.85 0.800.46 2-isopropylmalate synthase Cj1719c gi|121612265 0.830.68 0.670.21 Hypothetical protein CJE0598 CJIE2 prophage CJE0598 gi|57238304 1.100.28 0.770.4 Flagellin CJE1526 gi|57238729 0.870.25...”
- Hyperosmotic stress response of Campylobacter jejuni
Cameron, Journal of bacteriology 2012 - “...cj1567c cj1568c cj1569c cj1570c cj1571c cj1573c cj1682c Other metabolism Putative phosphate acetyltransferase Acetyl coenzyme A synthetase L-Serine dehydratase...”
- Key role of Mfd in the development of fluoroquinolone resistance in Campylobacter jejuni
Han, PLoS pathogens 2008 - “...chain M 0.0055 0.096095 1.60 NT Cj1624c sdaA , L-serine dehydratase 0.0046 0.094812 1.58 NT Cj1682c gltA , citrate synthase 0.0167 0.142007 1.54 NT Cj1688c secY , preprotein translocase subunit 0.0021 0.076881 1.63 2.15 Cj1717c leuC , 3-isopropylmalate dehydratase large subunit 0.0018 0.076881 1.61 NT Unknown...”
- Comparative genomic assessment of Multi-Locus Sequence Typing: rapid accumulation of genomic heterogeneity among clonal isolates of Campylobacter jejuni
Taboada, BMC evolutionary biology 2008 - “...genomic data to examine genetic linkage in C. jejuni . The tkt (Cj1645) and gltA (Cj1682c) loci are located approximately 36 Kb apart in the C. jejuni NCTC 11168 genome and variability has been observed in several genes contained within the region flanked by these two...”
- Culture of Campylobacter jejuni with sodium deoxycholate induces virulence gene expression
Malik-Kale, Journal of bacteriology 2008 - “...Cj1400c Cj1403c Cj1502c Cj1548c Cj1567c Cj1628 Cj1658 Cj1659 Cj1682c Cj1719c Cj0056c Cj0069 lctP atpA atpD infB trxB Cj0153c thiC rpmG secE nusG rplA Cj0499...”
- Identification of Campylobacter jejuni genes contributing to acid adaptation by transcriptional profiling and genome-wide mutagenesis
Reid, Applied and environmental microbiology 2008 - “...20) UP (5.5) 463 (915), Cj1566c Cj1570c Cj1571c Cj1573c Cj1682c UP (4, 12) DOWN (4, 12) Cytochrome C551 peroxidase Cj1509c (fdhC) DOWN (2, 4, 12) (0.998)...”
- Major structural differences and novel potential virulence mechanisms from the genomes of multiple campylobacter species
Fouts, PLoS biology 2005 - “...ammonia-lyase ( aspA, CJE0082), glutamine synthetase type I ( glnA, CJE0798), citrate synthase ( gltA, CJE1851), serine hydroxymethyltransferase ( glyA, CJE0451), phosphoglucosamine mutase ( pgm/glmM, CJE0409), transketolase ( tkt, CJE1817), and ATP synthase F1 alpha subunit ( uncA/atpA, CJE0100) on the PubMLST Web site ( http://pubmlst.org/...”
CJJ81176_1675 citrate synthase from Campylobacter jejuni subsp. jejuni 81-176
30% identity, 85% coverage
SG0871 citrate synthase from Sodalis glossinidius str. 'morsitans'
31% identity, 84% coverage
APA386B_2584 citrate synthase from Acetobacter pasteurianus 386B
30% identity, 82% coverage
MAB_0944 Probable citrate synthase I (GltA) from Mycobacterium abscessus ATCC 19977
32% identity, 84% coverage
A911_08105 citrate synthase from Campylobacter jejuni subsp. jejuni PT14
30% identity, 85% coverage
RM25_RS11475 citrate synthase from Propionibacterium freudenreichii subsp. freudenreichii
32% identity, 84% coverage
ABO_1501 citrate synthase from Alcanivorax borkumensis SK2
31% identity, 84% coverage
- An impaired metabolic response to hydrostatic pressure explains Alcanivorax borkumensis recorded distribution in the deep marine water column
Scoma, Scientific reports 2016 - “...synthase G = 0.22 132.7 113.8 338 ABO_1248 malate dehydrogenase = 0.08 169.1 160.3 1864 ABO_1501 type II citrate synthase = 0.12 82.3 89.3 1152 ABO_1431 aconitate hydratase 1.27 321.6 778.2 872 ABO_0694 aconitate hydratase TCA cycle + 1.98 224.4 56.9 1871 ABO_1201 bifunctional aconitate hydratase...”
- “...dehydrogenase, iron-sulfur = 0.22 132.7 113.8 338 ABO_1248 malate dehydrogenase = 0.08 169.1 160.3 1864 ABO_1501 type II citrate synthase = 0.01 282.6 284.6 991 ABO_1495 dihydrolipoamide succinyltransferase = 0.04 98.0 100.8 475 ABO_1498 succinate dehydrogenase flavoprotein subunit = 0.04 157.3 161.3 486 ABO_1499 succinate dehydrogenase,...”
- Genome sequence of the ubiquitous hydrocarbon-degrading marine bacterium Alcanivorax borkumensis
Schneiker, Nature biotechnology 2006 - “...borkumensis SK2 genome contains the genetic determinants for the biosynthesis of glutamate ( glt A, ABO_1501, glt B, ABO_2229, glt D, ABO_2228 and glt X, ABO_1509), ectoine ( ectA BC, ABO_2150_2152) and (putatively) betaine (ABO_0886) ( Fig. 4 ). However, genes for the synthesis of other...”
CT1834 citrate synthase from Chlorobaculum tepidum TLS
31% identity, 81% coverage
- Both forward and reverse TCA cycles operate in green sulfur bacteria
Tang, The Journal of biological chemistry 2010 - “...as a methyl or ethyl group), were detected gltA (CT1834, encoding citrate synthase (CS)) is required for and that BChl c was 13C-labeled with [13C]pyruvate or...”
- “...rRNA gene. Growth conditiona Gene 3 HCO gltA (CT1834, citrate synthase) aclA (CT1088, ACL, subunit) aclB (CT1089, ACL, subunit) porA (CT1628, pyruvate:...”
H16_A2627 citrate synthase from Ralstonia eutropha H16
H16_A2627 citrate synthase from Cupriavidus necator H16
32% identity, 84% coverage
- Insights into the Degradation of Medium-Chain-Length Dicarboxylic Acids in Cupriavidus necator H16 Reveal β-Oxidation Differences between Dicarboxylic Acids and Fatty Acids
Strittmatter, Applied and environmental microbiology 2022 (secret) - Detection of phase-dependent transcriptomic changes and Rubisco-mediated CO2 fixation into poly (3-hydroxybutyrate) under heterotrophic condition in Ralstonia eutropha H16 based on RNA-seq and gene deletion analyses
Shimizu, BMC microbiology 2013 - “...(H16_B1300), which encode paralogs of PdhA1 and PdhL, respectively, were barely expressed throughout cultivation. gltA (H16_A2627), acnA and acnB (H16_A2638 and H16_B0568, respectively), and icd1 and icd2 (H16_A3056 and H16_B1931, respectively), which encode enzymes for the conversion of C 6 -acids in TCA cycle, were highly...”
- Proteomic and transcriptomic elucidation of the mutant ralstonia eutropha G+1 with regard to glucose utilization
Raberg, Applied and environmental microbiology 2011 - “...the provision of glucose. Indeed, citrate synthase (CisY, H16_A2627) was present in lower quantities (factor of 0.5) in glucose-utilizing cells of mutant G1...”
2h12B / P20901 Structure of acetobacter aceti citrate synthase complexed with oxaloacetate and carboxymethyldethia coenzyme a (cmx) (see paper)
30% identity, 84% coverage
- Ligands: oxaloacetate ion; carboxymethyldethia coenzyme *a (2h12B)
lpg1415 citrate synthase from Legionella pneumophila subsp. pneumophila str. Philadelphia 1
lpl1366 citrate synthase from Legionella pneumophila str. Lens
31% identity, 85% coverage
- The Legionella pneumophila Siderophore Legiobactin Is a Polycarboxylate That Is Identical in Structure to Rhizoferrin
Burnside, Infection and immunity 2015 - “...Alcoy Lens Corby lpw14291 (100, 100) lpp1370 (99, 100) lpg1415 (100, 100) lpa02078 (100, 100) lpl1366 (100, 100) lpc0831 (100, 100) lpw00051 (100, 100) lpp0006...”
- Mediators of lipid A modification, RNA degradation, and central intermediary metabolism facilitate the growth of Legionella pneumophila at low temperatures
Söderberg, Current microbiology 2010 - “...genes involved in central intermediary metabolism ( Table 1 ). NU357 had an insertion in lpg1415 , the gltA gene encoding citrate synthase, which catalyzes the first step in the TCA cycle, namely the formation of citrate from oxaloacetate and acetyl-CoA [ 27 ]. Since gltA...”
- “...T2S inner membrane platform protein 0.0004% 0.0005% NU356 lpg1159 putative membrane permease 0.4% 0.1% NU357 lpg1415 ( gltA ) citrate synthase 0.3% 0.5% NU358 lpg1352 ( fadB ) 3-hydroxyacyl-CoA dehydrogenase 0.1% 0.2% NU359 lpg0092 ( rnr ) ribonuclease R 0.0005% 0.0007% NU360 lpg0363 ( lpxP )...”
- The Legionella pneumophila Siderophore Legiobactin Is a Polycarboxylate That Is Identical in Structure to Rhizoferrin
Burnside, Infection and immunity 2015 - “...lpp1370 (99, 100) lpg1415 (100, 100) lpa02078 (100, 100) lpl1366 (100, 100) lpc0831 (100, 100) lpw00051 (100, 100) lpp0006 (99, 99) lpg0006 (99, 99) lpa00006...”
AYM39_19030 citrate synthase from Methylomonas sp. DH-1
31% identity, 83% coverage
- Improvement of succinate production from methane by combining rational engineering and laboratory evolution in Methylomonas sp. DH-1
Jo, Microbial cell factories 2024 - “...pTOP- ssadh . To construct an overexpression vector for the citrate synthase ( gltA , AYM39_19030) gene, the strong promoter, P mxaF (AYM39_15615), was used. The sequences of the P mxaF and gltA genes were assembled as one fragment by overlap extension PCR. The assembled DNA...”
- “...(2,805,889) Point mutation G A Missense (Ala175Val) AYM39_12470 7 Chromosome (4,271,282) Deletion C Frame shift AYM39_19030 8 Chromosome (4,458,259) Point mutation C A Intergenic region 9 Chromosme (Integrated malate synthase) Insertion 132 bp Fragmentation by stop codon 10 b Plasmid (16,19919,918) Deletion 3720 bp In frame...”
NCLIV_024780 putative citrate synthase from Neospora caninum Liverpool
41% identity, 73% coverage
- The 2-methylcitrate cycle is implicated in the detoxification of propionate in Toxoplasma gondii
Limenitakis, Molecular microbiology 2013 - “...Dicarboxylic acid transporter 0.6321 TGME49_074060 Abbreviations Nc Et Pf Cp Tp PrpE NCLIV_032540 ETH_00007195 PrpC NCLIV_024780 ETH_00026655 PrpD NCLIV_013410 ETH_00015105 PrpB NCLIV_000780 Contig 1606+713 Acn NCLIV_046260 ETH_00020300 PF13_0229 TP01_1050 NCLIV_033680 ETH_00021115 PF08_0031 cgd1_600 TP02_0450 Abbreviations Bb Pm Pt Tt PrpE XP_001460124 XP_001025576 PrpC XP_002787782 XP_001447471 XP_001023516...”
BCAM0972 citrate synthase from Burkholderia cenocepacia J2315
31% identity, 84% coverage
A0A0H3C985 citrate synthase (unknown stereospecificity) (EC 2.3.3.16) from Caulobacter vibrioides (see paper)
YP_002517356 citrate synthase from Caulobacter vibrioides NA1000
CCNA_01983 citrate synthase from Caulobacter crescentus NA1000
30% identity, 86% coverage
Bmul_4643 citrate synthase from Burkholderia multivorans ATCC 17616
32% identity, 84% coverage
- Proteomic Studies of the Biofilm Matrix including Outer Membrane Vesicles of Burkholderia multivorans C1576, a Strain of Clinical Importance for Cystic Fibrosis
Terán, Microorganisms 2020 - “...enolase eno ENO_BURM1 4 cytoplasm aldehyde dehydrogenase family protein Bmul_3451 WP_054317513.1 4 cytoplasm citrate synthase Bmul_4643 OJD04157.1 3 cytoplasm redoxin family protein Bmul_1331 KOS88719.1 3 cytoplasm phasin protein Bmul_1136 WP_006401963.1 3 unknown bacterioferritin bfr /Bmul_1081 ABO01605.1 2 cytoplasm a NCBI accession number of the proteins. b...”
- “...Subcellular localization b Porin opcP WP_054315301.1 Outer membrane Chaperonin GroEL groL WP_006400973.1 Cytoplasmic Citrate (Si)-synthase Bmul_4643 OJD04157.1 Cytoplasmic Aldehyde dehydrogenase family protein Bmul_3451 WP_054317513.1 Cytoplasmic Malate dehydrogenase mdh WP_006399543.1 Unknown Leucine ABC transporter subunit substrate binding protein LivK Bmul_3623 OJD03740.1 Periplasmic Glycine dehydrogenase gcvP GCSP_BURM1 Unknown...”
bglu_2g08280 Citrate synthase I from Burkholderia glumae BGR1
31% identity, 84% coverage
BTH_II0665 citrate synthase I from Burkholderia thailandensis E264
Q2T7I5 Citrate synthase from Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
32% identity, 84% coverage
KYF39_04395 citrate synthase from Riemerella anatipestifer RA-YM
32% identity, 82% coverage
- Genome-Wide Analysis Reveals that PhoP Regulates Pathogenicity in Riemerella anatipestifer
Zhang, Microbiology spectrum 2022 - “...LPS assembly protein LptD KYF39_04380 1.72 2.97E37 RidA family protein KYF39_04385 1.48 3.26E12 Hypothetical protein KYF39_04395 1.67 2.29E28 Citrate synthase KYF39_04400 1.16 8.51E12 AhpC/TSA family protein KYF39_04435 1.01 3.72E07 Type B 50S ribosomal protein L36 KYF39_04790 1.25 2.90E07 Do family serine endopeptidase KYF39_04905 1.50 1.47E02 Hypothetical...”
BPSS1715 citrate synthase from Burkholderia pseudomallei K96243
32% identity, 84% coverage
aarA / P20901 citrate synthase monomer (EC 2.3.3.3) from Acetobacter aceti (see 2 papers)
30% identity, 82% coverage
CA51_34870 citrate synthase from Rosistilla oblonga
30% identity, 82% coverage
FTL_1789 citrate synthase from Francisella tularensis subsp. holarctica
32% identity, 86% coverage
3msuB / Q5NIJ6 Crystal structure of citrate synthase from francisella tularensis
32% identity, 84% coverage
- Ligand: oxaloacetate ion (3msuB)
Rmet_2481 citrate synthase from Cupriavidus metallidurans CH34
Rmet_2481 Citrate synthase I from Ralstonia metallidurans CH34
32% identity, 84% coverage
- The complete genome sequence of Cupriavidus metallidurans strain CH34, a master survivalist in harsh and anthropogenic environments
Janssen, PloS one 2010 - “...a full cycle in which acetate is again transformed to citrate by citrate synthase CitA (Rmet_2481, Rmet_4144, Rmet_4268, Rmet_4946, and Rmet_5380) and citrate to D-isocitrate via aconitase AcnA (Rmet_1585, Rmet_2492, Rmet_4240, and Rmet_5296). We note that D-isocitrate, as for full TCA cycles, is transfigured into 2-ketoglutarate...”
YP_002727485 Citrate synthase from Wolbachia sp. wRi
30% identity, 86% coverage
lpp1370 citrate synthase from Legionella pneumophila str. Paris
31% identity, 85% coverage
XP_003882425 Citrate synthase, related from Neospora caninum Liverpool
31% identity, 87% coverage
- Two enzymes contribute to citrate production in the mitochondrion of Toxoplasma gondii
Lyu, The Journal of biological chemistry 2024 - “...CS1, KAA6419099; Putative peroxisomal CS in parasite: T.gondii CS2 , EPR61654; N.caninum Liverpool CS2 , XP_003882425; Cystoisospora suis CS2 , PHJ25487; Peroxisomal CS in fungi: Gigaspora margarita CS2 , KAF0555079; Conidiobolus coronatus CS2 , KXN72308; Haematococcus lacustris CS2 , GFH18987; Putative peroxisomal CS in algae: C.sorokiniana...”
Mal33_42290 citrate synthase from Rosistilla oblonga
30% identity, 82% coverage
VpaChn25_0837, WU75_19760 citrate synthase from Vibrio parahaemolyticus
VP0842 citrate synthase from Vibrio parahaemolyticus RIMD 2210633
30% identity, 84% coverage
M892_06275 citrate synthase from Vibrio campbellii ATCC BAA-1116
30% identity, 84% coverage
P9WPD5 citrate synthase (unknown stereospecificity) (EC 2.3.3.16) from Mycobacterium tuberculosis (see paper)
NP_215411 citrate synthase 1 from Mycobacterium tuberculosis H37Rv
Rv0896 citrate synthase from Mycobacterium tuberculosis H37Rv
31% identity, 83% coverage
- The unfoldase ClpC1 of Mycobacterium tuberculosis regulates the expression of a distinct subset of proteins having intrinsically disordered termini
Lunge, The Journal of biological chemistry 2020 (secret) - Structures of citrate synthase and malate dehydrogenase of Mycobacterium tuberculosis.
Ferraris, Proteins 2015 (PubMed)- GeneRIF: Crystal structures of M. tuberculosis malate dehydrogenase and citrate synthase.
- Immunological depiction of synthetic B-cell epitopes of Mycobacterium tuberculosis
Sharma, International journal of mycobacteriology 2023 (PubMed)- “...effort was made to evaluate antibody response to peptides derived from proteins Rv2588c, Rv0512, Rv0148, Rv0896, and Rv0635 of M. tuberculosis in PTB patients and healthy individuals through enzyme-linked immunosorbent assay. Five milliliters of venous blood samples was collected from each participant, and serum was separated...”
- Mycobacterium tuberculosis CitA activity is modulated by cysteine oxidation and pyruvate binding
Pathirage, RSC medicinal chemistry 2023 - “...family including citrate synthase I encoded by gltA2 gene (Rv0896), citrate synthase II encoded by citA (Rv0889c) and methyl citrate synthase that is encoded by...”
- “...of the primary M. tb citrate synthase, GltA2 (encoded by gene rv0896, PDB accession code 4TVM), for comparison. As shown in Fig. 2, The H2 and H3 helices at the...”
- A potent subset of Mycobacterium tuberculosis glycoproteins as relevant candidates for vaccine and therapeutic target
Yari, Scientific reports 2023 - “...(0.70) Virulence, detoxification, adaptation Rv0685 Elongation factor TuOS 396 10 (2.52) 4 (1.01) Information pathways Rv0896 Citrate synthase gltA2 431 22 (5.10) 4 (0.93) Intermediary metabolism respiration Rv1479 regulatory protein MoxR1 377 21 (5.60) 0 (0.00) Regulatory proteins, transcriptional mechanism Rv3877 ESX-1 secretion espA 392 33...”
- Understanding the Genetic Diversity of Mycobacterium africanum Using Phylogenetics and Population Genomics Approaches
Balamurugan, Frontiers in genetics 2022 - “...(Rv0946c), Glu255Ala (Rv1131), Ala309Gly (Rv2454c), Val425Ala and Ser112Ala (Rv1127c), Gly198Ala (Rv3293) and Ile137Val (Rv0363c), Thr421Ala (Rv0896), Arg442His (Rv1248c), Thr218Ile (Rv1122), and Ser381Leu (Rv1449c), hinting at the differential growth attenuation. Genes harboring multiple (sub)-lineage-specific core-cluster SNPs such as Lys117Asn, Val447Met, and Ala455Val (Rv0066c; icd2 ) present across...”
- Cholesterol-dependent transcriptome remodeling reveals new insight into the contribution of cholesterol to Mycobacterium tuberculosis pathogenesis
Pawełczyk, Scientific reports 2021 - “...this transcription factor (Figs. 4 , 5 B). We also observed induction of gltA2 ( Rv0896 ), an essential citrate synthase gene 36 conducting the entry reaction of the tricarboxylic acid cycle (TCA), with concomitant repression of icd1 ( Rv3339c ), which encodes isocitrate dehydrogenase, and...”
- One-Year Old Dormant, "Non-culturable" Mycobacterium tuberculosis Preserves Significantly Diverse Protein Profile
Trutneva, Frontiers in cellular and infection microbiology 2020 - “...Membrane Periplasmic superoxide dismutase [Cu-Zn] SodC Rv0432 5 10 Cytosol Probable citrate synthase I GltA2 Rv0896 N/D 10 In the columns marked as place, proteins were arranged according to their spot density. See also M&M. Proteins with increased abundance in D2 cells vs. active cells (place...”
- “...Rv0211 Probable iron-regulated phosphoenolpyruvate carboxykinase [GTP] PckA Rv0951 Probable succinyl-CoA synthetase (beta chain) SucC (SCS-beta) Rv0896 Probable citrate synthase I GltA2 Rv1074c Probable beta-ketoacyl CoA thiolase FadA3 Rv0363c Probable fructose-bisphosphate aldolase Fba Rv1617 Probable pyruvate kinase PykA Rv1017c Probable ribose-phosphate pyrophosphokinase PrsA (phosphoribosyl pyrophosphate synthetase) Rv1310...”
- Lineage-Specific Proteomic Signatures in the Mycobacterium tuberculosis Complex Reveal Differential Abundance of Proteins Involved in Virulence, DNA Repair, CRISPR-Cas, Bioenergetics and Lipid Metabolism
Yimer, Frontiers in microbiology 2020 - “...7 Putative succinate-semialdehyde dehydrogenase 2 gabD2 Rv1731 3, 5 4, 7 Citrate synthase 1 gltA2 Rv0896 5 3, 4, 7 Succinate dehydrogenase 2 membrane subunit SdhC sdhC Rv3316 5 3, 4, 7 Succinate dehydrogenase flavoprotein subunit sdhA Rv3318 5 3, 4, 7 Probable succinate dehydrogenase SdhB...”
- Activity-Based Protein Profiling Reveals That Cephalosporins Selectively Active on Non-replicating Mycobacterium tuberculosis Bind Multiple Protein Families and Spare Peptidoglycan Transpeptidases
Lopez, Frontiers in microbiology 2020 - “...P64178 Rv1436 gap Yes PP: glyceraldehyde-3-phosphate dehydrogenase P65149 Rv3001c ilvC Yes PP: ketol-acid reductoisomerase Q10530 Rv0896 gtlA2 Yes PP: citrate synthase 1 P0A590 Rv2220 glnA1 Yes PP: glutamine synthetase 1 P95143 Rv0694 lldD No PP: putative L -lactate dehydrogenase P65682 Rv2607 pdxH No SF: pyridoxine/pyridoxamine 5-phosphate...”
- More
APH_1232 citrate synthase I from Anaplasma phagocytophilum HZ
31% identity, 87% coverage
PP_4194, T1E_0434 citrate synthase from Pseudomonas putida KT2440
PP4194 citrate synthase from Pseudomonas putida KT2440
31% identity, 84% coverage
- Modification of Glucose Metabolic Pathway to Enhance Polyhydroxyalkanoate Synthesis in <i>Pseudomonas putida</i>
Dong, Current issues in molecular biology 2024 - “...as compared to the parent strain [ 21 ]. Citrate synthase (encoded by gltA , PP_4194) is the first enzyme and catalyzes the production of citric acid with acetyl-CoA and oxaloacetate as substrates into TCA cycle. In E. coli that heterogeneously expressed PHA synthetic gene, gltA...”
- Synthetically-primed adaptation of Pseudomonas putida to a non-native substrate D-xylose
Dvořák, Nature communications 2024 - “...tt L1 (Fig. 6c ), while upregulation of the pyruvate dehydrogenase complex, citrate synthase GltA (PP_4194), and malate dehydrogenase Mdh supported TCA cycle activity. We expected that some of the lower expressed proteins in PD689 tt L1 were encoded by the chromosomal region (PP_2114PP_2219), multiplied in...”
- Insights into the susceptibility of Pseudomonas putida to industrially relevant aromatic hydrocarbons that it can synthesize from sugars
García-Franco, Microbial cell factories 2023 - “...icd/idh genes (T1E_0537 and T1E_0538). Two citrate synthase genes ( glt A and prp C) (T1E_0434 and T1E_5347) were also induced, leading to an increased ability to channel acetyl-CoA quickly and efficiently into the respiratory chain. Phosphoenolpyruvate carboxylase, which is involved in replenishment of the Krebs...”
- Regulatory tasks of the phosphoenolpyruvate-phosphotransferase system of Pseudomonas putida in central carbon metabolism
Chavarría, mBio 2012 - “...dehydrogenase subunit E1 (PP_0339); AceF, dihydrolipoamide acetyltransferase (PP_0338); LpdG, dihydrolipoamide dehydrogenase (PP_4187); GltA, citrate synthase (PP_4194); AcnA, aconitate hydratase 1 (PP_2112); AcnB, aconitate hydratase 2 (PP_2339); Icd, isocitrate dehydrogenase (PP_4011); Kgd, alpha-ketoglutarate decarboxylase (PP_4189); KgdB, dihydrolipoamide acetyltransferase (PP_4188); SucA, 2-oxoglutarate dehydrogenase E1 component (PP_4189); SucC, succinyl-CoA...”
- Integrated analysis of gene expression and metabolic fluxes in PHA-producing Pseudomonas putida grown on glycerol
Beckers, Microbial cell factories 2016 - “...carboxylase 0.09 0.06 0.10 0.50 PP0154 Acetyl-CoA hydrolase 0.21 0.23 1.42 1.41 TCA cycle gltA PP4194 Citrate synthase 0.01 0.57 0.10 1.12 acnA PP2112 Aconitate hydratase 0.04 0.22 0.10 0.57 acnB PP2339 Aconitate hydratase 0.33 0.2 0.10 0.74 icd PP4012 Isocitrate dehydrogenase 0.38 0.14 0.10 1.97...”
- Production of medium chain length polyhydroxyalkanoate in metabolic flux optimized Pseudomonas putida
Borrero-de, Microbial cell factories 2014 - “...ppsA PP2082 Phosphoenolpyruvate synthase 0.5 0.4 ppc PP1505 Phosphoenolpyruvate carboxylase 0.5 0.4 TCA cycle gltA PP4194 Citrate synthase 0.7 0.7 acnA PP2112 Aconitate hydratase 0.4 -0.4 acnB PP2339 Aconitate hydratase 0.7 0.3 icd PP4011 Isocitrate dehydrogenase 0.3 -0.5 sucA PP4189 2-Oxoglutarate dehydrogenase -0.7 -0.2 sucD PP4185...”
- “...ppsA PP2082 Phosphoenolpyruvate synthase 0.2 -0.1 ppc PP1505 Phosphoenolpyruvate carboxylase 0.0 1.4 TCA cycle gltA PP4194 Citrate synthase -0.2 0.7 acnA PP2112 Aconitate hydratase 0.8 -0.5 acnB PP2339 Aconitate hydratase -0.2 0.3 icd PP4011 Isocitrate dehydrogenase -0.3 -0.3 sucA PP4189 2-Oxoglutarate dehydrogenase -0.6 0.2 sucD PP4185...”
- ATP-dependent RecG helicase is required for the transcriptional regulator OxyR function in Pseudomonas species
Yeom, The Journal of biological chemistry 2012 - “...(hmgA) PP0234 (oprE) PP1206 (oprD) PP0222 PP2335 PP0170 PP4194 (gltA) PP0883 PP0238 (ssuD) PP2441 PP5278 PP3148 PP0235 (lsfA) PP3122 PP0885 PP4402 (bkdA2)...”
- PpoR is a conserved unpaired LuxR solo of Pseudomonas putida which binds N-acyl homoserine lactones
Subramoni, BMC microbiology 2009 - “...PP4814 ATP-dependent protease La domain protein 2.338 31. PP3122 CoA-transferase, subunit A, putative 2.176 32. PP4194 citrate synthase 2.162 33. PP0684 peptidyl-prolyl cis-trans isomerase, FKBP-type 2.077 34. PP5319 hypothetical protein 2.013 In order to validate the differential expression of genes observed in the microarray experiment, semi...”
- Genome-scale reconstruction and analysis of the Pseudomonas putida KT2440 metabolic network facilitates applications in biotechnology
Puchałka, PLoS computational biology 2008 - “...Formate dehydrogenase PP0490 or PP0491 PP2183 or PP2184 or PP2185 or PP2186 4 Citrate synthase PP4194 l -Valine 21.85 0.83 1.00 2-Methylcitrate dehydratase PP2338 5 Glycine hydroxymethyl transferase PP0322 l -Leucine, l -lysine, l -phenylalanine 16.75 3.33 4.00 PP0671 Citrate synthase PP4194 6 Glycine hydroxymethyl transferase...”
WP_025098908 citrate synthase from Burkholderia gladioli
31% identity, 85% coverage
gltA / P56062 citrate synthase monomer (EC 2.3.3.3) from Helicobacter pylori (strain ATCC 700392 / 26695) (see 2 papers)
HP0026 citrate synthase (gltA) from Helicobacter pylori 26695
P56062 Citrate synthase from Helicobacter pylori (strain ATCC 700392 / 26695)
32% identity, 84% coverage
- Genomic differentiation within East Asian Helicobacter pylori
You, Microbial genomics 2022 - “...of pyruvate:ferredoxin oxidoreductase, part of the microaerophilic metabolic pathway leading to acetyl~CoA Subunit interaction gltA HP0026 5(b) Energy metabolism Citrate synthase, the first enzyme in TCA cycle incorporating acetyl~CoA Subunit interaction o ppD HP0250 5(a) Importer Oligopeptide ABC transporter, ATPase subunit Cofactor binding Fst >0.5 o...”
- “...The region-differentiated amino acid changes involve a handful of key metabolic enzymes. Citrate synthase GltA (HP0026, MWE_1570), is the first enzyme in the TCA cycle catalysing the conversion of acetyl-CoA and oxaloacetate to citrate. Yunnan-differentiated S127T is located between the two identical monomers and is likely...”
- Acid-regulated gene expression of Helicobacter pylori: Insight into acid protection and gastric colonization
Marcus, Helicobacter 2018 - “...0.05 1.62 0.13 0.04 ATP synthase F1 -subunit ( atpC ) Metabolism TCA Pathway HPG27_RS00145 HP0026 1.31 0.05 0.01 1.71 0.12 0.02 2.82 0.48 0.06 citrate synthase ( gltA ) HPG27_RS03800 HP0779 2.15 0.03 0.00 1.36 0.03 0.00 1.16 0.09 0.20 aconitase B ( acnB )...”
- Rapid evolution of distinct Helicobacter pylori subpopulations in the Americas
Thorell, PLoS genetics 2017 - “...a specific ancestry components. Locus tag Gene Description Population showing the enrichment Enrichment P-value * HP0026 gltA type II citrate synthase hpEuropeColombia Asia_high 1.4E-10 HP0042 trbI protein hpEuropeColombia Africa_high 1.0E-09 HP0099 tlpA methyl-accepting chemotaxis protein hspAfrica1NAmerica Africa_low 1.2E-09 HP0160 hypothetical protein hpEuropeColombia Europe_high 4.1E-12 HP0216 1-deoxy-D-xylulose...”
- Structural and functional aspects of the Helicobacter pylori secretome
Zanotti, World journal of gastroenterology 2014 - “...Amino peptidase HP1350 Carboxyl-terminal protease Other enzymes HP0026 Citrate synthase HP0072 Urease B (UreB) HP0073 Urease A (UreA) HP0154 Enolase,...”
- “...reported in Table 1, including citrate synthase (HP0026), glutamate dehydrogenase (HP0380) and enolase (HP0154), are clearly cytoplasmic enzymes and were...”
- Targeted identification of glycosylated proteins in the gastric pathogen Helicobacter pylori (Hp)
Champasa, Molecular & cellular proteomics : MCP 2013 - “...37 3 16.9 HP0632 AAD07692 hydB 67.6 Quinone-reactive Ni-Fe hydrogenase Inner membrane 7 4 13.5 HP0026 P56062 gltA 50.9 Citrate synthase Cytoplasm 71 6 13.2 HP0757 AAD07805 34.9 Beta-alanine synthase Cytoplasm 6 2 12.4 HP0485 AAD07551 37.7 Catalase-like protein Periplasm 4 3 12.3 HP0201 AAD07269 plsX...”
- Protein glycosylation in Helicobacter pylori: beyond the flagellins?
Hopf, PloS one 2011 - “...nd HP1132 F0F1 ATP synthase subunit 73 51.5 1, G (52.1) 5 61 0.24 0.25 HP0026 Citrate synthase GltA 44 48.3 1, G (53.6) 5 62 0.28 0.28 HP0026 Citrate synthase GltA 49 48.3 1, G (53.6) 6 70 0.21 0.18 HP1134 F0F1 ATP synthase subunit...”
- Metabolism and genetics of Helicobacter pylori: the genome era
Marais, Microbiology and molecular biology reviews : MMBR 1999 - “...discoveries of genes encoding citrate synthase (gltA, HP0026), aconitase (acnB, HP0779), isocitrate dehydrogenase (icd, HP0027), fumarase (fumC, HP1325), and...”
- Outer Membrane Vesicles Secreted by Helicobacter pylori Transmitting Gastric Pathogenic Virulence Factors
Wei, ACS omega 2022 - “...O25668 CbpA 77 A0A0M3KL20 C694_06140 78 O26082 CeuE 79 P56033 rplE 80 O25311 HP_0589 81 P56062 gltA 82 O24923 HP_0097 83 O24944 HP_0130 84 O25225 typA 85 O25534 pgbB 86 O25254 hslU 87 O25995 HP_1457 88 P96786 fliD 89 O26084 HP_1564 90 O25993 HP_1454 91 O25158...”
- “...O25883 fumC 58 O25216 PepF 59 O25147 HP_0385 60 O25656 PqqE 61 O25997 HP_1461 62 P56062 gltA 63 O25738 HP_1110 64 O25414 HP_0710 65 P56185 rnj 66 O25736 HP_1108 67 P56145 pheT 68 O26082 CeuE 69 P56155 pyrF 70 O24968 pyrF 71 O26102 pdxJ 72 O25995...”
- Structural and functional aspects of the Helicobacter pylori secretome
Zanotti, World journal of gastroenterology 2014 - “...z b' 1E9Y, 1E9Z 1E9Y, 1E9Z 2JGQ 3QBU, 4LY4 P56062 P69996 P14916 P48285 P56076 O25025 O25067 O25080 O25090 P55990 O25153 February 14, 2014|Volume 20|Issue 6|...”
- Targeted identification of glycosylated proteins in the gastric pathogen Helicobacter pylori (Hp)
Champasa, Molecular & cellular proteomics : MCP 2013 - “...3 16.9 HP0632 AAD07692 hydB 67.6 Quinone-reactive Ni-Fe hydrogenase Inner membrane 7 4 13.5 HP0026 P56062 gltA 50.9 Citrate synthase Cytoplasm 71 6 13.2 HP0757 AAD07805 34.9 Beta-alanine synthase Cytoplasm 6 2 12.4 HP0485 AAD07551 37.7 Catalase-like protein Periplasm 4 3 12.3 HP0201 AAD07269 plsX 38.4...”
Poly24_35470 citrate synthase from Rosistilla carotiformis
30% identity, 82% coverage
BP2358 citrate synthase from Bordetella pertussis Tohama I
31% identity, 82% coverage
- A Functional Tricarboxylic Acid Cycle Operates during Growth of Bordetella pertussis on Amino Acid Mixtures as Sole Carbon Substrates
Izac, PloS one 2015 - “...qPCR primer sequence (5' to 3') recA (BP2546) recA-F TCATCGCCGAAATGCAGAAG recA (BP2546) recA-R CTTCATGCGGATCTGGTTGA gltA (BP2358) gltA-F ATCACACGATGGTCAACGAG gltA (BP2358) gltA-R CTTGTACTCTTCACACGGGG acnA (BP2014) acnA-F TGTCAGTTCTATTCGCTGCC acnA (BP2014) acnA-R CAGCTTCATGTTCAGGTCGA acnB (BP2021) acnB-F CCAAGCAAGGCAAGAAGAAC acnB (BP2021) acnB-R CTCGTCTTCATAGCCGTTGG icd (BP2488) icd-F TCATGAAGTTCACGGAAGGC icd (BP2488) icd-R GAGATGTAGTCGCCGTTCAG...”
- “...lpdA BP0618lpd pyruvate acetyl-CoA pdhA BP0629 pyruvate dehydrogenase component E1 subunit acetyl-CoA+ oxaloacetate citrate gltA BP2358 type II citrate synthase citrate isocitrate (intermediary: cis -aconitate) acnA BP2014 aconitate hydratase citrate isocitrate (intermediary: cis -aconitate) acnB BP2021 bifunctional aconitate hydratase 2 isocitrate -ketoglutarate icd BP2488 isocitrate dehydrogenase...”
- A gel-free proteomic-based method for the characterization of Bordetella pertussis clinical isolates
Williamson, Journal of microbiological methods 2012 - “...35 (2) 35 (2) 35 (2) 35 (2) Membrane transport Type II citrate synthase NP_880994 BP2358 qltA 48 C 11 (3) 8 (2) 10 (3) 10 (3) Carbohydrate metabolism Ubiquinol oxidase polypeptide I NP_881514 BP2932 cyoB 72 CM 6 (3) 6 (2) 9 (4) 6 (2)...”
C3K673 Citrate synthase from Pseudomonas fluorescens (strain SBW25)
PFLU1815 citrate synthase from Pseudomonas fluorescens SBW25
PFLU_1815 citrate synthase from Pseudomonas [fluorescens] SBW25
31% identity, 84% coverage
jhp0022 CITRATE SYNTHASE from Helicobacter pylori J99
32% identity, 84% coverage
- Growth phase-dependent response of Helicobacter pylori to iron starvation
Merrell, Infection and immunity 2003 - “...2.4 2.8 2.2 3.0 2.7 2.3 JHP0018 JHP0022 JHP0279 JHP0537 JHP0586 JHP0716 JHP0837 JHP0878 JHP1112 JHP1159 JHP1428 JHP1427 #JHP0585 Carboxynorspermidine...”
- “...HP0691 HP0692 *HP0943 *HP1238 *HP1399 HP1538 HP1539 JHP0022 JHP0162 JHP0262 JHP0279 JHP0637 JHP0636 JHP0878 JHP1159 JHP1427 JHP1461 JHP1460 Citrate synthase,...”
PSPTO_2194 citrate synthase I from Pseudomonas syringae pv. tomato str. DC3000
31% identity, 84% coverage
WP_010900596 citrate synthase from Thermoplasma acidophilum DSM 1728
P21553 Citrate synthase from Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
Ta0169 citrate synthase from Thermoplasma acidophilum DSM 1728
32% identity, 95% coverage
- The partial substrate dethiaacetyl-coenzyme A mimics all critical carbon acid reactions in the condensation half-reaction catalyzed by Thermoplasma acidophilum citrate synthase.
Kurz, Biochemistry 2009 - GeneRIF: All of the processes that occur in the condensation half-reaction performed by Thermoplasma acidophilum citrate synthase with the natural thioester substrate, acetyl-coenzyme A, also occur with the ketone inhibitor dethiaacetyl-CoA.
- An active site-tail interaction in the structure of hexahistidine-tagged Thermoplasma acidophilum citrate synthase
Murphy, Acta crystallographica. Section F, Structural biology communications 2015 - “...host E. coli C41(DE3) Complete amino-acid sequence of the construct produced PETEEISKGLEDVNIKWTRLTTIDGNKGILRYGGYSVEDIIASGAQDEEIQYLFLYGNLPTEQELRKYKETVQKGYKIPDFVINAIRQLPRESDAVAMQMAAVAAMAASETKFKWNKDTDRDVAAEMIGRMSAITVNVYRHIMNMPAELPKPSDSYAESFLNAAFGRKATKEEIDAMNTALILYTDHEVPASTTAGLVAVSTLSDMYSGITAALAALKGPLHGGAAEAAIAQFDEIKDPAMVEKWFNDNIINGKKRLMGFGHRVYKTYDPRAKIFKGIAEKLSSKKPEVHKVYEIATKLEDFGIKAFGSKGIYPNTDYFSGIVYMSIGFPLRNNIYTALFALSRVTGWQAHFIEYVEEQQRLIRPRAVYVGPAERKYVPIAERK VDKLAAALEHHHHHH UniProt identifier P21553 The restriction sites in ODNs 1306 (forward, NdeI) and 1309 (reverse, XhoI) are underlined. Stop codon 385 is replaced by the vector-encoded tag sequence. The recombinant protein lacks an N-terminal...”
- Crystal Structures of Two Isozymes of Citrate Synthase from Sulfolobus tokodaii Strain 7
Murakami, Biochemistry research international 2016 - “...acetyl-CoA [ 36 , 37 ]. For another example, Thermoplasma acidophilum has two CS genes, Ta0169 and Ta0819, which share rather high sequence identity of 68%; thus they might show similar conformation and function similarly to each other [ 38 ]. Therefore we needed to express...”
- Identification and functional verification of archaeal-type phosphoenolpyruvate carboxylase, a missing link in archaeal central carbohydrate metabolism
Ettema, Journal of bacteriology 2004 - “...MTH1726, MTH962 PF0203 Faci02000612, Faci02001586 PTO0889, PTO0169 TA0169, TA0819 TVN0239 SSO1254 APE0311 CTLf 2301 APE1713 PAE3585 PAE3586e PAE1689 SSO2589...”
A1G_07170 type II citrate synthase from Rickettsia rickettsii str. 'Sheila Smith'
29% identity, 83% coverage
WP_014411765 citrate synthase from Rickettsia prowazekii str. Breinl
28% identity, 82% coverage
ZMO1963 citrate synthase I from Zymomonas mobilis subsp. mobilis ZM4
30% identity, 84% coverage
- Genome-Wide Analyses of Proteome and Acetylome in Zymomonas mobilis Under N2-Fixing Condition
Nisar, Frontiers in microbiology 2021 - “...(AcnA, ZMO0543) at K663, and succinateCoA ligase (SucD, ZMO0567) at K293. Also, CitC and GltA (ZMO1963) from TCA cycle were found acetylated at site K57 and K311 under the N 2 -fixing condition, respectively. In comparison, for phosphorylated-based PTM in Z. mobilis , only Mdh was...”
- Transcriptome analysis of Zymomonas mobilis ZM4 reveals mechanisms of tolerance and detoxification of phenolic aldehyde inhibitors from lignocellulose pretreatment
Yi, Biotechnology for biofuels 2015 - “...(pyruvate decarboxylase), ZMO1478 (6-phosphogluconolactonase), ZMO1496 (phosphoenolpyruvate carboxylase), ZMO1596 (Fe-containing alcohol dehydrogenase), ZMO1608 (phosphopyruvate hydratase), and ZMO1963 (citrate synthase). The primers for qRT-PCR of the genes are listed in Additional file 1 Our hierarchical cluster analysis showed two clear distinguished expression patterns for 1908 genes in the...”
- Discovery of ethanol-responsive small RNAs in Zymomonas mobilis
Cho, Applied and environmental microbiology 2014 - “...Hydroxylamine reductase (ZMO0117) Citrate synthase (ZMO1963) TonB-dependent receptor (ZMO0031) Zms4 Glutaredoxin-like protein (ZMO1873) CheX protein (ZMO0084)...”
- Elucidation of Zymomonas mobilis physiology and stress responses by quantitative proteomics and transcriptomics
Yang, Frontiers in microbiology 2014 - “...1.09 0.75 ZMO1885 NADH:flavin oxidoreductase/NADH oxidase 0.74 0.75 ZMO1956 DNA repair protein RecN 0.81 0.75 ZMO1963 Citrate synthase I 0.86 0.75 ZMO1970 3methyl2oxobutanoate hydroxymethyltransferase 0.69 0.90 ZMO1980 Methyltransferase GidB 0.78 0.70 ZMO1984 Aldo/keto reductase 0.96 1.15 ZMO1989 MethylatedDNA/proteincysteine methyltransferase 0.93 1.10 ZMO1992 Carboxymethylenebutenolidase 0.94 1.40 ZMO1993...”
- Transcriptome profiling of Zymomonas mobilis under ethanol stress
He, Biotechnology for biofuels 2012 - “...Citrate lyase 0.78 ZMO0569 SdhC 0.95 ZMO0705 BudB 1.03 ZMO1955 YqkJ 0.91 ZMO1307 FumA 0.76 ZMO1963 GltA 0.94 Induction and repression of cell envelope components under ethanol stress There are 32 ORFs (ZMO0602-ZMO0652: flgABCDEFGHIJKL, flhAB, fliDEFGHIKLMNPQRS, motAB) encoding flagellar structure proteins, motor proteins and biosynthesis proteins...”
HPG27_RS00145 citrate synthase from Helicobacter pylori G27
31% identity, 84% coverage
AL01_06255 citrate synthase from Bombella intestini
32% identity, 81% coverage
- Whole-Genome Sequence Analysis of Bombella intestini LMG 28161T, a Novel Acetic Acid Bacterium Isolated from the Crop of a Red-Tailed Bumble Bee, Bombus lapidarius
Li, PloS one 2016 - “...lactoylgluthathione lyase (AL01_00090); 18, pyruvate decarboxylase (AL01_08375); 19, alcohol dehydrogenase (AL01_01980, AL01_07015); 20, citrate synthase (AL01_06255); 21, aconitate hydratase 1 (AL01_06260); 22, NADP+-dependent isocitrate dehydrogenase (AL01_06250); 23, 2-oxoglutarate dehydrogenase E1 (AL01_08340); 24, dihydrolipoyllysine succinyltransferase (AL01_07740); 25, dihydrolipoamide dehydrogenase (AL01_00930); 26, fumarate hydratase (AL01_05840); 27, PQQ-dependent glucose...”
M271_31465 citrate synthase from Streptomyces rapamycinicus NRRL 5491
31% identity, 82% coverage
Cagg_3738 citrate synthase I from Chloroflexus aggregans DSM 9485
31% identity, 84% coverage
Mal4_25960 citrate synthase from Maioricimonas rarisocia
31% identity, 82% coverage
GL4_2103 citrate synthase from Methyloceanibacter caenitepidi
30% identity, 87% coverage
- Possible cross-feeding pathway of facultative methylotroph Methyloceanibacter caenitepidi Gela4 on methanotroph Methylocaldum marinum S8
Takeuchi, PloS one 2019 - “...mcl1 971 638 -0.61 0.000 GL4_0468 L-malyl-CoA/beta-methylmalyl-CoA lyase mcl2 50 237 2.22 0.000 TCA cycle GL4_2103 Citrate synthase citA 250 403 0.69 0.000 GL4_0055 Aconitate hydratase acnA 294 153 -0.94 0.000 GL4_1694 Isocitrate dehydrogenase icd 346 185 -0.90 0.000 GL4_0108 2-oxoglutarate dehydrogenase E1 component sucA 386...”
- “..., Table 1 ). In the TCA cycle, genes for citrate synthase ( citA , GL4_2103), malate dehydrogenase ( mdh , GL4_0105), succinyl-CoA synthethase ( sucC and sucD ; GL4_0106 and GL4_0107) and 2-oxoglutarate dehydrogenase (sucA and sucB; GL4_0108 and GL4_0109) were upregulated ( Fig 3...”
N1H47_14640 citrate synthase from Streptomyces noursei
30% identity, 83% coverage
- Transcriptional Analysis Revealing the Improvement of ε-Poly-L-lysine Production from Intracellular ROS Elevation after Botrytis cinerea Induction
Zhang, Journal of fungi (Basel, Switzerland) 2024 - “...real-time PCR (qRT-PCR). The transcriptional levels of genes ( zwf , N1H47_01765 , N1H47_21215 , N1H47_14640 , N1H47_16885 , N1H47_34205 , N1H47_11760 , N1H47_11815 , N1H47_25630 , N1H47_35560 ) were measured with real-time fluorescent quantitative PCR (ABI Stepone plus, Applied Biosystems, Waltham, MA, USA) with SG...”
- “...ROS in the LOS resulted in the increased transcription of genes encoding citrate synthase ( N1H47_14640 ), 2-oxoglutarate dehydrogenase E1 component ( N1H47_26000 ), succinyl-CoA synthase ( sucC , sucD ), and succinate dehydrogenase ( N1H47_11475 ). The gene encoding phosphoenolpyruvate carboxylase ( N1H47_01765 ) was...”
- Transcriptome and Metabolome Analysis Revealing the Improved ε-Poly-l-Lysine Production Induced by a Microbial Call from Botrytis cinerea
Zeng, Applied and environmental microbiology 2022 (secret)
2ifcC / P21553 The structure of the binary complex of oxalateacetate with citrate synthase from the thermophilic archaeon thermolasma acidophilum
32% identity, 95% coverage
- Ligand: oxaloacetate ion (2ifcC)
SBI_07003 citrate synthase from Streptomyces bingchenggensis BCW-1
31% identity, 83% coverage
Mal48_29080 citrate synthase from Thalassoglobus polymorphus
30% identity, 85% coverage
Ta0819 probable citrate (si)-synthase from Thermoplasma acidophilum DSM 1728
32% identity, 94% coverage
- Crystal Structures of Two Isozymes of Citrate Synthase from Sulfolobus tokodaii Strain 7
Murakami, Biochemistry research international 2016 - “...36 , 37 ]. For another example, Thermoplasma acidophilum has two CS genes, Ta0169 and Ta0819, which share rather high sequence identity of 68%; thus they might show similar conformation and function similarly to each other [ 38 ]. Therefore we needed to express and purify...”
- Identification and functional verification of archaeal-type phosphoenolpyruvate carboxylase, a missing link in archaeal central carbohydrate metabolism
Ettema, Journal of bacteriology 2004 - “...MTH962 PF0203 Faci02000612, Faci02001586 PTO0889, PTO0169 TA0169, TA0819 TVN0239 SSO1254 APE0311 CTLf 2301 APE1713 PAE3585 PAE3586e PAE1689 SSO2589 ST1805,...”
PD0750 citrate synthase from Xylella fastidiosa Temecula1
31% identity, 84% coverage
XF1535 citrate synthase from Xylella fastidiosa 9a5c
30% identity, 84% coverage
RL2509 putative citrate synthase I from Rhizobium leguminosarum bv. viciae 3841
33% identity, 96% coverage
- Role of O2 in the Growth of Rhizobium leguminosarum bv. viciae 3841 on Glucose and Succinate
Wheatley, Journal of bacteriology 2017 - “...pgl zwf gpmB zwf gltA eno pdhA pdhC RL2508 RL2509 RL2513 gltA citA tpiA RL2631 RL2701 RL2703 RL4007 RL4011 RL4060 RL4114 RL4115 RL4116 RL4117 RL4118 RL4162...”
- “...candidate citrate synthase genes are present in Rlv3841: RL2508, RL2509, and RL2234 (12) (Table 2). On succinate at 21% O2, mutation of either RL2234 or RL2509...”
- The Use of Transposon Insertion Sequencing to Interrogate the Core Functional Genome of the Legume Symbiont Rhizobium leguminosarum
Perry, Frontiers in microbiology 2016 - “...synthase II GN 0.85 14.82 NE 1 13.54 NE 3.5.8 Putative citrate synthase II 3.2 RL2509 citA Citrate synthase 2 GN 0.8 19 NE 0.8 19.17 NE 3.5.8 Putative citrate synthase I 3.3 RL4536 acnA Aconitate hydratase GI 0.05 1 ES 0.05 1 ES 3.5.8 Putative...”
- Transcriptomic analysis of Rhizobium leguminosarum biovar viciae in symbiosis with host plants Pisum sativum and Vicia cracca
Karunakaran, Journal of bacteriology 2009 - “...putative citrate synthase genes (RL2234, RL2508, and RL2509), only RL2234 (annotated as ccsA) was strongly upregulated (threeto eightfold) in mature nodules....”
- The genome of Rhizobium leguminosarum has recognizable core and accessory components
Young, Genome biology 2006 - “...(see Additional data file 3). There are actually three candidate genes for citrate synthase (RL2508, RL2509, and RL2234) on the chromosome of Rlv3841. R. tropici has two citrate synthase genes, one of which, namely pcsA , is present on its pSym and affects nodulating ability and...”
GOX1999 Citrate synthase from Gluconobacter oxydans 621H
31% identity, 83% coverage
- Global mRNA decay and 23S rRNA fragmentation in Gluconobacter oxydans 621H
Kranz, BMC genomics 2018 - “...(GOX2015); glk , glucokinase (GOX2419); ( glk ), putative glucokinase (GOX1182); gltA , citrate synthase (GOX1999); gnd , 6-phosphogluconate dehydrogenase (GOX1705); gnk , gluconokinase (GOX1709); gno , gluconate 5-dehydrogenase (GOX2187); gpm phosphoglyceromutase (GOX0330); icd , isocitrate dehydrogenase (GOX1336); lpd , dihydrolipoamide dehydrogenase (GOX2292); mqo , malate:quinone...”
AOL_s00079g361 hypothetical protein from Orbilia oligospora ATCC 24927
30% identity, 74% coverage
- Genomic and proteomic analyses of the fungus Arthrobotrys oligospora provide insights into nematode-trap formation
Yang, PLoS pathogens 2011 - “...indicated by the enhanced expression of genes in the TCA cycle, such as citrate synthase (AOL_s00079g361), aconitase (AOL_s00110g24), isocitrate dehydrogenase (AOL_s00075g141), succinyl-CoA synthetase (AOL_s00043g45), and malate dehydrogenase (AOL_s00210g140 and AOL_s00215g565) ( Table S7 ). In addition, malate synthase (AOL_s00112g112) and isocitrate lyase (AOL_s00075g130), two key enzymes...”
- “...18. AOL_s00112g112; 19. AOL_s00170g104; 20. AOL_s00043g45; 21. AOL_s00110g24; 22. AOL_s00075g130; 23. AOL_s00075g141; 24. AOL_s00004g494; 25. AOL_s00079g361; 26. AOL_s00215g818; 27. AOL_s00054g909; 28. AOL_s00004g362; 29. AOL_s00097g268; 30. AOL_s00083g375; 31. AOL_s00076g129; 32. AOL_s00176g31; 33. AOL_s00176g31. (JPG) Click here for additional data file. Figure S5 The metabolite profile of the...”
P51040 Citrate synthase from Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
28% identity, 83% coverage
- Heparan sulfate-dependent phase separation of CCL5 and its chemotactic activity.
Yu, eLife 2024 - “...-CCL5-mut-R ynebrten et al., 2015 PCR primers TGGGTTGGCACACACTTGCGCGTTCGCCGCGGTGACAAAGACGACTGC Recombinant DNA reagent pET-28a Miao Ling Plasmid P51040 Chemical compound, drug Cy3-NHS ATT Bioquest 1023 Chemical compound, drug Heparin GlycoNovo C-HEPPIM Mw: 13.980 Da Cell line ( Homo sapiens ) HUVEC Pricella CL-0675 Cell line ( Cricetulus griseus...”
MMSR116_24135, MMSR116_RS23810 citrate synthase from Methylobacterium mesophilicum SR1.6/6
29% identity, 84% coverage
- Transcriptome and Secretome Analyses of Endophyte Methylobacterium mesophilicum and Pathogen Xylella fastidiosa Interacting Show Nutrient Competition
Dourado, Microorganisms 2023 - “...Uncharacterized protein 22 9 27|28 30 - MMSR116_RS09955 MMSR116_10120 Redoxin 17 11 31 - MMSR116_RS23810 MMSR116_24135 Citrate synthase 48 3 32 - MMSR116_RS14870 MMSR116_15050 Uncharacterized protein 17 16 36|37 33 - MMSR116_RS01755 MMSR116_01770 Alanine racemase domain-containing protein 40 12 34 15 MMSR116_RS14980 MMSR116_15160 Phosphoenolpyruvate carboxykinase PckA...”
- “...MMSR116_13100 Uncharacterized protein 22 9 27|28 30 - MMSR116_RS09955 MMSR116_10120 Redoxin 17 11 31 - MMSR116_RS23810 MMSR116_24135 Citrate synthase 48 3 32 - MMSR116_RS14870 MMSR116_15050 Uncharacterized protein 17 16 36|37 33 - MMSR116_RS01755 MMSR116_01770 Alanine racemase domain-containing protein 40 12 34 15 MMSR116_RS14980 MMSR116_15160 Phosphoenolpyruvate carboxykinase...”
CCNA_03757 citrate synthase from Caulobacter crescentus NA1000
33% identity, 98% coverage
- Mapping the IscR regulon sheds light on the regulation of iron homeostasis in <i>Caulobacter</i>
Dos, Frontiers in microbiology 2024 - “...above each figure. Gels were stained with ethidium bromide. (B) The promoter region of gene CCNA_03757 was used as a negative control. The arrow indicates the free probes. Created in BioRender. Santos, N. (2024) BioRender.com/x20p050 . We identified several relevant genes involved in iron homeostasis and...”
- Bacterial cell cycle control by citrate synthase independent of enzymatic activity
Bergé, eLife 2020 - “...crescentus genome. Indeed, BLAST searches revealed the presence of two other putative citrate synthase genes: CCNA_03757 and CCNA_03758 ( Figure 3figure supplement 1A ) (henceforth citB and citC , respectively), which were also annotated as non-essential for viability on PYE ( Christen et al., 2011 )....”
- “...RI /Hin dIII. pMB288 (pNTPS138- citB ) The plasmid construct used to delete citB ( CCNA_03757 ) was made by PCR amplification of two fragments:the first to amplify the upstream region of citB , a 550-bp fragment was amplified using primers OMB184 and OMB185, flanked by...”
SCO2736 citrate synthase from Streptomyces coelicolor A3(2)
30% identity, 83% coverage
- A Proteomic Analysis Indicates That Oxidative Stress Is the Common Feature Triggering Antibiotic Production in Streptomyces coelicolor and in the pptA Mutant of Streptomyces lividans
Lejeune, Frontiers in microbiology 2021 - “...abundant in Pi proficiency than in Pi limitation (group II). It includes the citrate synthase SCO2736, the aconitate hydratase SCO5999, the -ketoglutarate dehydrogenase E1 component SCO528 that generates NADH, and the subunit (SCO4808) of the succinyl-CoA synthase that generates guanosine triphosphate (GTP). Cluster C contains six...”
- Integrating perspectives in actinomycete research: an ActinoBase review of 2020-21
Undabarrena, Microbiology (Reading, England) 2021 - “...[ 78 ]. Remarkably, the strain carrying the same EQCi system targeting gltA gene ( sco2736 ) from the TCA cycle showed 850% more actinorhodin than the wild-type [ 78 ]. In summary, incorporating both the QS system and CRISPRi allows an adjustable, completely autonomous, and...”
- Developing an endogenous quorum-sensing based CRISPRi circuit for autonomous and tunable dynamic regulation of multiple targets in Streptomyces
Tian, Nucleic acids research 2020 - “...j23119 promoter was used to regulate the transcription of sgRNA targeting the gltA gene ( sco2736 ) in the TCA cycle. The strain carrying the above EQCi plasmid produced 850% higher actinorhodin titers than the controls ( Supplementary Figure S8 ). Overall, EQCi system-mediated dynamic regulation...”
- Expression of genes of the Pho regulon is altered in Streptomyces coelicolor
Millan-Oropeza, Scientific reports 2020 - “...cycle (TCA) and notably those of the upper part of the TCA, the citrate synthase SCO2736 and the aconitase SCO5999 as well as the NADP+ dependent malic enzyme SCO2951 47 , were more abundant in SL than in SC throughout growth on glucose and glycerol, to...”
- DNA mapping and kinetic modeling of the HrdB regulon in Streptomyces coelicolor
Šmídová, Nucleic acids research 2019 - “...glycolysis and TCA cycle, irrespective of the dependency of HrdB. Among others, citrate synthase CitA (SCO2736) has been previously shown to be crucial for maintaining the physiological balance of the cells. Its proper function is linked with cellular differentiation as its mutant loses abilities to form...”
- Global features of gene expression on the proteome and transcriptome levels in S. coelicolor during germination
Strakova, PloS one 2013 - “...38% of TCA cycle genes, including the subunits of succinyl CoA synthase (SCO4809,6586), citrate synthase (SCO2736), malate dehydrogenase (SCO4824) and acetyl transferase (SCO7123), for 22% of glycolysis genes and 25% of genes from pentose phosphate pathway. A significant correlation with PC1 was also found for mRNAs...”
- Metabolic switches and adaptations deduced from the proteomes of Streptomyces coelicolor wild type and phoP mutant grown in batch culture
Thomas, Molecular & cellular proteomics : MCP 2012 - “...SCO5077 SCO1947 SCO5624 SCO4711 SCO3906 SCO5625 SCO4809 SCO3909 SCO2736 SCO2180 SCO6279 98.03 90.81 88.81 87.87 85.6 85.28 74.36 60.02 58.93 58.67 57.36 56.52...”
- Rapid functional screening of Streptomyces coelicolor regulators by use of a pH indicator and application to the MarR-like regulator AbsC
Yang, Applied and environmental microbiology 2010 - “...genes encoding aconitase (SacA, SCO5999), citrate synthase (CitA, SCO2736) and the E1 Downloaded from http://aem.asm.org/ on February 12, 2017 by University of...”
- More
O33915 Citrate synthase from Rhizobium meliloti (strain 1021)
SMc02087 CITRATE SYNTHASE PROTEIN from Sinorhizobium meliloti 1021
30% identity, 84% coverage
For advice on how to use these tools together, see
Interactive tools for functional annotation of bacterial genomes.
The PaperBLAST database links 793,807 different protein sequences to 1,259,118 scientific articles. Searches against EuropePMC were last performed on March 13 2025.
PaperBLAST builds a database of protein sequences that are linked
to scientific articles. These links come from automated text searches
against the articles in EuropePMC
and from manually-curated information from GeneRIF, UniProtKB/Swiss-Prot,
BRENDA,
CAZy (as made available by dbCAN),
BioLiP,
CharProtDB,
MetaCyc,
EcoCyc,
TCDB,
REBASE,
the Fitness Browser,
and a subset of the European Nucleotide Archive with the /experiment tag.
Given this database and a protein sequence query,
PaperBLAST uses protein-protein BLAST
to find similar sequences with E < 0.001.
To build the database, we query EuropePMC with locus tags, with RefSeq protein
identifiers, and with UniProt
accessions. We obtain the locus tags from RefSeq or from MicrobesOnline. We use
queries of the form "locus_tag AND genus_name" to try to ensure that
the paper is actually discussing that gene. Because EuropePMC indexes
most recent biomedical papers, even if they are not open access, some
of the links may be to papers that you cannot read or that our
computers cannot read. We query each of these identifiers that
appears in the open access part of EuropePMC, as well as every locus
tag that appears in the 500 most-referenced genomes, so that a gene
may appear in the PaperBLAST results even though none of the papers
that mention it are open access. We also incorporate text-mined links
from EuropePMC that link open access articles to UniProt or RefSeq
identifiers. (This yields some additional links because EuropePMC
uses different heuristics for their text mining than we do.)
For every article that mentions a locus tag, a RefSeq protein
identifier, or a UniProt accession, we try to select one or two
snippets of text that refer to the protein. If we cannot get access to
the full text, we try to select a snippet from the abstract, but
unfortunately, unique identifiers such as locus tags are rarely
provided in abstracts.
PaperBLAST also incorporates manually-curated protein functions:
- Proteins from NCBI's RefSeq are included if a
GeneRIF
entry links the gene to an article in
PubMed®.
GeneRIF also provides a short summary of the article's claim about the
protein, which is shown instead of a snippet.
- Proteins from Swiss-Prot (the curated part of UniProt)
are included if the curators
identified experimental evidence for the protein's function (evidence
code ECO:0000269). For these proteins, the fields of the Swiss-Prot entry that
describe the protein's function are shown (with bold headings).
- Proteins from BRENDA,
a curated database of enzymes, are included if they are linked to a paper in PubMed
and their full sequence is known.
- Every protein from the non-redundant subset of
BioLiP,
a database
of ligand-binding sites and catalytic residues in protein structures, is included. Since BioLiP itself
does not include descriptions of the proteins, those are taken from the
Protein Data Bank.
Descriptions from PDB rely on the original submitter of the
structure and cannot be updated by others, so they may be less reliable.
(For SitesBLAST and Sites on a Tree, we use a larger subset of BioLiP so that every
ligand is represented among a group of structures with similar sequences, but for
PaperBLAST, we use the non-redundant set provided by BioLiP.)
- Every protein from EcoCyc, a curated
database of the proteins in Escherichia coli K-12, is included, regardless
of whether they are characterized or not.
- Proteins from the MetaCyc metabolic pathway database
are included if they are linked to a paper in PubMed and their full sequence is known.
- Proteins from the Transport Classification Database (TCDB)
are included if they have known substrate(s), have reference(s),
and are not described as uncharacterized or putative.
(Some of the references are not visible on the PaperBLAST web site.)
- Every protein from CharProtDB,
a database of experimentally characterized protein annotations, is included.
- Proteins from the CAZy database of carbohydrate-active enzymes
are included if they are associated with an Enzyme Classification number.
Even though CAZy does not provide links from individual protein sequences to papers,
these should all be experimentally-characterized proteins.
- Proteins from the REBASE database
of restriction enzymes are included if they have known specificity.
- Every protein with an evidence-based reannotation (based on mutant phenotypes)
in the Fitness Browser is included.
- Sequence-specific transcription factors (including sigma factors and DNA-binding response regulators)
with experimentally-determined DNA binding sites from the
PRODORIC database of gene regulation in prokaryotes.
- Putative transcription factors from RegPrecise
that have manually-curated predictions for their binding sites. These predictions are based on
conserved putative regulatory sites across genomes that contain similar transcription factors,
so PaperBLAST clusters the TFs at 70% identity and retains just one member of each cluster.
- Coding sequence (CDS) features from the
European Nucleotide Archive (ENA)
are included if the /experiment tag is set (implying that there is experimental evidence for the annotation),
the nucleotide entry links to paper(s) in PubMed,
and the nucleotide entry is from the STD data class
(implying that these are targeted annotated sequences, not from shotgun sequencing).
Also, to filter out genes whose transcription or translation was detected, but whose function
was not studied, nucleotide entries or papers with more than 25 such proteins are excluded.
Descriptions from ENA rely on the original submitter of the
sequence and cannot be updated by others, so they may be less reliable.
Except for GeneRIF and ENA,
the curated entries include a short curated
description of the protein's function.
For entries from BioLiP, the protein's function may not be known beyond binding to the ligand.
Many of these entries also link to articles in PubMed.
For more information see the
PaperBLAST paper (mSystems 2017)
or the code.
You can download PaperBLAST's database here.
Changes to PaperBLAST since the paper was written:
- November 2023: incorporated PRODORIC and RegPrecise. Many PRODORIC entries were not linked to a protein sequence (no UniProt identifier), so we added this information.
- February 2023: BioLiP changed their download format. PaperBLAST now includes their non-redundant subset. SitesBLAST and Sites on a Tree use a larger non-redundant subset that ensures that every ligand is represented within each cluster. This should ensure that every binding site is represented.
- June 2022: incorporated some coding sequences from ENA with the /experiment tag.
- March 2022: incorporated BioLiP.
- April 2020: incorporated TCDB.
- April 2019: EuropePMC now returns table entries in their search results. This has expanded PaperBLAST's database, but most of the new entries are of low relevance, and the resulting snippets are often just lists of locus tags with annotations.
- February 2018: the alignment page reports the conservation of the hit's functional sites (if available from from Swiss-Prot or UniProt)
- January 2018: incorporated BRENDA.
- December 2017: incorporated MetaCyc, CharProtDB, CAZy, REBASE, and the reannotations from the Fitness Browser.
- September 2017: EuropePMC no longer returns some table entries in their search results. This has shrunk PaperBLAST's database, but has also reduced the number of low-relevance hits.
Many of these changes are described in Interactive tools for functional annotation of bacterial genomes.
PaperBLAST cannot provide snippets for many of the papers that are
published in non-open-access journals. This limitation applies even if
the paper is marked as "free" on the publisher's web site and is
available in PubmedCentral or EuropePMC. If a journal that you publish
in is marked as "secret," please consider publishing elsewhere.
Many important articles are missing from PaperBLAST, either because
the article's full text is not in EuropePMC (as for many older
articles), or because the paper does not mention a protein identifier such as a locus tag, or because of PaperBLAST's heuristics. If you notice an
article that characterizes a protein's function but is missing from
PaperBLAST, please notify the curators at UniProt
or add an entry to GeneRIF.
Entries in either of these databases will eventually be incorporated
into PaperBLAST. Note that to add an entry to UniProt, you will need
to find the UniProt identifier for the protein. If the protein is not
already in UniProt, you can ask them to create an entry. To add an
entry to GeneRIF, you will need an NCBI Gene identifier, but
unfortunately many prokaryotic proteins in RefSeq do not have
corresponding Gene identifers.
References
PaperBLAST: Text-mining papers for information about homologs.
M. N. Price and A. P. Arkin (2017). mSystems, 10.1128/mSystems.00039-17.
Europe PMC in 2017.
M. Levchenko et al (2017). Nucleic Acids Research, 10.1093/nar/gkx1005.
Gene indexing: characterization and analysis of NLM's GeneRIFs.
J. A. Mitchell et al (2003). AMIA Annu Symp Proc 2003:460-464.
UniProt: the universal protein knowledgebase.
The UniProt Consortium (2016). Nucleic Acids Research, 10.1093/nar/gkw1099.
BRENDA in 2017: new perspectives and new tools in BRENDA.
S. Placzek et al (2017). Nucleic Acids Research, 10.1093/nar/gkw952.
The EcoCyc database: reflecting new knowledge about Escherichia coli K-12.
I. M. Keeseler et al (2016). Nucleic Acids Research, 10.1093/nar/gkw1003.
The MetaCyc database of metabolic pathways and enzymes.
R. Caspi et al (2018). Nucleic Acids Research, 10.1093/nar/gkx935.
CharProtDB: a database of experimentally characterized protein annotations.
R. Madupu et al (2012). Nucleic Acids Research, 10.1093/nar/gkr1133.
The carbohydrate-active enzymes database (CAZy) in 2013.
V. Lombard et al (2014). Nucleic Acids Research, 10.1093/nar/gkt1178.
The Transporter Classification Database (TCDB): recent advances
M. H. Saier, Jr. et al (2016). Nucleic Acids Research, 10.1093/nar/gkv1103.
REBASE - a database for DNA restriction and modification: enzymes, genes and genomes.
R. J. Roberts et al (2015). Nucleic Acids Research, 10.1093/nar/gku1046.
Deep annotation of protein function across diverse bacteria from mutant phenotypes.
M. N. Price et al (2016). bioRxiv, 10.1101/072470.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory