PaperBLAST
PaperBLAST Hits for CharProtDB::CH_088329 PTS system mannose-specific EIIAB component; EC 2.7.1.-; EC 2.7.1.69 (Escherichia coli K12) (323 a.a., MTIAIVIGTH...)
Show query sequence
>CharProtDB::CH_088329 PTS system mannose-specific EIIAB component; EC 2.7.1.-; EC 2.7.1.69 (Escherichia coli K12)
MTIAIVIGTHGWAAEQLLKTAEMLLGEQENVGWIDFVPGENAETLIEKYNAQLAKLDTTK
GVLFLVDTWGGSPFNAASRIVVDKEHYEVIAGVNIPMLVETLMARDDDPSFDELVALAVE
TGREGVKALKAKPVEKAAPAPAAAAPKAAPTPAKPMGPNDYMVIGLARIDDRLIHGQVAT
RWTKETNVSRIIVVSDEVAADTVRKTLLTQVAPPGVTAHVVDVAKMIRVYNNPKYAGERV
MLLFTNPTDVERLVEGGVKITSVNVGGMAFRQGKTQVNNAVSVDEKDIEAFKKLNARGIE
LEVRKVSTDPKLKMMDLISKIDK
Running BLASTp...
Found 224 similar proteins in the literature:
ManX / b1817 mannose-specific PTS enzyme IIAB component (EC 2.7.1.191; EC 2.7.1.199; EC 2.7.1.193) from Escherichia coli K-12 substr. MG1655 (see 12 papers)
manX / P69797 mannose-specific PTS enzyme IIAB component from Escherichia coli (strain K12) (see 9 papers)
PTNAB_ECOLI / P69797 PTS system mannose-specific EIIAB component; EIIAB-Man; EIII-Man; EC 2.7.1.191 from Escherichia coli (strain K12) (see 10 papers)
TC 4.A.6.1.1 / P69797 PTNA aka MANX aka PTSL aka GPTB aka B1817, component of The mannose (glucose, 2-deoxyglucose, glucosamine, N-acetylglucosamine, N-acetylmannosamine, mannosamine and fructose) PTS porter/group translocator, ManXYZ (Rephaeli and Saier 1980; Plumbridge 2015). Catalyzes xylose facilitated diffusion in lactobacilli. The order of D-sugar substrate affinities is: glucose > mannose > 2-deoxyglucose > N-acetylglucosamine > glucosamine > N-acetylmannosamine > mannosamine > fructose from Escherichia coli (see 10 papers)
manX / RF|NP_416331.1 PTS system mannose-specific EIIAB component; EC 2.7.1.-; EC 2.7.1.69 from Escherichia coli K12 (see 10 papers)
NP_416331 mannose-specific PTS enzyme IIAB component from Escherichia coli str. K-12 substr. MG1655
P69799 PTS system mannose-specific EIIAB component from Escherichia coli O157:H7
b1817 fused mannose-specific PTS enzymes: IIA component/IIB component from Escherichia coli str. K-12 substr. MG1655
ECs2527 mannose-specific PTS enzyme IIAB from Escherichia coli O157:H7 str. Sakai
SF5M90T_1379 PTS mannose transporter subunit IIAB from Shigella flexneri 5a str. M90T
100% identity, 100% coverage
- function: The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. The enzyme II ManXYZ PTS system is involved in mannose transport.
function: Also functions as a receptor for bacterial chemotaxis and is required for infection of the cell by bacteriophage lambda where it most likely functions as a pore for penetration of lambda DNA.
catalytic activity: D-mannose(out) + N(pros)-phospho-L-histidyl-[protein] = D- mannose 6-phosphate(in) + L-histidyl-[protein] (RHEA:49232)
subunit: Homodimer. - substrates: D-2-deoxyglucose, D-N-acetyglucosamine, D-N-acetylmannosamine, D-fructose, D-glucosamine, D-glucose, D-mannosamine, D-mannose
tcdb comment: The mechanism appears to be rapid equilibrium, random, bi-bi sequential (Rephaeli and Saier 1980). L-sugars are not transported - Visualization of the phosphorylated active site loop of the cytoplasmic B domain of the mannitol transporter II(Mannitol) of the Escherichia coli phosphotransferase system by NMR spectroscopy and residual dipolar couplings.
Suh, Journal of molecular biology 2005 (PubMed)- GeneRIF: solution structure of a stably phosphorylated form of the cytoplasmic B domain of (IIB(Mtl)) of the E coli phosphotransferase system, containing a mutation of the active site Cys384 to Ser, solved by NMR
- Comparing the predicted and observed properties of proteins encoded in the genome of Escherichia coli K-12.
Link, Electrophoresis 1997 (PubMed)- GeneRIF: N-terminus verified by Edman degradation on mature peptide
- The Role of Propionate-Induced Rearrangement of Membrane Proteins in the Formation of the Virulent Phenotype of Crohn's Disease-Associated Adherent-Invasive Escherichia coli
Pobeguts, International journal of molecular sciences 2024 - “...P10384 Outer membrane protein Fadl 80 3.97 0.52 P02930 Outer membrane protein TolC 2.84 0.37 P69797 Mannose transprter ManX 153 2.31 0.30 P10346 glutamine ABC transporter ATP-binding protein GlnQ 91 3.05 0.40 Biosynthesis and binding of the siderophore enterobactin P0ADI4 Enterochelin synthase component B EntB 179...”
- The Thioredoxin Fold Protein (TFP2) from Extreme Acidophilic Leptospirillum sp. CF-1 Is a Chaperedoxin-like Protein That Prevents the Aggregation of Proteins under Oxidative Stress
Muñoz-Villagrán, International journal of molecular sciences 2024 - “...kinase ndk 5.03 0.004 P0A7E5 CTP synthetase pyrG 1.65 0.017 G. Carbohydrate transport and metabolism P69797 mannose-specific PTS enzyme IIAB component manX 7.37 0.000 P37188 galactitol-specific PTS enzyme IIB component gatB 9.14 0.002 P0C8J8 putative tagatose-1.6-bisphosphate aldolase 2 chaperone gatZ 9.20 0.003 P0C8J6 tagatose-1.6-bisphosphate aldolase 2...”
- Progress toward Proteome-Wide Photo-Cross-Linking to Enable Residue-Level Visualization of Protein Structures and Networks In Vivo
Faustino, Analytical chemistry 2023 (secret) - A bottom-up approach towards a bacterial consortium for the biotechnological conversion of chitin to L-lysine
Vortmann, Applied microbiology and biotechnology 2021 - “...and S3). Deletion of genes encoding the proteins NagE (P09323) (Primer 1 and 2), ManXYZ (P69797, P69801, P69805) (Primer 3 and 4), ChbBCA (P69795, P17334, P69791) (Primer 5 and 6), LysA (P00861) (Primer 7 and 8), and Lpp (P69776) (Primer 9 & 10) in the substrate...”
- Moonlighting protein prediction using physico-chemical and evolutional properties via machine learning methods.
Shirafkan, BMC bioinformatics 2021 - “...an appropriate candidate for the outlier. Among the outlier proteins, there were non-MPs (such as P69797) that have been misclassified in 8 different classification methods with 16 different feature vectors. Because these proteins have been obtained by computational methods, the results of this study could reduce...”
- “...are taken into consideration, proteins O75821 and P69786 will be found in10 feature vectors and P69797 in 9 feature vectors. Research shows that proteins P69786 and P69797 have been identified as non-MP proteins. One of the hypotheses that this study can make is that these two...”
- Exposure of E. coli to DNA-Methylating Agents Impairs Biofilm Formation and Invasion of Eukaryotic Cells via Down Regulation of the N-Acetylneuraminate Lyase NanA
Di, Frontiers in microbiology 2016 - “...2314 0.0039 aspartate ammonia-lyase aspA P0AC38 1.53 3125 0.0028 PTS system mannose-specific EIIAB component manX P69797 1.53 2041 0.0014 Bifunctional purine biosynthesis protein PurH purH P15639 1.53 3125 0.0028 L-threonine dehydratase catabolic TdcB tdcB P0AGF6 1.51 2562 0.0061 Thymidine phosphorylase deoA P07650 1.39 3005 0.0041 Aspartateammonia...”
- The T4 phage DNA mimic protein Arn inhibits the DNA binding activity of the bacterial histone-like protein H-NS
Ho, The Journal of biological chemistry 2014 - “...mannose-specific EIIAB component Elongation factor Tu 1 P0A9S3 P69797 A7ZSL4 7,461/121 4,165/72 2,766/45 67 86 80 Band 3 Elongation factor Tu 1 Isocitrate...”
- The Escherichia coli proteome: past, present, and future prospects
Han, Microbiology and molecular biology reviews : MMBR 2006 - “...isomerase 5.29/42,849.95 5.16/50,629 (5-6) ManX P69797 PTS system mannose-specific IIAB component 5.74/34,916.36 5.17/26,187 (4.5-5.5) Map P0AE18...”
- Protein Citrullination by Peptidyl Arginine Deiminase/Arginine Deiminase Homologs in Members of the Human Microbiota and Its Recognition by Anti-Citrullinated Protein Antibodies
Pérez-Pérez, International journal of molecular sciences 2024 - “...rRNA. Moreover, for the mannose-specific EIIAB component of the 35 kDa PTS/manX system (Uniprot ID: P69799), an important active carbohydrate transport system, it also binds to 39 kDa glycerol dehydrogenase/gldA (Uniprot ID: P0A9S6) that catalyzes NAD-dependent oxidation. his enzyme allows microorganisms to use glycerol as a...”
- Peptidylarginine Deiminase Inhibitors Reduce Bacterial Membrane Vesicle Release and Sensitize Bacteria to Antibiotic Treatment
Kosgodage, Frontiers in cellular and infection microbiology 2019 - “...P14407 Fumarate hydratase class I, anaerobic fumB 15233 78.27 P0A9S6 Glycerol dehydrogenase gldA 220449 441.19 P69799 PTS system mannose-specific EIIAB component manX 94232 56.71 B7MRV6 Serine-tRNA ligase serS 16845 55.11 a Ions score is 10 * Log(P), where P is the probability that the observed match...”
- FastKnock: an efficient next-generation approach to identify all knockout strategies for strain optimization
Hassani, Microbial cell factories 2024 - “...Triple ACKr, GLCpts, PYK 0.56 54.88 b2296, b3115, b1849, b1819, b2415, b2416, b1621, b1101, b2417, b1817, b1818, b1854, b1676 DHAPT, GART, PPAKr Quadruple ACKr, ARGDC, GLCpts, PYK 0.56 64.72 b2296, b3115, b1849, b2938, b4117, b1819, b2415, b2416, b1621, b1101, b2417, b1817, b1818, b1854, b1676 GART, PPAKr,...”
- Effect of Global Regulators RpoS and Cyclic-AMP/CRP on the Catabolome and Transcriptome of Escherichia coli K12 during Carbon- and Energy-Limited Growth
Franchini, PloS one 2015 - “...component of a transport system 15.2 14.3 manX c , f , g , i b1817 PTS enzyme IIAB, mannose-specific 8.0 manY c , f , g b1818 PTS enzyme IIC, mannose-specific 15.1 manZ f , g , i b1819 PTS enzyme IID, mannose-specific 5.8 gatC...”
- 18th Congress of the European Hematology Association, Stockholm, Sweden, June 13–16, 2013
, Haematologica 2013 - Genomic SELEX for Hfq-binding RNAs identifies genomic aptamers predominantly in antisense transcripts
Lorenz, Nucleic acids research 2010 - “...(ECA) polysaccharide chain length modulation protein 1117 281 1 900 602 1 900 713 manX b1817 Antisense Fused mannose-specific PTS enzymes: IIA component/IIB component 635 267 3 729 119 3 729 264 xylF b3566 Sense d -xylose transporter subunit 1351 248 3 673 658 3 673...”
- DNA microarray-mediated transcriptional profiling of the Escherichia coli response to hydrogen peroxide
Zheng, Journal of bacteriology 2001 - “...yaeH manX ycgK b1020 b1165 b1498 b3917 b1376 b2425 b0163 b1817 b1178 14 14 14 12 12 12 12 11 10 Functionb Function unknown Chaperone, heat-inducible protein of...”
- Combined, functional genomic-biochemical approach to intermediary metabolism: interaction of acivicin, a glutamine amidotransferase inhibitor, with Escherichia coli K-12
Smulski, Journal of bacteriology 2001 - “...b0051 b2568 b0072 b0071 b3455 b3460 b3458 b4024 b4033 b1620 b1817 b1530 b2328 b3829 b4242 Fold induction 0.37 0.31 0.41 0.13 0.47 0.27 0.49 0.36 0.10 0.27 0.42...”
- Genome-wide transcriptional profiling of the Escherichia coli responses to superoxide stress and sodium salicylate
Pomposiello, Journal of bacteriology 2001 - “...b3212 b2947 b3510 b3509 b2237 b1732 b3604 b3603 b4129 b1817 b1818 b1531 b1532 b1530 b3028 b3601 b0578 b1482 b4376 b1897 b0932 b0903 b1014 b3506 b3284 b3908...”
- Global transcriptional response of Escherichia coli O157:H7 to growth transitions in glucose minimal medium
Bergholz, BMC microbiology 2007 - “...fadD 2.50 2 ECs2082 adhP 3.62 2 ECs2519 yoaC 2.05 2 ECs2084 rpsV 2.45 2 ECs2527 manX -2.95 1 ECs2086 osmC 2.01 2 ECs2528 manY -3.21 1 ECs2091 - 3.38 2 ECs2546 ydjX 4.09 2 ECs2092 - 3.70 2 ECs2560 eda -2.65 1 ECs2113 O157 -3.24...”
- RNA-seq analysis of the influence of anaerobiosis and FNR on Shigella flexneri
Vergara-Irigaray, BMC genomics 2014 - “...SF4250 treB PTS system trehalose(maltose)-specific transporter subunits IIBC 3.66 SF5M90T_4160 treC trehalase 6-P hydrolase 3.56 SF5M90T_1379 manX PTS enzyme IIAB, mannose-specific 3.36 SF5M90T_1378 manY PTS enzyme IIC, mannose-specific 3.11 SF5M90T_1377 manZ PTS enzyme IID, mannose-specific 2.89 SF5M90T_3670 rbsD high affinity ribose transport protein 2.71 SF5M90T_1101 ptsG...”
Z2860 PTS enzyme IIAB, mannose-specific from Escherichia coli O157:H7 EDL933
100% identity, 100% coverage
SEN1207 PTS system, mannose-specific IIAB component from Salmonella enterica subsp. enterica serovar Enteritidis str. P125109
94% identity, 100% coverage
- Global transcriptomic analysis of ethanol tolerance response in Salmonella Enteritidis
He, Current research in food science 2022 - “...system glucitol/sorbitol-specific transporter subunit IIBC SEN3875 glpX 2.11 Fructose-1,6-bisphosphatase I SEN2676 srlD 10.51 Sorbitol-6-phosphate 2-dehydrogenase SEN1207 manX 2.61 PTS system mannose-specific transporter subunit IIAB SEN2137 fbaB 2.60 Fructose-bisphosphate aldolase, class I SEN1717 pfkB 3.33 6-phosphofructokinase 1 Two-component systems SEN0381 phoR 2.98 Phosphate regulon sensor protein SEN0380...”
- “...protein SEN3696 rbsA 9.10 D-ribose transporter ATP-binding protein SEN3695 rbsD 15.11 D-ribose pyranase Phosphotransferase systems SEN1207 manX 2.16 PTS system mannose-specific transporter subunit IIAB SEN1206 manY 5.13 Phosphotransferase enzyme II, C component SEN1205 manZ 6.52 PTS system mannose-specific transporter subunit IID SEN2197 fruA 3.09 Fructose PTS...”
SPAB_01384 hypothetical protein from Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7
94% identity, 100% coverage
STM1830 Sugar Specific PTS family, mannose-specific enzyme IIAB from Salmonella typhimurium LT2
STM14_2212 PTS mannose transporter subunit IIAB from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
94% identity, 100% coverage
- The ancestral SgrS RNA discriminates horizontally acquired Salmonella mRNAs through a single G-U wobble pair
Papenfort, Proceedings of the National Academy of Sciences of the United States of America 2012 - “...Gene ID Fold regulation* Fold regulation manX manY manZ STM1830 STM1831 STM1832 -10.3 -12.4 -5.5 -34.9 -20.2 -13.1 ptsG STM1203 -10.2 -7.1 sopD yigL STM2945...”
- PoxA, yjeK, and elongation factor P coordinately modulate virulence and drug resistance in Salmonella enterica
Navarre, Molecular cell 2010 - “...synthetase GlnA. Forms glutamine from ammonia and glutamate with the conversion of ATP to ADP. STM1830 manX 4.89 0.011 Mannose-specific enzyme IIAB. Imports hexoses (including mannose, glucose, glucosamine, and fructose), releasing the phosphate esters into the cell cytoplasm in preparation for metabolism, primarily via glycolysis. STM4581...”
- Integrative DNA methylome and transcriptome analysis reveals DNA adenine methylation is involved in Salmonella enterica Typhimurium response to oxidative stress
Zhang, Microbiology spectrum 2023 - “...transporter STM14_1053 0.90 0.014 Hypothetical protein STM14_1053 STM14_1388 ycfR 0.68 0.05 Putative outer membrane protein STM14_2212 manX 0.82 0.024 Mannose-specific enzyme IIAB STM14_2213 manY 0.83 0.022 Mannose-specific enzyme IIC STM14_2492 0.93 0.0021 Hypothetical protein STM14_2492 STM14_2773 0.79 0.033 Putative outer membrane protein STM14_3625 0.77 0.045 Hypothetical...”
SARI_01110 hypothetical protein from Salmonella enterica subsp. arizonae serovar 62:z4,z23:--
93% identity, 100% coverage
NT01EI_1721 mannose-specific phosphotransferase system component iiab from Edwardsiella ictaluri 93-146
82% identity, 100% coverage
PMPD1_2421 PTS mannose transporter subunit IIAB from Paramixta manurensis
86% identity, 99% coverage
ETAE_1559 PTS system, mannose-specific IIAB component from Edwardsiella tarda EIB202
82% identity, 100% coverage
YPO1758 PTS system, mannose-specific IIAB component from Yersinia pestis CO92
YPTB1634 PTS system, mannose-specific IIAB component from Yersinia pseudotuberculosis IP 32953
81% identity, 100% coverage
- Phylogeny and Classification of Yersinia pestis Through the Lens of Strains From the Plague Foci of Commonwealth of Independent States
Kutyrev, Frontiers in microbiology 2018 - “...antique bv. using PCR and SNP typing. We have detected 0.ANT3 strains, containing SNP in YPO1758 locus (Supplementary Tables S3A,B ). However, we were unable to assign a large number of strains using the SNPs, marker for 0.ANT1, 0.ANT2, and 0.ANT3 branches. Whole-genome sequencing of four...”
- Yersinia pestis strains of ancient phylogenetic branch 0.ANT are widely spread in the high-mountain plague foci of Kyrgyzstan
Eroshenko, PloS one 2017 - “...0.ANT1 (in YPO1404 and YPO2011 loci), 0.ANT2 (in YPO400 and YPO1545 loci) and 0.ANT3 (in YPO1758 locus) were used. No strains of 0.ANT1 branch among those from Kyrgyzstan were detected. However, we have found the strains of 0.ANT2 and 0.ANT3 branches among them. Strains of 0.ANT2...”
- Growth of Yersinia pseudotuberculosis in human plasma: impacts on virulence and metabolic gene expression
Rosso, BMC microbiology 2008 - “...putative anaerobic ribonucleotide reductase activating protein 0.440 (0.001) 0.508 (0.019) Mannose and glucose uptake YPTB1634 YPO1758 manX probable PTS system, mannose-specific IIAB component 2.673 (< 0.001) 3.234 (< 0.001) YPTB1633 YPO1757 manY probable PTS system, mannose-specific IIC component 1.991 (0.006) 2.201 (< 0.001) YPTB1632 YPO1756 manZ...”
- “...3.084 (< 0.001) YPTB1633 (manY) YPO1757 PTS system. mannose-specific IIC component 1.991 (0.005) YPTB1634 (manX) YPO1758 PTS system. mannose-specific IIAB component 2.674 (< 0.001) YPTB1687 YPO1814 putative sugar ABC transporter. ATP-binding protein 1.865 (0.016) YPTB1930 YPO1932 putative sugar transporteR 1.963 (0.002) YPTB1975 YPO1982 putative dehydrogenase 0.63...”
- Growth of Yersinia pseudotuberculosis in human plasma: impacts on virulence and metabolic gene expression
Rosso, BMC microbiology 2008 - “...nrdG putative anaerobic ribonucleotide reductase activating protein 0.440 (0.001) 0.508 (0.019) Mannose and glucose uptake YPTB1634 YPO1758 manX probable PTS system, mannose-specific IIAB component 2.673 (< 0.001) 3.234 (< 0.001) YPTB1633 YPO1757 manY probable PTS system, mannose-specific IIC component 1.991 (0.006) 2.201 (< 0.001) YPTB1632 YPO1756...”
- “...IID component 3.084 (< 0.001) YPTB1633 (manY) YPO1757 PTS system. mannose-specific IIC component 1.991 (0.005) YPTB1634 (manX) YPO1758 PTS system. mannose-specific IIAB component 2.674 (< 0.001) YPTB1687 YPO1814 putative sugar ABC transporter. ATP-binding protein 1.865 (0.016) YPTB1930 YPO1932 putative sugar transporteR 1.963 (0.002) YPTB1975 YPO1982 putative...”
YE1777 PTS system, mannose-specific IIAB component from Yersinia enterocolitica subsp. enterocolitica 8081
80% identity, 100% coverage
SG1327 PTS system mannose-specific IIAB component ManX from Sodalis glossinidius str. 'morsitans'
79% identity, 99% coverage
- Heme-induced genes facilitate endosymbiont (Sodalis glossinidius) colonization of the tsetse fly (Glossina morsitans) midgut
Runyen-Janecky, PLoS neglected tropical diseases 2022 - “...phosphotransferase systems (PTS) for sugar transport, including SG2041-SG2042 (PTS system component in the L-Ascorbate family), SG1327 (the first gene in an operon for a PTS system in the D-mannose family), and SG2427-SG2428 (PTS system, unassigned family). Finally, SG1701 , which encodes a homologue of PtsH that...”
- “...Furthermore, the first gene in an operon that encodes the promiscuous PTS sugar transporter ( SG1327 , ManX), and SG1701 , which encodes a putative homologue of a common component in all PTS sugar transport systems (PtsH), were induced in Sgm under high heme conditions [...”
MS0618 Hypothetical protein from Mannheimia succiniciproducens MBEL55E
64% identity, 98% coverage
ASUC_RS04870, CBG46_00530 PTS mannose transporter subunit IIAB from Actinobacillus succinogenes 130Z
63% identity, 99% coverage
- Comparative Transcriptome Analysis Reveals the Molecular Mechanisms of Acetic Acid Reduction by Adding NaHSO<sub>3</sub> in <i>Actinobacillus succinogenes</i> GXAS137
Li, Polish journal of microbiology 2023 - “...essential roles in cell NADH regeneration. Two kinds of sugar phosphotransferase system (PTS) transporter genes (CBG46_00530 and CBG46_03170) and maltose ATP-binding cassette (ABC) transporter gene were up-regulated (log 2 FC 1.5), which are conducive to the absorption of carbohydrates. ATPase (CBG46_04725) was highly up-regulated (log 2...”
- “...bacteria to NaHSO 3 . The transcription levels of six genes (CBG46_00240, CBG46_03905, CBG46_00540, CBG46_03900, CBG46_00530, CBG46_03910) involved in the phosphotransferase system (PTS) pathway increased by 1.03, 1.35, 1.78, 1.36, 1.15 and 1.40 log 2 FC, respectively, which encoded phosphocarrier protein HPr and the three subunits...”
- One step forward, two steps back: Transcriptional advancements and fermentation phenomena in Actinobacillus succinogenes 130Z
Long, PloS one 2021 - “...in SA(+) and reference, G in SA(-)) at position 1004969 at the 5 end of ASUC_RS04870 ( Fig 5B ). Investigation into these mutations revealed the SNP had been previously shown to have no effect on SA production [ 49 ]. While the deletion would have...”
HD0768 mannose-specific phosphotransferase IIAB component from Haemophilus ducreyi 35000HP
59% identity, 98% coverage
CBG46_03910 mannose/fructose/sorbose PTS transporter subunit IIA from Actinobacillus succinogenes
44% identity, 95% coverage
- Comparative Transcriptome Analysis Reveals the Molecular Mechanisms of Acetic Acid Reduction by Adding NaHSO<sub>3</sub> in <i>Actinobacillus succinogenes</i> GXAS137
Li, Polish journal of microbiology 2023 - “...to NaHSO 3 . The transcription levels of six genes (CBG46_00240, CBG46_03905, CBG46_00540, CBG46_03900, CBG46_00530, CBG46_03910) involved in the phosphotransferase system (PTS) pathway increased by 1.03, 1.35, 1.78, 1.36, 1.15 and 1.40 log 2 FC, respectively, which encoded phosphocarrier protein HPr and the three subunits (EIIC,...”
1vrcB / P69797 Complex of enzyme iiamannose and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure (see paper)
100% identity, 40% coverage
- Ligand: phosphite ion (1vrcB)
X276_23245 mannose/fructose/sorbose PTS transporter subunit IIA from Clostridium beijerinckii NRRL B-598
44% identity, 98% coverage
- Transcriptional analysis of amino acid, metal ion, vitamin and carbohydrate uptake in butanol-producing Clostridium beijerinckii NRRL B-598
Vasylkivska, PloS one 2019 - “...subunits and non-PTS systems) were not expressed during T1-T3, except for mannose PTS EII genes X276_23245- X276_23235 and X276_02990- X276_02975 ( Fig 5 , S5 File , S7 File ). Mannose EII-encoding genes were the ones with the highest number of mapped reads in the whole...”
- Acidogenesis, solventogenesis, metabolic stress response and life cycle changes in Clostridium beijerinckii NRRL B-598 at the transcriptomic level
Patakova, Scientific reports 2019 - “...other hand, two clusters of genes coding the putative mannose family of enzyme II proteins (X276_23245- X276_23235 and X276_02990- X276_02975) were highly expressed (see Fig. 2B ) through the course of cultivation, despite no mannose being present in the medium. This suggested that these mannose PTS...”
Cbei_0711 PTS system mannose/fructose/sorbose family IIA subunit from Clostridium beijerincki NCIMB 8052
43% identity, 98% coverage
WP_043709678 mannose/fructose/sorbose PTS transporter subunit IIB from Weissella cibaria
43% identity, 98% coverage
OG1RF_10019 mannose/fructose/sorbose PTS transporter subunit IIA from Enterococcus faecalis OG1RF
Q839X9 PTS system mannose-specific EIIAB component from Enterococcus faecalis (strain ATCC 700802 / V583)
EF0020 PTS system, mannose-specific IIAB components from Enterococcus faecalis V583
43% identity, 96% coverage
- Purine and carbohydrate availability drive Enterococcus faecalis fitness during wound and urinary tract infections
Tan, mBio 2024 - “...from 8 hpi wounds a Locus tag Name Description Log 2 FC P -value FDR OG1RF_10019 mptAB PTS mannose transporter subunit EIIAB 1.15 5.75E-06 2.11E-05 OG1RF_10020 mptC PTS mannose/fructose/sorbose transporter subunit IIC 0.92 3.54E-10 1.58E-09 OG1RF_10021 mptD PTS mannose transporter subunit IID 1.11 8.90E-18 7.46E-17 OG1RF_11489...”
- “...from 3 dpi wounds a Locus tag Name Description Log 2 FC P -value FDR OG1RF_10019 mptAB PTS mannose transporter subunit EIIAB 9.75 5.64E-05 2.93E-03 OG1RF_10020 mptC PTS mannose/fructose/sorbose transporter subunit IIC 10.36 3.81E-06 8.53E-05 OG1RF_10021 mptD PTS mannose transporter subunit IID 10.86 1.10E-08 6.29E-07 OG1RF_11280...”
- Genome Modification in Enterococcus faecalis OG1RF Assessed by Bisulfite Sequencing and Single-Molecule Real-Time Sequencing
Huo, Journal of bacteriology 2015 - “...substitutions that occur within the OG1RF_11594 and OG1RF_10019 (manX2) coding regions. We did not analyze these variations further. Modification motifs...”
- Gliotoxin-mediated bacterial growth inhibition is caused by specific metal ion depletion
Downes, Scientific reports 2023 - “...family 0.61846 0.026495 2 5.6 Q836Q1 PTS system mannose-specific EIIAB component 0.60834 0.007484 22 78.8 Q839X9 PTS system, mannose-specific IIC component 0.6067 0.018615 2 12.4 Q839X8 Table 9 Proteins which are uniquely present in E. faecalis when grown in the presence of gliotoxin (5 g/ml), compared...”
- Enterococcus faecalis Glycolipids Modulate Lipoprotein-Content of the Bacterial Cell Membrane and Host Immune Response
Theilacker, PloS one 2015 - “...family protein cell membrane EF0105 -1.613 Ornithine carbamoyltransferase. catabolic cytoplasmic EF0770 -1.628 Uncharacterized protein cytoplasmic EF0020 -1.639 PTS system. mannose specific IIAB components cytoplasmic EF2715 -1.642 50S ribosomal protein L7 L12 cytoplasmic EF2729 -1.689 Transcription termination antitermination protein nusG cytoplasmic EF0709 -1.708 Phosphocarrier protein HPr cytoplasmic...”
- Growth rate-dependent control in Enterococcus faecalis: effects on the transcriptome and proteome, and strong regulation of lactate dehydrogenase
Mehmeti, Applied and environmental microbiology 2012 - “...Primosomal DnaI 0.65 0.60 0.32 1.15 Energy metabolism EF0020 EF0195 EF0949 EF1125 EF1131 EF1167 EF1353 EF1354 EF1356 EF1416 EF1526 EF1612 EF1962 EF1963 EF1964...”
- Transcriptome, proteome, and metabolite analyses of a lactate dehydrogenase-negative mutant of Enterococcus faecalis V583
Mehmeti, Applied and environmental microbiology 2011 - “...February 11, 2017 by University of California, Berkeley EF0020 EF0043 EF0105 EF0146 EF0200 EF0233 EF0255 EF0282 Putative function Functional class VOL. 77, 2011...”
- “...ldh-1 L-Lactate EF0900 adhE Bifunctional acetaldehyde-CoA/alcohol dehydrogenase EF0020 EF0200 EF0282 EF0283 EF0517 EF1002 EF1167 EF2151 EF2550 EF3293 a b pdhA...”
- Intra- and interspecies genomic transfer of the Enterococcus faecalis pathogenicity island
Laverde, PloS one 2011 - “...EF0016 + + + + EF0017 + + + + EF0019 + + + + EF0020 + + + + EF0021 + + + + 3a + + + + 3b + + + + 4a + + + + EF0046 + + + + 4b...”
- Identification of proteins related to the stress response in Enterococcus faecalis V583 caused by bovine bile
Bøhle, Proteome science 2010 - “...EF0709 9.3 4.92 13 11 0.99 0.70 0.52 7 e PTS system, mannose-specific IIAB components EF0020 35.5 5.11 50 22 1.62 3.06 0.90 8 peptide ABC transporter, ATP-binding protein EF0912 35.9 5.97 20 7 1.10 1,00 0.46 9 e Amino acid biosynthesis Ornithine carbamoyltransferase EF0105 38.1...”
- “...these 19 proteins, discrepancies are observed in several cases, either at one time point (e.g. EF0020 & EF1499 at 120 minutes) or in the form of an overall trend (e.g. EF3184 and EF3186 where an increase in transcription does not seem to lead to an increase...”
- Class IIa bacteriocin resistance in Enterococcus faecalis V583: the mannose PTS operon mediates global transcriptional responses
Opsata, BMC microbiology 2010 - “...citE citE-R ACGGAGATAACACCGGAACC EF3320, citE dnaB-F TAGAAATGGGGGCAGAATCA EF0013, dnaB dnaB-R ATTCGCACGGGACAAACTAC EF0013, dnaB mptAB-F TGACCTATGGGGAGGAACAC EF0020, mptAB mptAB-R GTCGCAATTTCTTGTGCTGA EF0020, mptAB mptC-F ATTCGTATTGCGATTCCAGCA EF0021, mptC mptC-R TGCATAACCTACGGCAACGAC EF0021, mptC mptD-F TCGTTGGTCATTCATGTGGT EF0022, mptD mptD-R GTTGAACTAATGCGGCCAGT EF0022, mptD mptDi-F GAAGGAGGAGCAAAGAAAATGGCA EF0022, mptD mptDi-R CACCGACACCGGCTAAAGGAC EF0022, mptD mptO-F...”
- “...Quantitative RT-PCR Gene ID Gene Log 2 ratio Log 2 ratio EF0013 dnaB 0.02 0.04 EF0020 mptAB -2.80 -2.07 EF0021 mptC -0.68 -3.07 EF0022 mptD -1.70 -2.48 EF0024 manO -0.59 -3.29 EF0105 argF-1 3.06 3.83 EF0106 araC 3.02 3.28 EF0633 tyrS-1 -0.82 -1.46 EF1963 pgk -1.53...”
- Survey of genomic diversity among Enterococcus faecalis strains by microarray-based comparative genomic hybridization
Aakra, Applied and environmental microbiology 2007 - “...(pgi) EF1129 EF1928 EF1929 (glpK) EF0954-EF0958 EF0411-EF0413 EF0020 EF0021 EF0022 EF2589 (manA) EF0451 EF0466 (nagB) EF3044 (nagA2) EF0433 EF0434 (rhaA) EF0435...”
- Transcriptional response of Enterococcus faecalis V583 to erythromycin
Aakra, Antimicrobial agents and chemotherapy 2005 - “...Transport and binding protein Transport and binding protein EF0020 EF0021 EF0022 EF0411 EF0553 EF0958 EF1012 EF1017 EF1018 EF1019 EF1336 EF1633 EF1801 EF2213...”
MS2379 Hypothetical protein from Mannheimia succiniciproducens MBEL55E
MS2379 mannose/fructose/sorbose PTS transporter subunit IIA from [Mannheimia] succiniciproducens MBEL55E
42% identity, 95% coverage
CEA_P0065 mannose/fructose/sorbose PTS transporter subunit IIA from Clostridium acetobutylicum EA 2018
CAP0066, CA_P0066 Mannose-specific phosphotransferase system component IIAB from Clostridium acetobutylicum ATCC 824
42% identity, 98% coverage
- Comparative genomic and transcriptomic analysis revealed genetic characteristics related to solvent formation and xylose utilization in Clostridium acetobutylicum EA 2018
Hu, BMC genomics 2011 - “...3.721454 5.987476 xylanase CEA_P0053 CA_P0054 4.25084 2.735168 2.447001 3.424303 3.598697 5.185082 xylanase/chitin deacetylase family protein CEA_P0065 CA_P0066 3.062167 1.145145 2.159875 4.902259 3.81378 2.953822 mannose-specific phosphotransferase system component IIAB CEA_P0066 CA_P0067 2.925021 1.579742 2.174524 4.883877 3.683632 2.826095 mannose/fructose-specific phosphotransferase system component IIC CEA_P0067 CA_P0068 3.006142 1.74298 2.611356...”
- Alleviation of Carbon Catabolite Repression through araR and xylR Inactivation in Clostridium acetobutylicum DSM 792
Delarouzée, Applied and environmental microbiology 2023 (secret) - Quantitative proteomic analysis of the influence of lignin on biofuel production by Clostridium acetobutylicum ATCC 824
Raut, Biotechnology for biofuels 2016 - “...the non-specific mannose PTS system. The components of the non-specific mannose PTS system are IIA (CA_P0066), IIC/D (CA_P0068) and 6--glucosidase (CA_C0743) (possibly associated with mannose PTS system). These were found to be up-regulated (ExpCL/ExpC). The data show that C. acetobutylicum possesses multiple cellobiose transport systems, as...”
- Elucidation of the roles of adhE1 and adhE2 in the primary metabolism of Clostridium acetobutylicum by combining in-frame gene deletion and a quantitative system-scale approach
Yoo, Biotechnology for biofuels 2016 (no snippet) - Comparative genomic and transcriptomic analysis revealed genetic characteristics related to solvent formation and xylose utilization in Clostridium acetobutylicum EA 2018
Hu, BMC genomics 2011 - “...5.987476 xylanase CEA_P0053 CA_P0054 4.25084 2.735168 2.447001 3.424303 3.598697 5.185082 xylanase/chitin deacetylase family protein CEA_P0065 CA_P0066 3.062167 1.145145 2.159875 4.902259 3.81378 2.953822 mannose-specific phosphotransferase system component IIAB CEA_P0066 CA_P0067 2.925021 1.579742 2.174524 4.883877 3.683632 2.826095 mannose/fructose-specific phosphotransferase system component IIC CEA_P0067 CA_P0068 3.006142 1.74298 2.611356 4.717371...”
- Intracellular butyryl phosphate and acetyl phosphate concentrations in Clostridium acetobutylicum and their implications for solvent formation
Zhao, Applied and environmental microbiology 2005 - “...Included in the BuP cluster are an operon (CAP0066 to CAP0068) with homology to the lev PTS operon in Bacillus subtilis (6), cellobiose-specific PTS...”
- Transcriptional analysis of butanol stress and tolerance in Clostridium acetobutylicum
Tomas, Journal of bacteriology 2004 - “...involved in acetate production, a phosphotransferase (CAP0066), phosphodiesterase (CAP0015), and a predicted dehydrogenase (CAC1480). Although the direction...”
LGAS_1795 Phosphotransferase system, mannose/fructose-specific component IIA from Lactobacillus gasseri ATCC 33323
39% identity, 97% coverage
- The PTS transporters of Lactobacillus gasseri ATCC 33323
Francl, BMC microbiology 2010 - “...and 21, respectively (Table 5 ). The amplified PTS 15 (LGAS_1669), 20 (LGAS_1778) and 21 (LGAS_1795) internal regions were 819 bp, 760 bp and 675 bp, respectively. The junction fragments for successful pMJM-4 integration were 999 bp and 1039 bp. The junction fragments for successful pMJM-5...”
D0R662 PTS system mannose-specific EIIAB component from Lactobacillus johnsonii (strain FI9785)
39% identity, 97% coverage
gbs0348 Unknown from Streptococcus agalactiae NEM316
SAK_0435 PTS system, IIAB component, mannose/fructose/sorbose family from Streptococcus agalactiae A909
41% identity, 95% coverage
LMOf2365_0113 PTS system, mannose-specific, IIAB component from Listeria monocytogenes str. 4b F2365
lmo0096 similar to PTS system mannose-specific, factor IIAB from Listeria monocytogenes EGD-e
43% identity, 98% coverage
- Catabolite control protein C contributes to virulence and hydrogen peroxide-induced oxidative stress responses in <i>Listeria monocytogenes</i>
Ogunleye, Frontiers in microbiology 2024 - “...component 2.7 1.9E-03 LMOf2365_0026 N-acetylgalactosamine permease IIC component 3.3 7.2E-05 LMOf2365_0044 Glutamine--fructose-6-phosphate aminotransferase 1.9 4.2E-03 LMOf2365_0113 ( manL ) PTS system mannose-specific EIIAB component fructose IIA component: PTS system sorbose subfamily IIB component 1.6 1.0E-03 LMOf2365_0114 PTS system mannose-specific EIIC component 2.4 9.5E-04 LMOf2365_0115 PTS system...”
- Transcriptomics of Listeria monocytogenes Treated With Olive Leaf Extract
Liu, Frontiers in microbiology 2021 - “...(Log 2 FC=5.71, 1.36, 1.47, and 1.13, respectively). At 24h post-treatment, 9 PTS-related genes (LMOf2365_0030, LMOf2365_0113, LMOf2365_0572, LMOf2365_0922, LMOf2365_1272, LMOf2365_2128, LMOf2365_2129, LMOf2365_2130, and LMOf2365_2292) were found to be differentially regulated; 7 of which were found to be downregulated in the presence of OLE while LMOf2365_2129 and...”
- The ribonuclease PNPase is a key regulator of biofilm formation in Listeria monocytogenes and affects invasion of host cells
Quendera, NPJ biofilms and microbiomes 2023 - “...formation, particularly by affecting the expression of genes involved in the metabolism of carbohydrates (e.g., lmo0096 and lmo0783 , encoding PTS components), of amino acids (e.g., lmo1984 and lmo2006 , encoding biosynthetic enzymes) and in the Agr quorum sensing-like system ( lmo0048-49 ). Moreover, we show...”
- “...pattern in terms of log 2 RPKM. e Read coverage plots of three upregulated ( lmo0096 , lmo0783 , lmo0784 ) and three downregulated genes ( lmo1984 , lmo1986 , lmo2006 ). lmo0783-0784 are shown in operon. Blue line corresponds to wild-type, while red line corresponds...”
- DegU-mediated suppression of carbohydrate uptake in Listeria monocytogenes increases adaptation to oxidative stress
Chen, Applied and environmental microbiology 2023 (secret) - Listeria monocytogenes GshF contributes to oxidative stress tolerance via regulation of the phosphoenolpyruvate-carbohydrate phosphotransferase system
Chen, Microbiology spectrum 2023 - “...lmo0027 PTS beta-glucoside transporter subunit IIABC lmo0034 2.34 Yes/down lmo0034 PTS cellbiose transporter subunit IIC lmo0096 2.26 Yes/down lmo0096 PTS mannose transporter subunit IIAB lmo0097 3.61 Yes/down lmo0097 PTS mannose transporter subunit IIC lmo0098 3.70 Yes/down lmo0098 PTS mannose transporter subunit IID lmo0298 4.86 Yes/down lmo0298...”
- Characterisation of the growth behaviour of Listeria monocytogenes in Listeria synthetic media
Schulz, Environmental microbiology reports 2023 - “...overlapping substrate specificities. For instance, the two PTS systems ManLMN (MptACD) and MpoABCD, encoded by lmo0096 0098 and lmo0784 0781 , respectively, are both involved in the transport of glucose and mannose (Ak et al., 2011 ; Stoll & Goebel, 2010 ). Inactivation of all PTS...”
- Colonisation dynamics of Listeria monocytogenes strains isolated from food production environments
Gray, Scientific reports 2021 - “...nagB G Glucosamine-6-phosphate deaminase 3.5.99.6 7453 48h lmo0956 fig|1639.4014.peg.2912 3.55 nagA G N-acetylglucosamine-6-phosphate deacetylase 3.5.1.25 lmo0096 fig|1639.4014.peg.505 3.03 G PTS system mannost-specific transporter subunits IIAB 2.7.1.191 lmo0097 fig|1639.4014.peg.506 2.99 G PTS system mannose-specific IIC component Lmo0783 fig|1639.4014.peg.1297 4.18 manX G PTS system mannose-specific IIAB component 2.7.1.191...”
- Transcriptomic and Phenotypic Analyses of the Sigma B-Dependent Characteristics and the Synergism between Sigma B and Sigma L in Listeria monocytogenes EGD-e
Mattila, Microorganisms 2020 - “...at 37 C. The transcriptome microarray data were validated on a selection of genes ( lmo0096 , lmo0137 , lmo0685, and lmo2625 ) using quantitative real-time reverse-transcription PCR (RT-qPCR). The expression levels of this gene selection in the microarray data were in line with the results...”
- “...ribosomal genes were downregulated in sigBL during exponential growth at 37 C. Genes lmo0098 and lmo0096 encoding PTSsystem components were the most downregulated genes detected in sigBL during exponential growth at 37 C. Sixtythree genes were downregulated during exponential growth of L.monocytogenes sigBL in BHI at...”
- Identification and Characterization of als Genes Involved in D-Allose Metabolism in Lineage II Strain of Listeria monocytogenes
Zhang, Frontiers in microbiology 2018 - “...other DEGs in addition to genes lmo0734 to lmo0739 . Among the downregulated genes, genes lmo0096 and lmo0097 mainly participate in mannose metabolism. D-allose metabolism is a part of mannose metabolism (KEGG Pathway map00051). D-allose metabolism might have an affect on mannose metabolism. Genes lmo2761 to...”
- Listeriomics: an Interactive Web Platform for Systems Biology of Listeria
Bécavin, mSystems 2017 - “...intracellular propulsion. The other genes on the list are involved in either sugar metabolism ( lmo0096 , lmo2391 , lmo0783 , lmo2684 ) or stress response ( lmo2158 , lmo2673 ). Finally, a not-yet-described membrane protein, Lmo2484, is differently expressed in 81 of the 279 available...”
- More
SM12261_RS01270 PTS sugar transporter subunit IIB from Streptococcus mitis NCTC 12261
40% identity, 97% coverage
- Human Serum Supplementation Promotes Streptococcus mitis Growth and Induces Specific Transcriptomic Responses
Wei, Microbiology spectrum 2023 - “...the addition of human serum Operon Name Gene Fold change Protein product CiaRH-regulated gene 1 SM12261_RS01270 manL 1.69 Mannose-specific IIB subunit of PTS system Metalloenzymes 2 SM12261_RS00935 4.15 Zinc-dependent alcohol dehydrogenase family protein 3 SM12261_RS01275 adhP 4.99 Alcohol dehydrogenase 4 SM12261_RS01285 1.54 NCS2 family permease (nucleobase...”
- “...dltX (SM12261_RS09105), virulence gene pspC (SM12261_RS04920), and the first gene of a mannose transporter operon (SM12261_RS01270) were all differentially regulated in response to human serum ( Table2 and 3 ). Six of the 18 CiaR-regulated promoters in S. pneumoniae drive expression of noncoding RNAs (ncRNAs) (...”
SGO_1679 phosphotransferase system enzyme II from Streptococcus gordonii str. Challis substr. CH1
41% identity, 97% coverage
PECL_340 mannose/fructose/sorbose PTS transporter subunit IIA from Pediococcus claussenii ATCC BAA-344
41% identity, 98% coverage
lin0143 similar to PTS system mannose-specific, factor IIAB from Listeria innocua Clip11262
42% identity, 98% coverage
Q9S4L5 protein-Npi-phosphohistidine-D-mannose phosphotransferase (EC 2.7.1.191) from Streptococcus salivarius (see paper)
HSISS4_00257 PTS sugar transporter subunit IIB from Streptococcus salivarius
40% identity, 97% coverage
SPy1738 mannose-specific phosphotransferase system component IIAB from Streptococcus pyogenes M1 GAS
39% identity, 98% coverage
- Characterization of the RofA regulon in the pandemic M1global and emergent M1UK lineages of Streptococcus pyogenes
Zhi, Microbial genomics 2023 - “...H1489 rofA mutant; indeed, in this strain rofA mutation led to a >2-fold increase in Spy1738 spd (DNaseB). This strain also demonstrated a convincing 34-fold upregulation of the entire SLS operon when rofA was mutated, alongside a 35-fold increase in genes that comprise the mga regulon...”
- New Pathogenesis Mechanisms and Translational Leads Identified by Multidimensional Analysis of Necrotizing Myositis in Primates
Kachroo, mBio 2020 - “...Streptopain protease inhibitor Spy1713 1,080.7 NS Spy1735 speB Streptococcal pyrogenic exotoxin B Spy1714 912.3 NS Spy1738 spd Phage-associated deoxyribonuclease Spy1717 70.5 NS Superantigens Spy0182 speG Exotoxin type G precursor Spy0222 2.1 3.8 Spy1702 smeZ Mitogenic exotoxin Z Spy0238 NS 2.6 Spy0356 speJ Exotoxin type J precursor...”
- CcpA-mediated repression of streptolysin S expression and virulence in the group A streptococcus
Kinkel, Infection and immunity 2008 - “...Spy1381 Spy0127 Spy1305 Spy1479 Spy0926 Spy1635 Spy0785 Spy1738 SPy0141 Spy1720 Spy0283 Spy1851 Spy0106 Spy0186 Spy0988 Spy0576 Spy0424 Arginine deiminaseb...”
- Proteomic analysis and identification of Streptococcus pyogenes surface-associated proteins
Severin, Journal of bacteriology 2007 - “...SPy1073 SPy0731 SPy1262 SPy1282 SPy1371 SPy1372 SPy1547 SPy1738 SPy1881 SPy1889 SPy1896 SPy2070 SPy2072 Cytoplasmic proteins (group 2)i SPy0063 SPy0065 SPy0460...”
- Regulation of SpeB in Streptococcus pyogenes by pH and NaCl: a model for in vivo gene expression
Loughman, Journal of bacteriology 2006 - “...SPy0744 SPy0745 SPy0746 SPy0747 SPy0843 SPy1151 SPy1378 SPy1718 Spy1738 SPy1739 SPy1740 SPy1939 SPy2019 Gene VOL. 188, 2006 MODELING IN VIVO STREPTOCOCCAL GENE...”
- “...of California, Berkeley SPy2039 SPy1915 SPy0739 SPy1065 SPy1738 SPy1378 Spy1228 SPy1109 SPy1815 SPy0149 Gene (putative function) VOL. 188, 2006 MODELING IN...”
- A novel adaptation of aldolase regulates virulence in Streptococcus pyogenes
Loughman, The EMBO journal 2006 - “...by pH and NaCl in S. pyogenes Locusa Spy2039 Spy1738 Spy0167 Spy0745 Spy1915 Spy1815 Spy0149 Gene speB manL slo sagH salA scrA ntpK Cysteine protease Mannose...”
TC 4.A.6.1.10 / Q04GK1 Phosphotransferase system, mannose/fructose-specific component IIA, component of The hexose (glucose and fructose demonstrated) PTS uptake system from Oenococcus oeni (strain BAA-331 / PSU-1) (see paper)
OEOE_0464 Phosphotransferase system, mannose/fructose-specific component IIA from Oenococcus oeni PSU-1
OEOE_RS02230, WP_002816525 PTS sugar transporter subunit IIB from Oenococcus oeni PSU-1
38% identity, 97% coverage
M5005_Spy_1479 PTS system, mannose-specific IIAB component from Streptococcus pyogenes MGAS5005
SpyM3_1511 putative mannose-specific phosphotransferase system component IIAB from Streptococcus pyogenes MGAS315
L897_07135 PTS sugar transporter subunit IIB from Streptococcus pyogenes HSC5
39% identity, 97% coverage
- Genome-wide analysis of in vivo CcpA binding with and without its key co-factor HPr in the major human pathogen group A Streptococcus
DebRoy, Molecular microbiology 2021 - “...GTGAAAACGTTTTAAA M5005_Spy_1477 NCS2 family permease S Yes Semi dependent 57 Yes Yes Yes Prom GTGAAAACGTTTTAAA M5005_Spy_1479 manL PTS mannose transporter subunit EIIAB G Yes Semi dependent 58 Yes Yes Yes Prom AAAGAAAACGTTTTCT M5005_Spy_1496 phaB EnoylCoA hydratase I Yes Independent 59 Yes No No M5005_Spy_1497 dnaJ Chaperone...”
- Novel regulatory small RNAs in Streptococcus pyogenes
Tesorero, PloS one 2013 - “...aminopeptidase C <<< SPyM3_1392 NAD synthetase <<< Q, Z, P SSRC34 SPyM3_1510 hypothetical protein >>> SPyM3_1511 putative mannose-specific phosphotransferase system component IIAB >>> Q, Z SSRC35 SPyM3_1533 heat-inducible transcription repressor <<< SPyM3_1534 N-acetylmuramoyl-L-alanine amidase <<< Q, Z SSRC36 SPyM3_1644 putative deoxyribonuclease hsdM modification subunit >>> SPyM3_1645...”
- Presence of a Prophage Determines Temperature-Dependent Capsule Production in Streptococcus pyogenes
Brown, Genes 2016 - “...L897_04020 encoding a putative collagen-like cell surface protein (10 bps or 5 bps deletion), and L897_07135 encoding PTS mannose transporter subunit II AB (missense mutation, VF). Next, we examined all eighteen spontaneous mutants through PCR to detect the deletion of the prophage and through sequencing to...”
- “...the capsule mutants had the mutations in the genes of slo , L897_04020 , and L897_07135 . Taken together, these results indicate that the deletion of the prophage in the capsule thermoregulation mutants is linked to their phenotypic change of capsule production at 37 C. 3.3....”
LSA0449 Mannose-specific phosphotransferase system, enzyme IIAB from Lactobacillus sakei subsp. sakei 23K
42% identity, 98% coverage
TC 4.A.6.1.15 / E1UCI0 PTS system, mannose-specific, IIAB component, component of The primary glucose /mannose uptake transporter, ManLMN from Listeria monocytogenes serotype 4a (strain L99)
42% identity, 98% coverage
- substrates: Mannose, glucose
LJ0503 phosphoenolpyruvate-dependent sugar phosphotransferase system EIIAB, probable mannose specific from Lactobacillus johnsonii NCC 533
40% identity, 97% coverage
HGB56_11950 mannose/fructose/sorbose PTS transporter subunit IIA from Lactiplantibacillus plantarum ST-III
40% identity, 98% coverage
- The Carbohydrate Metabolism of Lactiplantibacillus plantarum
Cui, International journal of molecular sciences 2021 - “...responsible for fructose transport, which were encoded by fruA (HGB56_02940), fruA1-fruA2-fruB (HGB56_07725, HGB56_07730, HGB56_07735), pts9ABCD (HGB56_11950, HGB56_11955, HGB56_11960) and pts10AB (HGB56_11975, HGB56_11980) genes, respectively ( Supplementary Table S3-4 ). Fructose enters cells in the form of 6-phosphate-fructose through these PTSs, then 6-phosphate-fructose is transformed into 1,...”
SEQ_0494 mannose-specific phosphotransferase system (PTS), IIAB component from Streptococcus equi subsp. equi 4047
39% identity, 97% coverage
KSF55_03010 mannose/fructose/sorbose PTS transporter subunit IIA from Lactiplantibacillus pentosus
40% identity, 98% coverage
- Genome-wide transcriptomics revealed carbon source-mediated gamma-aminobutyric acid (GABA) production in a probiotic, <i>Lactiplantibacillus pentosus</i> 9D3
Raethong, Heliyon 2025 - “...Gene ID Protein function Glucose a Sucrose b Lactose c KSF55_03040 Mannose PTS Up Down KSF55_03010 Mannose PTS Up Down Down KSF55_01155 Mannitol PTS Up Down Down KSF55_01145 Mannitol PTS Up Down KSF55_11445 Acetylglucosamine PTS Up Down KSF55_16135 Alpha-glucoside PTS Down Up KSF55_13515 Cellobiose PTS Down...”
- “...in the expression patterns of specific genes in the mannose and mannitol PTS, such as KSF55_03010, KSF55_03040, KSF55_01145, and KSF55_01155, indicating potential co-regulation by the glucose signaling of genes in Cluster II. In the lactose culture, the SGS encoding enzyme involved in galactose metabolism, including UDPglucose-hexose-1-phosphate...”
BSQ49_11165 mannose/fructose/sorbose PTS transporter subunit IIA from Liquorilactobacillus hordei
39% identity, 98% coverage
lp_0575 mannose/fructose/sorbose PTS transporter subunit IIA from Lactiplantibacillus plantarum WCFS1
F9UL45 PTS system mannose-specific EIIAB component from Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
lp_0575 mannose PTS, EIIAB from Lactobacillus plantarum WCFS1
40% identity, 98% coverage
- Butanol Tolerance of Lactiplantibacillus plantarum: A Transcriptome Study
Petrov, Genes 2021 - “...glucitol/sorbitol transporter subunit IIA NC 3.11 lp_0884, pts11A PTS glucose transporter subunit IIA NC 2.30 lp_0575, pts9AB PTS mannose transporter subunit IIAB NC 6.36 lp_0185, pts1BCA PTS -glucoside transporter subunit IIBCA NC 4.96 lp_2649, pts19C PTS N-acetylgalactosamine transporter IIC 12.45 2.88 lp_3009, pts23B PTS sugar transporter...”
- Identification of key proteins and pathways in cadmium tolerance of Lactobacillus plantarum strains by proteomic analysis.
Zhai, Scientific reports 2017 - “...isomerase 1.56 PTS system PTS system F9UT61 pts4ABC; PTS system trehalose-specific transporter subunit IIBC 1.86 F9UL45 pts9AB; PTS system, mannose-specific EIIAB component 1.73 F9UL47 pts9D; PTS system, mannose-specific EIID component 1.82 F9UL56 pts10A; PTS system, mannose-specific EIIA component 1.52 F9UL57 pts10B; PTS system, mannose-specific EIIB component...”
- Response of Lactobacillus plantarum WCFS1 to the Gram-Negative Pathogen-Associated Quorum Sensing Molecule N-3-Oxododecanoyl Homoserine Lactone
Spangler, Frontiers in microbiology 2019 - “...ID Description 1 h 4 h F9US34_LACPL lp_0002 dnaN Beta sliding clamp -0.78 -0.60 F9UL45_LACPL lp_0575 pts9AB PTS system, mannose-specific EIIAB component (EC 2.7.1.69) -0.52 -0.57 F9UL47_LACPL lp_0577 pts9D PTS system, mannose-specific EIID component (EC 2.7.1.69) -0.55 -0.52 F9UL90_LACPL lp_0627 Prophage P1 protein 4 -0.96 -0.69...”
- Functional analysis of the role of CggR (central glycolytic gene regulator) in Lactobacillus plantarum by transcriptome analysis
Rud, Microbial biotechnology 2011 - “...protein 3.1 1.8 lp_0436 pts7C Cellobiose PTS, EIIC 0.6 lp_0439 pts8C Cellobiose PTS, EIIC 0.9 lp_0575 pts9AB Mannose PTS, EIIAB 2.4 0.6 lp_0576 pts9C Mannose PTS, EIIC 2.6 0.6 0.6 lp_0749 pstB Phosphate ABC transporter, ATPbinding protein 2.1 a lp_0770 Multidrug transport protein 0.7 lp_1120 Amino...”
- Identification of prebiotic fructooligosaccharide metabolism in Lactobacillus plantarum WCFS1 through microarrays
Saulnier, Applied and environmental microbiology 2007 - “...and transport lp_0230 lp_0329 lp_0349 lp_0436 lp_0576 lp_0575 lp_0577 lp_0587 lp_0822 lp_1083 lp_1386 lp_1409 lp_1466 lp_1468 lp_1469 lp_1471 lp_1472 lp_1473...”
SMUGS5_08440 PTS sugar transporter subunit IIB from Streptococcus mutans GS-5
40% identity, 97% coverage
- D‑Tagatose inhibits the growth and biofilm formation of Streptococcus mutans
Hasibul, Molecular medicine reports 2018 - “...Ftf-F aaatatgaaggcggctacaacg 101 Ftf-R cttcaccagtcttagcatcctgaa SMUGS5_08805 Fructose/Mannose-specific PTS subunit IIC EII-fru/man-F aagactctctttacggtgggttc 111 EII-fru/man-R agtgaaaccaacaaagaatggaa SMUGS5_08440 Glucose/Mannose-specific PTS subunit IIAB EII-glu/man-F ctaaagctgaccgtatcattgttg 111 EII-glu/man-R attggtacaacattggccttgaca SMUGS5_09220 Maltose/Glucose-specific PTS subunit IIABC EII-mal/glu-F acacaatatctttggcggtaaga 105 EII-mal/glu-R cgaaaccagagataataccaacg SMUGS5_03875 Fructose-specific PTS subunit IIABC EII-fru-F tgatacttttaaggctgggatca 116 EII-fru-R aaaagaaccgttgcttcctttac SMUGS5_08275...”
SMU_1877, SMU_RS08590 PTS sugar transporter subunit IIB from Streptococcus mutans UA159
40% identity, 97% coverage
- Identification of the antibacterial action mechanism of diterpenoids through transcriptome profiling
Moon, Frontiers in microbiology 2022 - “...0.65 1.42 1.45 1.69 SMU_RS07235 PTS cellobiose transporter subunit IIC ptcC 1.32 2.91 2.83 3.10 SMU_RS08590 PTS mannose transporter subunit IIAB ptnA 1.45 3.44 2.06 2.42 SMU_RS08600 PTS mannose/fructose/sorbose transporter family subunit IID 0.83 2.76 1.55 1.79 SMU_RS08595 PTS mannose/fructose/sorbose transporter subunit IIC ptnC 1.08 3.16...”
- Cnm of Streptococcus mutans is important for cell surface structure and membrane permeability
Naka, Frontiers in cellular and infection microbiology 2022 - “...system transporter protein EI 1028092 SMU_675 2.503 ptnA PTS system mannose-specific transporter subunit IIAB 1029081 SMU_1877 2.447 opuBa Choline transporter ABC transporter ATP-binding protein 1028412 SMU_1096 2.421 SMU_1163c ABC transporter ATP-binding protein 1028468 SMU_1163c 2.394 sloC ABC transporter metal binding lipoprotein 1029755 SMU_184 2.381 SMU_1041 ABC...”
T303_02805 PTS sugar transporter subunit IIB from Streptococcus thermophilus ASCC 1275
38% identity, 97% coverage
TC 4.A.6.1.7 / Q5M5W6 ManL, component of The glucose/mannose/2-deoxyglucose/fructose phosphotransferase systems (phosphorylates without transport), ManLMN from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
stu0333 mannose PTS system component IIAB from Streptococcus thermophilus LMG 18311
38% identity, 97% coverage
str0333 mannose PTS system component IIAB from Streptococcus thermophilus CNRZ1066
39% identity, 97% coverage
SSA_1918 Phosphotransferase system, mannose-specific EIIAB, putative from Streptococcus sanguinis SK36
41% identity, 93% coverage
SPD_0264 PTS system, mannose-specific IIAB components from Streptococcus pneumoniae D39
SPV_0264, SP_0284 PTS sugar transporter subunit IIB from Streptococcus pneumoniae TIGR4
40% identity, 97% coverage
- Environmental and genetic regulation of Streptococcus pneumoniae galactose catabolic pathways
Kareem, Nature communications 2024 - “...0.37 0.60 2.07 manM SPD_0263 PTS system mannose-specific transporter subunit IIC 0.49 0.71 2.29 manL SPD_0264 PTS system mannose-specific transporter subunit IIAB 0.53 1.11 3.78 SPD_0560 PTS system transporter subunit IIB 0.19 0.34 0.42 SPD_0561 PTS system transporter subunit IIC 0.14 0.30 0.37 lacD SPD_1050 tagatose...”
- Identification of Streptococcus pneumoniae genes associated with hypothiocyanous acid tolerance through genome-wide screening
Shearer, Journal of bacteriology 2023 (secret) - Cadmium stress dictates central carbon flux and alters membrane composition in Streptococcus pneumoniae
Neville, Communications biology 2020 - “...expression Glucose catabolism/glycolysis SPD_0262 manN PTS-system, IID component 1.50 SPD_0263 manM PTS-system, IIC component 1.59 SPD_0264 manL PTS-system, IIAB components 1.68 SPD_0526 fba Fructose-1,6-bisphosphate aldolase, class II (EC 4.1.2.13) 1.09 SPD_0789 pfkA Phosphofructokinase (EC 2.7.1.11) 1.39 SPD_0790 pyk Pyruvate kinase (EC 2.7.1.40) 1.31 SPD_1012 eno Enolase...”
- Panproteome-wide analysis of antibody responses to whole cell pneumococcal vaccination
Campo, eLife 2018 - “...Linear mixed effects ManL Glucose, mannose, galactose, fructose, N-acetylglucosamine and glucosamine ABC transporter ATPase ManL SPD_0264 0.803 (0.3741.553) 0.000 (0.1040.059) 0.460 (0.1290.907) 0.070 (0.0520.469) 1.083 (0.8331.346) Both MltG Endolytic murein transglycosylase MltG SPD_1346 2.993 (2.3303.371) 0.087 (0.1190.055) 0.249 (0.1100.283) 0.253 (0.0600.401) 0.491 (0.3380.753) Both MreC Peptidoglycan...”
- Pneumococcal galactose catabolism is controlled by multiple regulators acting on pyruvate formate lyase
Al-Bayati, Scientific reports 2017 - “...system, mannose/fructose/sorbose family protein, IID component 2.3 SPD_0263 manM PTS system, mannose-specific IIC component 2 SPD_0264 manL PTS system, mannose-specific IIAB components 1.7 SPD_0378 enoyl-CoA hydratase 2.7 SPD_0379 Transcriptional regulator, MarR family 2.3 SPD_0380 3-oxoacyl-(acyl carrier protein) synthase 2.4 SPD_0381 Acyl carrier protein 2.5 SPD_0382 enoyl-(acyl-carrier-protein)...”
- N-acetylglucosamine-Mediated Expression of nagA and nagB in Streptococcus pneumoniae
Afzal, Frontiers in cellular and infection microbiology 2016 - “...N-acetylglucosamine-6-phosphate deacetylase, NagA 2.4 spd_1846 PTS system, IIB component 2.3 spd_1246 glucosamine-6-phosphate isomerase, NagB 2.3 spd_0264 PTS system, mannose-specific IIAB components, ManL 2.1 spd_1492 Hypothetical protein 2.0 spd_1491 Hypothetical protein 2.0 spd_1100 Glucose-6-phosphate 1-dehydrogenase, Zwf 2.2 spd_0448 Glutamine synthetase, GlnA 3.3 spd_1099 Amino acid ABC transporter,...”
- LacR is a repressor of lacABCD and LacT is an activator of lacTFEG, constituting the lac gene cluster in Streptococcus pneumoniae
Afzal, Applied and environmental microbiology 2014 - “...in GalM17 and GM17 Functionb Ratioc SPD_0562 SPD_0264 SPD_1046 SPD_1047 SPD_1048 SPD_1049 SPD_1050 SPD_1051 SPD_1052 SPD_1053 -Galactosidase PTS system,...”
- A Nonadjuvanted Whole-Inactivated Pneumococcal Vaccine Induces Multiserotype Opsonophagocytic Responses Mediated by Noncapsule-Specific Antibodies
David, mBio 2022 - “...permease protein 6,467.131,744.26 1,188.6258.24 2.444 SP_2085 pstC Phosphate transport system permease protein 5,396.82,017.12 231.2775 4.544 SP_0284 manL EIIAB-Man 5,374.13193.91 9,420.93723.38 0.810 SP_2223 hypothetical protein 4,849.8467.69 3,379.6354.14 0.521 SP_0807 ezrA Septation ring formation regulator EzrA 4,522.81,316.05 00 NA SP_0659 etrx1 Thioredoxin family protein 4,332.81,408.67 3,032.6640.65 0.515 SP_0641...”
- Refining the Pneumococcal Competence Regulon by RNA Sequencing
Slager, Journal of bacteriology 2019 - “...to SPV_1123) ( 37 ) and the downregulatory effect of CiaR on the manLMN operon (SPV_0264 to SPV_0262) ( 46 ) may prevent clear clustering. Time-resolved expression profiles of several regulons during competence. We visualized the typical time-resolved expression patterns of the various regulons by plotting...”
NP_344822 PTS system, mannose-specific IIAB components from Streptococcus pneumoniae TIGR4
40% identity, 96% coverage
- Protein-based streptococcus pneumoniae vaccines
MIZRACHI, 2011
TC 4.A.6.1.16 / Q8Y8V9 Lmo0783 protein, component of Constitutively synthesized sensor, MpoABCD, controlling man operon (see TC# 4.A.6.1.15) expression by interacting with and phosphorylating ManR, the transcriptional regulator of the man operon from Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
lmo0783 similar to mannose-specific phosphotransferase system (PTS) component IIB from Listeria monocytogenes EGD-e
LMOf6854_0826 PTS system, mannose/fructose/sorbose family, IIB component subfamily from Listeria monocytogenes str. 1/2a F6854
LMON_0787 mannose/fructose/sorbose PTS transporter subunit IIB from Listeria monocytogenes EGD
72% identity, 49% coverage
- substrates: Mannose
- The ribonuclease PNPase is a key regulator of biofilm formation in Listeria monocytogenes and affects invasion of host cells
Quendera, NPJ biofilms and microbiomes 2023 - “...by affecting the expression of genes involved in the metabolism of carbohydrates (e.g., lmo0096 and lmo0783 , encoding PTS components), of amino acids (e.g., lmo1984 and lmo2006 , encoding biosynthetic enzymes) and in the Agr quorum sensing-like system ( lmo0048-49 ). Moreover, we show that PNPase...”
- “...terms of log 2 RPKM. e Read coverage plots of three upregulated ( lmo0096 , lmo0783 , lmo0784 ) and three downregulated genes ( lmo1984 , lmo1986 , lmo2006 ). lmo0783-0784 are shown in operon. Blue line corresponds to wild-type, while red line corresponds to pnpA...”
- DegU-mediated suppression of carbohydrate uptake in Listeria monocytogenes increases adaptation to oxidative stress
Chen, Applied and environmental microbiology 2023 (secret) - Listeria monocytogenes GshF contributes to oxidative stress tolerance via regulation of the phosphoenolpyruvate-carbohydrate phosphotransferase system
Chen, Microbiology spectrum 2023 - “...lmo0781 PTS mannose transporter subunit IID lmo0782 3.54 Yes/down lmo0782 PTS mannose transporter subunit IIC lmo0783 1.43 Yes/down lmo0783 PTS mannose transporter subunit IIB lmo0784 1.99 Yes/down lmo0784 PTS mannose transporter subunit IIB lmo0874 5.33 Yes/down lmo0874 PTS sugar transporter subunit IIA lmo0875 3.59 Yes/down lmo0875...”
- Proteomic Analysis of Listeria monocytogenes FBUNT During Biofilm Formation at 10°C in Response to Lactocin AL705
Melian, Frontiers in microbiology 2021 - “...cellobiose IIC-PTS and trehalose IIBC-PTS (Lmo2763 and Lmo1255) and a minor increase of mannose IIB/IIC/IID-PTS (Lmo0783, Lmo0782, Lmo0098) proteins were observed upon the addition of the bacteriocin during L. monocytogenes FBUNT biofilm formation. Most carbohydrates (glucose, fructose, mannose, cellobiose, and trehalose, among others) used by L....”
- Colonisation dynamics of Listeria monocytogenes strains isolated from food production environments
Gray, Scientific reports 2021 - “...system mannost-specific transporter subunits IIAB 2.7.1.191 lmo0097 fig|1639.4014.peg.506 2.99 G PTS system mannose-specific IIC component Lmo0783 fig|1639.4014.peg.1297 4.18 manX G PTS system mannose-specific IIAB component 2.7.1.191 lmo2552 fig|1639.4014.peg.192 3.7 murZ M UDP-N-acetylglucosamine 1-carboxyvinyltransferase 2.5.1.7 Ribosome lmo1542 fig|1639.4024.peg.1293 3.82 rplU J LSU ribosomal protein L21p 7545 48h...”
- Transcriptomic and Phenotypic Analyses of the Sigma B-Dependent Characteristics and the Synergism between Sigma B and Sigma L in Listeria monocytogenes EGD-e
Mattila, Microorganisms 2020 - “...Transport and binding proteins lmo0169 transporter, putative 2.1 2.4 lmo0782 PTS system component 3 3.4 lmo0783 PTS system component 3.3 2.8 lmo0784 PTS system component 3.7 3.2 Hypothetical and unclassified proteins lmo0265 peptidase, M20/M25/M40 family 2.2 2.4 lmo0602 protease synthase and sporulation negative regulatory protein pai...”
- “...putative 1.3 2.7 lmo0781 PTS system component 2 2.3 lmo0782 PTS system component 2.2 3.9 lmo0783 PTS system component 2.1 2.9 lmo0784 PTS system component 2.1 3.8 Hypothetical and unclassified proteins lmo0265 peptidase, M20/M25/M40 family lmo0355 succinate dehydrogenase/fumarate reductase, flavoprotein 2.2 2.4 lmo0602 subunit 1.9 1.9...”
- Listeriomics: an Interactive Web Platform for Systems Biology of Listeria
Bécavin, mSystems 2017 - “...genes on the list are involved in either sugar metabolism ( lmo0096 , lmo2391 , lmo0783 , lmo2684 ) or stress response ( lmo2158 , lmo2673 ). Finally, a not-yet-described membrane protein, Lmo2484, is differently expressed in 81 of the 279 available data sets. This protein...”
- Strand specific RNA-sequencing and membrane lipid profiling reveals growth phase-dependent cold stress response mechanisms in Listeria monocytogenes
Hingston, PloS one 2017 - “...IIC component lmo0782 12 1.60 2.72 1.43 -0.76 1.64 LMON_0787 PTS system, mannose-specific IIB component lmo0783 12 1.86 2.80 1.43 -1.11 1.86 LMON_0788 PTS system, mannose-specific IIB component / IIA component lmo0784 12 2.05 3.10 1.49 -1.23 1.70 LMON_0920 Succinate-semialdehyde dehydrogenase [NAD] + lmo0913 10 4.64...”
- More
- Physiological and transcriptional characterization of persistent and nonpersistent Listeria monocytogenes isolates
Fox, Applied and environmental microbiology 2011 - “...treB ptsH ptsI LMOf6854_0827 Downregulated LMOf6854_0826 Downregulated Downregulated Downregulated LMOf6854_0824 LMOf6854_0411 LMOf6854_0410 PTS system,...”
- Strand specific RNA-sequencing and membrane lipid profiling reveals growth phase-dependent cold stress response mechanisms in Listeria monocytogenes
Hingston, PloS one 2017 - “...-0.54 1.97 LMON_0786 PTS system, mannose/fructose-specific IIC component lmo0782 12 1.60 2.72 1.43 -0.76 1.64 LMON_0787 PTS system, mannose-specific IIB component lmo0783 12 1.86 2.80 1.43 -1.11 1.86 LMON_0788 PTS system, mannose-specific IIB component / IIA component lmo0784 12 2.05 3.10 1.49 -1.23 1.70 LMON_0920 Succinate-semialdehyde...”
B1745_05735 PTS sugar transporter subunit IIB from Lactobacillus amylolyticus
36% identity, 95% coverage
TC 4.A.6.1.6 / Q2QKM4 ManL aka EIIAB, component of Glucose porter, ManLMN from Lactobacillus casei (see paper)
40% identity, 98% coverage
lin0776 similar to mannose-specific phosphotransferase system (PTS) component IIB from Listeria innocua Clip11262
71% identity, 49% coverage
TC 4.A.6.1.11 / D2BKY7 Mannose-specificPTS system, IIAB component, component of Mannose enzyme II complex, IIAB, IIC, IID. IIC/IID serve allows entry of some bacteriocins including pediocin (class IIa) and lactococcin A (class IIc) (Kjos et al., 2011). Transports and phosphorylates Glucose, Mannose and Glucosamine from Lactococcus lactis subsp. lactis (strain KF147) (see 2 papers)
41% identity, 98% coverage
- substrates: Mannose
tcdb comment: The IID component is the probably receptor for several bacteriocins, subclass IIa bacteriocins (pediocin-like; pediocins) and subclass IId ones - lactococcin A (LcnA), lactococcin B (LcnB), garvicin Q (GarQ), and garvicins A, B and C (GarA-C) (Tymoszewska et al. 2018). Individual amino acids localized mostly in the sugar channel-forming transmembrane parts of subunit IIC or in the extracellular parts of IID likely are involved in the interaction with each bacteriocin, and these have been specified (Tymoszewska et al. 2018)
LGG_02838 mannose/fructose/sorbose PTS transporter subunit IIA from Lacticaseibacillus rhamnosus GG
LGG_02838 PTS system, mannose-specific IIAB component from Lactobacillus rhamnosus GG
41% identity, 94% coverage
LBA0452 mannose-specific PTS system component IIAB from Lactobacillus acidophilus NCFM
38% identity, 95% coverage
LLNZ_03795 PTS sugar transporter subunit IIB from Lactococcus cremoris subsp. cremoris NZ9000
llmg_0729 PTS system, mannose-specific IIAB components from Lactococcus lactis subsp. cremoris MG1363
41% identity, 97% coverage
- Genomics and transcriptomics analysis reveals the mechanism of isobutanol tolerance of a laboratory evolved Lactococcus lactis strain
Gupta, Scientific reports 2020 - “...29 LLNZ_01860 Phosphoglyceromutase Glycolysis/gluconeogenesis 30 LLNZ_00975 Cellobiose-specific PTS system IIC component Phosphotransferase system (PTS) 31 LLNZ_03795 PTS system, mannose-specific IIAB components Fructose and mannose metabolism 32 LLNZ_00645 Phosphoenolpyruvate-protein phosphotransferase Phosphotransferase system (PTS) 33 LLNZ_05195 GMP synthase Purine metabolism 34 LLNZ_06080 Branched-chain amino acid aminotransferase Cysteine and...”
- Easy-Curing and pH-Regulated CRISPR-Cas9 Plasmids for Gene Editing and Plasmid Curing in Lactococcus cremoris
Garay-Novillo, Microbial biotechnology 2024 - “...promoter RNDcrePR1 (a mutated version of the PR1 promoter, corresponding to the promoter region of llmg_0729 gene from L. cremoris MG1363; J. N. GarayNovillo, unpublished), a spacer cloning site (two adjacent and inverted SapI restriction sites), an sgRNA scaffold domain, and the transcriptional terminator (TII) from...”
- PBP2b Mutations Improve the Growth of Phage-Resistant Lactococcus cremoris Lacking Polysaccharide Pellicle
Guérin, Applied and environmental microbiology 2023 (secret) - Further Elucidation of Galactose Utilization in Lactococcus lactis MG1363
Solopova, Frontiers in microbiology 2018 - “...ptnD 11.8 1.9 Glucose/mannose PTS IID component llmg_0728 ptnC 3.3 2.1 Glucose/mannose PTS IIC component llmg_0729 ptnAB 2.8 2.8 Glucose/mannose PTS IIAB component llmg_pseudo54 llmg_pseudo54 5.8 5.0 Pseudogene IIC PTS component llmg_0739 malE 16.5 13.1 Maltose ABC transporter substrate binding protein llmg_0738 malF 11.0 9.6 Maltose...”
- Towards enhanced galactose utilization by Lactococcus lactis
Neves, Applied and environmental microbiology 2010 - “...llmg_0454 (yedF) llmg_0727 (ptnD) llmg_0728 (ptnC) llmg_0729 (ptnAB) llmg_0865 llmg_0866 llmg_0867 llmg_0963 llmg_1045 (ptbA) llmg_1244 llmg_1426 (yleD)...”
Ssal_01861 PTS sugar transporter subunit IIB from Streptococcus salivarius 57.I
37% identity, 92% coverage
SSU1583 mannose-specific phosphotransferase system (PTS), IIAB component from Streptococcus suis P1/7
39% identity, 97% coverage
- Identification of conditionally essential genes for Streptococcus suis infection in pigs
Arenas, Virulence 2020 - “...Amino acid ABC transporter permease 3.8 2.5 3.7 SSU1662 oppF Oligopeptide transport ATP-binding protein 5.1 SSU1583 manL Mannose-specific phosphotransferase system 7.4 6.2 SSU0751 potA Part of permidine/putrescine ABC transporter 7.8 SSU0249 glA Putative aquaporin 9.2 SSU1869 Metal cation ABC transporter TroA 5.2 3.7 5.5 Cell envelope...”
- FlpS, the FNR-Like Protein of Streptococcus suis Is an Essential, Oxygen-Sensing Activator of the Arginine Deiminase System
Willenborg, Pathogens (Basel, Switzerland) 2016 - “...the predicted PTS for fructose ( SSU0768 ), trehalose ( SSU0217 ) and glucose/mannose ( SSU1583 ), and in the stat growth phase the PTS for predicted transport of mannose ( SSU0199-201 ), galactose ( SSU0403-0406 ), and N-acetylgalactosamines ( SSU1055-1057 ) were significantly lower-expressed in...”
- “...to the affected expression of the respective genes found by our microarray analysis. SSU0357 and SSU1583 presumably encode for glucose-specific PTS whereas SSU0217 and SSU1309 encode for trehalose- and -glucoside PTS, respectively. Glucose and glucose-containing di- and oligosaccharides are the major energy sources of S. suis....”
Cbei_4913 PTS system mannose/fructose/sorbose family IIB subunit from Clostridium beijerincki NCIMB 8052
61% identity, 48% coverage
Cbei_3873 PTS system mannose/fructose/sorbose family IIB subunit from Clostridium beijerincki NCIMB 8052
59% identity, 50% coverage
EF0019 PTS system, IIB component from Enterococcus faecalis V583
61% identity, 49% coverage
- Influence of the Alternative Sigma Factor RpoN on Global Gene Expression and Carbon Catabolism in Enterococcus faecalis V583
Keffeler, mBio 2021 - “...set of genes that represented both upregulated ( ef0891 and ef2223 ) and downregulated ( ef0019 [ mptB ], ef1017 [ lptB ], and ef3210 [ xpoA ]) genes in the rpoN mutant. This list of validated genes included those whose expression profiles were found to...”
- “...we focused on three PTS operons predicted to contain the consensus 24/12 RpoN-dependent promoter ( ef0019 , ef1017 , and ef3210). The results shown in Fig.4A to C confirmed that these three genes were significantly downregulated in the rpoN mutant relative to the parental V583 and...”
- Single-Nucleotide RNA Maps for the Two Major Nosocomial Pathogens Enterococcus faecalis and Enterococcus faecium
Michaux, Frontiers in cellular and infection microbiology 2020 - “...consensus sequence in only three locations, upstream of ORFs encoding components of phosphotransferase systems (PTS), ef0019, ef1012 , and ef1017 , similar to what has been observed previously ( Iyer and Hancock, 2012 ; Innocenti etal., 2015 ). In E. faecium , we found an exact...”
- Whole-genome mapping of 5' RNA ends in bacteria by tagged sequencing: a comprehensive view in Enterococcus faecalis
Innocenti, RNA (New York, N.Y.) 2015 - “...found across the whole genome: upstream ORFs coding for components of phosphor-sugar transfer systems (PTS), ef0019 , ef1012 , ef1017 , ef1954 , ef3210 , and fabF-2 coding for an enzyme involved in fatty acid and biotin metabolism. Out of those six locations, the TSS for...”
- Expression of the agmatine deiminase pathway in Enterococcus faecalis is activated by the AguR regulator and repressed by CcpA and PTS(Man) systems
Suárez, PloS one 2013 - “...the aguR strain, originating the aguR C strain. mpt strains were constructed by interrupting the EF0019 gene through a single recombination event using the thermosensitive vector pGhost8 [22] . An internal fragment of mptB was PCR-amplified using chromosomal DNA of the JH2-2 strain as template. The...”
- Intra- and interspecies genomic transfer of the Enterococcus faecalis pathogenicity island
Laverde, PloS one 2011 - “...EF0015 + + + + EF0016 + + + + EF0017 + + + + EF0019 + + + + EF0020 + + + + EF0021 + + + + 3a + + + + 3b + + + + 4a + + + + EF0046...”
- Transcriptome, proteome, and metabolite analyses of a lactate dehydrogenase-negative mutant of Enterococcus faecalis V583
Mehmeti, Applied and environmental microbiology 2011 - “...dually regulated. In addition to the sigma54 promoter preceding EF0019, a Rex box found in front of EF0020 and elevated levels of the EF0020 protein suggest...”
PTRB_LACCA / Q9RGG4 PTS system sorbose-specific EIIB component; EIIB-Sor; Sorbose-specific phosphotransferase enzyme IIB component; EC 2.7.1.206 from Lacticaseibacillus casei (Lactobacillus casei) (see paper)
Q9RGG4 protein-Npi-phosphohistidine-L-sorbose phosphotransferase (subunit 3/4) (EC 2.7.1.206) from Lacticaseibacillus casei (see paper)
56% identity, 50% coverage
- function: The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitant with their translocation across the cell membrane. The enzyme II SorABCD PTS system is involved in L-sorbose transport.
catalytic activity: keto-L-sorbose(out) + N(pros)-phospho-L-histidyl-[protein] = L-sorbose 1-phosphate(in) + L-histidyl-[protein] (RHEA:49296)
PTRB_KLEPN / P37081 PTS system sorbose-specific EIIB component; EIIB-Sor; EIII-B-Sor; Sorbose-specific phosphotransferase enzyme IIB component; EC 2.7.1.206 from Klebsiella pneumoniae (see 3 papers)
TC 4.A.6.1.3 / P37081 PTRB aka SORB, component of Sorbose porter from Klebsiella pneumoniae (see 3 papers)
52% identity, 49% coverage
- function: The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitant with their translocation across the cell membrane. The enzyme II SorABFM PTS system is involved in L-sorbose transport.
catalytic activity: keto-L-sorbose(out) + N(pros)-phospho-L-histidyl-[protein] = L-sorbose 1-phosphate(in) + L-histidyl-[protein] (RHEA:49296)
subunit: Dimer of dimers. - substrates: Sorbose
c4984 Putative sorbose PTS component from Escherichia coli CFT073
52% identity, 49% coverage
ECs5001 sorbose-permease PTS system IIB component from Escherichia coli O157:H7 str. Sakai
Z5616 putative sorbose PTS component from Escherichia coli O157:H7 EDL933
52% identity, 50% coverage
- Genetic diversity among Escherichia coli O157:H7 isolates and identification of genes linked to human infections
Wu, Infection and immunity 2008 - “...(Z5613, Z5614, Z5615, Z5616, Z5617, ECS4941, ECS4999, ECs5000, ECs5001, and ECs5002) genes, as well as genes for several transporters, including a putative iron...”
- Genetic diversity among Escherichia coli O157:H7 isolates and identification of genes linked to human infections
Wu, Infection and immunity 2008 - “...(ECs4941 and Z5613) and utilization (Z5613, Z5614, Z5615, Z5616, Z5617, ECS4941, ECS4999, ECs5000, ECs5001, and ECs5002) genes, as well as genes for several...”
BSU27060 phosphotransferase system (PTS) fructose-specific enzyme IIB component from Bacillus subtilis subsp. subtilis str. 168
48% identity, 50% coverage
PTFB_BACSU / P26380 PTS system fructose-specific EIIB component; EIIB-Fru; Fructose-specific phosphotransferase enzyme IIB component; lev-PTS; p18; EC 2.7.1.202 from Bacillus subtilis (strain 168) (see 3 papers)
TC 4.A.6.1.2 / P26380 PTFB aka LEVE aka SACL, component of Fructose group translocator, LevDEFG from Bacillus subtilis (see 4 papers)
48% identity, 50% coverage
- function: The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active -transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. The enzyme II LevDE PTS system is involved in fructose transport.
function: LevD and LevE act as negative regulators of the levanase operon. They may be involved in a PTS-mediated phosphorylation of a regulator.
catalytic activity: D-fructose(out) + N(pros)-phospho-L-histidyl-[protein] = D- fructose 1-phosphate(in) + L-histidyl-[protein] (RHEA:49252) - substrates: fructose
BSQ49_11170 PTS system mannose/fructose/N-acetylgalactosamine-transporter subunit IIB from Liquorilactobacillus hordei
48% identity, 46% coverage
lin0777 similar to mannose-specific phosphotransferase system (PTS) component IIA from Listeria innocua Clip11262
57% identity, 40% coverage
EF0815 PTS system, IIAB components from Enterococcus faecalis V583
30% identity, 96% coverage
- The Coexistence of Bacterial Species Restructures Biofilm Architecture and Increases Tolerance to Antimicrobial Agents
Dong, Microbiology spectrum 2023 - “...transfer system (PTS) were upregulated, especially the genes involved in the transport of mannose ( ef0815 , ef0816 , and ef0817 ), galactose ( gatA and gatC ), and glucose ( ef2438 and ef0541 ), which were upregulated 2.3 to 44.2-fold ( Table1 ). TABLE1 DEGs...”
- “...gatA PTS system EIIA components +1.3 +2.3 gatC PTS system EIIC components 3.8 +3.2 Mannose ef0815 PTS system EIIAB components 18.2 +44.2 ef0816 PTS system EIIC components 7.1 +25.1 ef0817 PTS system EIID components 5.0 +2.8 Arginine/Lysine/Histidine ef0892 Amino acid ABC transporter ATP-binding protein +6.3 +5.3...”
TC 4.A.6.1.16 / Q8Y8V8 Lmo0784 protein, component of Constitutively synthesized sensor, MpoABCD, controlling man operon (see TC# 4.A.6.1.15) expression by interacting with and phosphorylating ManR, the transcriptional regulator of the man operon from Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
LMOh7858_0838 PTS system, mannose/fructose/sorbose family, IIA component subfamily from Listeria monocytogenes str. 4b H7858
lmo0784 similar to mannose-specific phosphotransferase system (PTS) component IIA from Listeria monocytogenes EGD-e
LMOf6854_0827 PTS system, mannose/fructose/sorbose family, IIA component subfamily from Listeria monocytogenes str. 1/2a F6854
LMRG_00472 hypothetical protein from Listeria monocytogenes 10403S
LMON_0788 mannose/fructose/sorbose PTS transporter subunit IIA from Listeria monocytogenes EGD
54% identity, 40% coverage
- substrates: Mannose
- Genomic and proteomic analysis of the Alkali-Tolerance Response (AlTR) in Listeria monocytogenes 10403S
Giotis, BMC microbiology 2008 - “...0.000 Some similarity to acatyltransferases lmo1974 NA 5.12 0.001 Similar to transcription regulators, (GntR family) LMOh7858_0838 NA 3.24 0.104 PTS PTS system, mannose/fructose/sorbose family, IIA component subfamily lmo2632 rplC -3.44 0.003 Ribosomal proteins : synthesis and modification Ribosomal protein L3 lmo0250 rplJ -3.36 0.004 Ribosomal protein...”
- Proteomic Analysis of Listeria monocytogenes FBUNT During Biofilm Formation at 10°C in Response to Lactocin AL705
Melian, Frontiers in microbiology 2021 - “...HrcA lmo1475/hrcA P0DJM4 Transport of carbohydrate and inorganic ion PTS mannose transporter subunit IIB lmo0784 Q8Y8V8 PTS mannose transporter subunit IID lmo2000 Q8Y5Q6 PTS mannose transporter subunit IIB lmo2002 Q8Y5Q4 Ferrichrome-binding protein lmo1959 Q8Y5U6 Heavy metal-transporting ATPase lmo1853 Q8Y647 Vitamin metabolism Demethylmenaquinone methyltransferase lmo1931/ubiE P67055 Dihydropteroate...”
- The ribonuclease PNPase is a key regulator of biofilm formation in Listeria monocytogenes and affects invasion of host cells
Quendera, NPJ biofilms and microbiomes 2023 - “...log 2 RPKM. e Read coverage plots of three upregulated ( lmo0096 , lmo0783 , lmo0784 ) and three downregulated genes ( lmo1984 , lmo1986 , lmo2006 ). lmo0783-0784 are shown in operon. Blue line corresponds to wild-type, while red line corresponds to pnpA mutant. The...”
- “...Agr ( lmo0048 , lmo0049 ), genes from the mannose/glucose ( lmo0096 , lmo0783 , lmo0784 ) and maltose ( lmo2124 , lmo2125 ) transport systems, along with genes involved in the pentose phosphate pathway ( lmo0342 , lmo0343 , lmo0345 ). The categories that were...”
- DegU-mediated suppression of carbohydrate uptake in Listeria monocytogenes increases adaptation to oxidative stress
Chen, Applied and environmental microbiology 2023 (secret) - Listeria monocytogenes GshF contributes to oxidative stress tolerance via regulation of the phosphoenolpyruvate-carbohydrate phosphotransferase system
Chen, Microbiology spectrum 2023 - “...lmo0782 PTS mannose transporter subunit IIC lmo0783 1.43 Yes/down lmo0783 PTS mannose transporter subunit IIB lmo0784 1.99 Yes/down lmo0784 PTS mannose transporter subunit IIB lmo0874 5.33 Yes/down lmo0874 PTS sugar transporter subunit IIA lmo0875 3.59 Yes/down lmo0875 PTS beta-glucoside transporter subunit IIB lmo0876 4.09 Yes/down lmo0876...”
- Characterisation of the growth behaviour of Listeria monocytogenes in Listeria synthetic media
Schulz, Environmental microbiology reports 2023 - “...For instance, the two PTS systems ManLMN (MptACD) and MpoABCD, encoded by lmo0096 0098 and lmo0784 0781 , respectively, are both involved in the transport of glucose and mannose (Ak et al., 2011 ; Stoll & Goebel, 2010 ). Inactivation of all PTS systems, e.g. by...”
- Proteomic Analysis of Listeria monocytogenes FBUNT During Biofilm Formation at 10°C in Response to Lactocin AL705
Melian, Frontiers in microbiology 2021 - “...repressor HrcA lmo1475/hrcA P0DJM4 Transport of carbohydrate and inorganic ion PTS mannose transporter subunit IIB lmo0784 Q8Y8V8 PTS mannose transporter subunit IID lmo2000 Q8Y5Q6 PTS mannose transporter subunit IIB lmo2002 Q8Y5Q4 Ferrichrome-binding protein lmo1959 Q8Y5U6 Heavy metal-transporting ATPase lmo1853 Q8Y647 Vitamin metabolism Demethylmenaquinone methyltransferase lmo1931/ubiE P67055...”
- Transcriptomic and Phenotypic Analyses of the Sigma B-Dependent Characteristics and the Synergism between Sigma B and Sigma L in Listeria monocytogenes EGD-e
Mattila, Microorganisms 2020 - “...putative 2.1 2.4 lmo0782 PTS system component 3 3.4 lmo0783 PTS system component 3.3 2.8 lmo0784 PTS system component 3.7 3.2 Hypothetical and unclassified proteins lmo0265 peptidase, M20/M25/M40 family 2.2 2.4 lmo0602 protease synthase and sporulation negative regulatory protein pai 1, putative 1.3 2.8 lmo0937 hypothetical...”
- “...component 2 2.3 lmo0782 PTS system component 2.2 3.9 lmo0783 PTS system component 2.1 2.9 lmo0784 PTS system component 2.1 3.8 Hypothetical and unclassified proteins lmo0265 peptidase, M20/M25/M40 family lmo0355 succinate dehydrogenase/fumarate reductase, flavoprotein 2.2 2.4 lmo0602 subunit 1.9 1.9 lmo2067 protease synthase and sporulation negative...”
- Strand specific RNA-sequencing and membrane lipid profiling reveals growth phase-dependent cold stress response mechanisms in Listeria monocytogenes
Hingston, PloS one 2017 - “...12 1.86 2.80 1.43 -1.11 1.86 LMON_0788 PTS system, mannose-specific IIB component / IIA component lmo0784 12 2.05 3.10 1.49 -1.23 1.70 LMON_0920 Succinate-semialdehyde dehydrogenase [NAD] + lmo0913 10 4.64 5.74 2.96 0.40 2.35 LMON_0944 Hypothetical protein 10 2.77 3.84 4.22 1.39 2.00 LMON_1488 Osmotically activated...”
- Phosphotransferase system-dependent extracellular growth of listeria monocytogenes is regulated by alternative sigma factors σL and σH
Wang, Applied and environmental microbiology 2014 - “...lmo0096 to lmo0098) and PTSMan-3 (encoded by lmo0781 to lmo0784), as well as a glucose-glucoside PTS permease (PTSGlc-1, encoded by lmo0027), have been found to...”
- “...regulate at least one PTS-encoding operon, lmo0781 to lmo0784 (PTSMan-3), which has been suggested to play an important role in the regulation of PrfA...”
- More
- Physiological and transcriptional characterization of persistent and nonpersistent Listeria monocytogenes isolates
Fox, Applied and environmental microbiology 2011 - “...LMOf6854_2062 manL treB ptsH ptsI LMOf6854_0827 Downregulated LMOf6854_0826 Downregulated Downregulated Downregulated LMOf6854_0824 LMOf6854_0411 LMOf6854_0410...”
- PrfA-like transcription factor gene lmo0753 contributes to L-rhamnose utilization in Listeria monocytogenes strains associated with human food-borne infections
Salazar, Applied and environmental microbiology 2013 - “...LMRG_01030 LMRG_01444 LMRG_01763 LMRG_01236 LMRG_00278 LMRG_01602 LMRG_00472 LMRG_01574 LMRG_02611 LMRG_01103 LMRG_01849 Fold change 23.5 20.3 16.2 15.0 13.4...”
- Deep RNA sequencing of L. monocytogenes reveals overlapping and extensive stationary phase and sigma B-dependent transcriptomes, including multiple highly transcribed noncoding RNAs
Oliver, BMC genomics 2009 - “...LMRG_02216 lmo2671 unknown 3.13 27.29 8.82 LMRG_02695 lmo2573 similar to zinc-binding dehydrogenase 7.52 25.91 3.83 LMRG_00472 lmo0784 similar to mannose-specific phosphotransferase system (PTS) component IIA 88.5 25.25 0.21 LMRG_02215 lmo2670 conserved hypothetical protein 3 25.23 8.58 LMRG_02697 lmo2571 similar to nicotinamidase 9.84 25.15 2.99 a Average...”
- Strand specific RNA-sequencing and membrane lipid profiling reveals growth phase-dependent cold stress response mechanisms in Listeria monocytogenes
Hingston, PloS one 2017 - “...-0.76 1.64 LMON_0787 PTS system, mannose-specific IIB component lmo0783 12 1.86 2.80 1.43 -1.11 1.86 LMON_0788 PTS system, mannose-specific IIB component / IIA component lmo0784 12 2.05 3.10 1.49 -1.23 1.70 LMON_0920 Succinate-semialdehyde dehydrogenase [NAD] + lmo0913 10 4.64 5.74 2.96 0.40 2.35 LMON_0944 Hypothetical protein...”
Cbei_4914 PTS system mannose/fructose/sorbose family IIA subunit from Clostridium beijerincki NCIMB 8052
49% identity, 41% coverage
lp_0587 mannose PTS, EIIB from Lactobacillus plantarum WCFS1
F9UL57 PTS system, mannose-specific EIIB component from Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
HGB56_11980 PTS system mannose/fructose/N-acetylgalactosamine-transporter subunit IIB from Lactiplantibacillus plantarum WCFS1
43% identity, 49% coverage
- Oleuropein Transcriptionally Primes Lactobacillus plantarum to Interact With Plant Hosts
Santamaría, Frontiers in microbiology 2019 - “...plantarum . Genes encoding PTS transporters required for the uptake of mannose ( pts10B or lp_0587 ), the sugar alcohol mannitol ( pts2CB or lp_0230 ), threalose ( pts5ABC or lp_0265 ), cellobiose ( pts6C or lp_0286 , pts20A or lp_2780 , pts20B or lp_2781 )...”
- Identification of prebiotic fructooligosaccharide metabolism in Lactobacillus plantarum WCFS1 through microarrays
Saulnier, Applied and environmental microbiology 2007 - “...lp_0230 lp_0329 lp_0349 lp_0436 lp_0576 lp_0575 lp_0577 lp_0587 lp_0822 lp_1083 lp_1386 lp_1409 lp_1466 lp_1468 lp_1469 lp_1471 lp_1472 lp_1473 lp_1686 lp_1921...”
- Identification of key proteins and pathways in cadmium tolerance of Lactobacillus plantarum strains by proteomic analysis.
Zhai, Scientific reports 2017 - “...pts9D; PTS system, mannose-specific EIID component 1.82 F9UL56 pts10A; PTS system, mannose-specific EIIA component 1.52 F9UL57 pts10B; PTS system, mannose-specific EIIB component 3.91 F9URE1 pts19D; PTS system, N-acetylglucosaminespecific EIID component 1.79 F9URE3 pts19B; PTS system, N-acetylglucosaminespecific EIIB component 1.70 F9URP8 pts20A; PTS system, cellobiose-specific EIIA component...”
- The Carbohydrate Metabolism of Lactiplantibacillus plantarum
Cui, International journal of molecular sciences 2021 - “...encoded by fruA (HGB56_02940), fruA1-fruA2-fruB (HGB56_07725, HGB56_07730, HGB56_07735), pts9ABCD (HGB56_11950, HGB56_11955, HGB56_11960) and pts10AB (HGB56_11975, HGB56_11980) genes, respectively ( Supplementary Table S3-4 ). Fructose enters cells in the form of 6-phosphate-fructose through these PTSs, then 6-phosphate-fructose is transformed into 1, 6-2P-fructose at the action of phosphofructokinase...”
LJ0627 phosphoenolpyruvate-dependent sugar phosphotransferase system EIIAB, probable mannose specific from Lactobacillus johnsonii NCC 533
29% identity, 98% coverage
KSF55_03040 PTS system mannose/fructose/N-acetylgalactosamine-transporter subunit IIB from Lactiplantibacillus pentosus
45% identity, 49% coverage
- Genome-wide transcriptomics revealed carbon source-mediated gamma-aminobutyric acid (GABA) production in a probiotic, <i>Lactiplantibacillus pentosus</i> 9D3
Raethong, Heliyon 2025 - “...phosphotransferase systems (PTS). Table 2 Gene ID Protein function Glucose a Sucrose b Lactose c KSF55_03040 Mannose PTS Up Down KSF55_03010 Mannose PTS Up Down Down KSF55_01155 Mannitol PTS Up Down Down KSF55_01145 Mannitol PTS Up Down KSF55_11445 Acetylglucosamine PTS Up Down KSF55_16135 Alpha-glucoside PTS Down...”
- “...the expression patterns of specific genes in the mannose and mannitol PTS, such as KSF55_03010, KSF55_03040, KSF55_01145, and KSF55_01155, indicating potential co-regulation by the glucose signaling of genes in Cluster II. In the lactose culture, the SGS encoding enzyme involved in galactose metabolism, including UDPglucose-hexose-1-phosphate uridylyl...”
PPE_RS07075 PTS sugar transporter subunit IIA from Paenibacillus polymyxa E681
45% identity, 40% coverage
CD3068 PTS system, IIb component from Clostridium difficile 630
39% identity, 47% coverage
- Semiquantitative analysis of clinical heat stress in Clostridium difficile strain 630 using a GeLC/MS workflow with emPAI quantitation
Ternan, PloS one 2014 - “...sugar uptake may be of less importance under heat stress was provided by detection of CD3068 (Enz IIb component, manX) and CD3277 (enz IIc component, manY), both of which are involved in mannose transport, only at 37C. In support of this, CD3068 was down regulated some...”
- Temporal differential proteomes of Clostridium difficile in the pig ileal-ligated loop model
Janvilisri, PloS one 2012 - “...PtsG (CD2667), MalX (CD3030), and CD3137 were down-regulated, others including CD0287, GatC (CD2325), PtsH (CD2756), CD3068, and CD3069 were found to be up-regulated. These results suggest that the changes in metabolic states of C. difficile within the host environments may provide another mechanism for host adaptation...”
TC 4.A.6.1.13 / B3WB09 Phosphoenolpyruvate-dependent sugar phosphotransferase system EIIAB, probable mannose specific, component of Fucosyl-α-1,3-N-acetylglucosamine PTS uptake porter, AlfEFG (next to an operon encoding a fucosidase (AlfB) and a transcriptional regulator of the GntR family, AlfR) from Lactobacillus casei (strain BL23)
K0ND69 PTS mannose/fructose/sorbose transporter subunit IIAB from Lacticaseibacillus paracasei
30% identity, 97% coverage
- substrates: Fucosyl-alpha-1,3-N-acetylglucosamine
tcdb comment: The fucosidase is specific for this disaccharide which is present in mammalian glycoproteins, glycolipids and milk (Rodríguez-Díaz et al. 2012). Uptake is dependent of AlfF but not on the PTS Enzyme I, suggesting that uptake does not require phosphorylation, consistent with the activity of AlfB as a fucosidase. Only the glucosamine moiety is utilized and the fucose moiety, after hydrolysis, is excreted (Rodríguez-Díaz et al. 2012) - Proteomic analysis of Lactobacillus casei GCRL163 cell-free extracts reveals a SecB homolog and other biomarkers of prolonged heat stress
Adu, PloS one 2018 - “...metabolism, nucleotide salvaging K0N8Q2/K0N7Z0 BN194_27750/BN194_27760 - (+) ** + + Putative Alpha-L-fucosidase Fucose metabolism? levE_4 K0ND69 BN194_27770 - - + + Fructose-specific phosphotransferase enzyme IIB component Sugar uptake K0MV08 BN194_13440 - - + + Uncharacterized ABC transporter ATP-binding protein Mb1303c Lipid export? asp23_2 K0N1F0 BN194_01950 -...”
FKY84_01780 PTS system mannose/fructose/N-acetylgalactosamine-transporter subunit IIB from Enterococcus faecalis
40% identity, 49% coverage
LMOf6854_2058 PTS system, mannose/fructose/sorbose family, IIA component from Listeria monocytogenes str. 1/2a F6854
LM6179_2766 PTS sugar transporter subunit IIA from Listeria monocytogenes 6179
44% identity, 41% coverage
lmo1997 similar to PTS mannose-specific enzyme IIA component from Listeria monocytogenes EGD-e
44% identity, 41% coverage
- Anti-Biofilm Effects of Z102-E of Lactiplantibacillus plantarum against Listeria monocytogenes and the Mechanism Revealed by Transcriptomic Analysis
Wei, Foods (Basel, Switzerland) 2024 - “...lmo0347 dihydroxyacetone kinase 16.727 4.064068 lmo0348 dihydroxyacetone kinase 14.344 3.842421 lmo1249 hypothetical protein 13.607 3.766271 lmo1997 PTS mannose transporter subunit IIA 5.734 2.51942 lmo0346 triosephosphate isomerase 5.534 2.468207 C is the control group; T is the treated group. foods-13-02495-t002_Table 2 Table 2 Top significantly down-regulated genes....”
- Listeria monocytogenes GshF contributes to oxidative stress tolerance via regulation of the phosphoenolpyruvate-carbohydrate phosphotransferase system
Chen, Microbiology spectrum 2023 - “...IIC lmo1972 lmo1972 PTS pentitol transporter subunit IIB lmo1973 lmo1973 PTS sugar transporter subunit IIA lmo1997 3.67 Yes/up lmo1997 PTS mannose transporter subunit IIA lmo2000 6.48 Yes/up 7.17 Yes/down lmo2000 PTS mannose transporter subunit IID lmo2001 5.88 Yes/up 7.63 Yes/down lmo2001 PTS mannose transporter subunit IIC...”
- “...gene in the operon. The wild-type L. monocytogenes strain and the deletion strains iiA man (lmo1997 ), lmo1998 , lmo1999 , iiD man (lmo2000 ), iiC man (2001 ), iiB man (lmo2002 ), lmo2003 , and lmo2004 were exposed to copper ions and diamide to assess...”
- DegU-mediated suppression of carbohydrate uptake in Listeria monocytogenes increases adaptation to oxidative stress
Chen, Applied and environmental microbiology 2023 (secret) - New Insights into the Lactic Acid Resistance Determinants of Listeria monocytogenes Based on Transposon Sequencing and Transcriptome Sequencing Analyses
Liu, Microbiology spectrum 2023 - “...sugar transporter subunit IIA 0.0051 4.39E-70 lmo1971 ulaA PTS ascorbate transporter subunit IIC 0.0581 2.09E-07 lmo1997 lmo1997 PTS mannose transporter subunit IIA 0.1123 5.88E-14 lmo2000 lmo2000 PTS mannose transporter subunit IID 0.0514 9.43E-34 lmo2001 lmo2001 PTS mannose transporter subunit IIC 0.0472 1.58E-40 lmo2002 lmo2002 PTS mannose...”
- YjbH mediates the oxidative stress response and infection by regulating SpxA1 and the phosphoenolpyruvate-carbohydrate phosphotransferase system (PTS) in Listeria monocytogenes
Cheng, Gut microbes 2021 - “...Change Significance (Log 2 WT/ yjbH ) EIIA lmo2765 PTS cellobiose-specific enzyme IIA 9.08 Yes lmo1997 PTS mannose-specific enzyme IIA 7.20 Yes lmo2797 PTS mannitol-specific enzyme IIA 6.64 Yes lmo2099 PTS mannitol/fructose-specific enzyme IIA 5.23 Yes lmo0426 PTS fructose-specific enzyme IIA 5.07 Yes lmo2667 PTS galactitol-specific...”
- The Combined Effect of Cold and Copper Stresses on the Proliferation and Transcriptional Response of Listeria monocytogenes
Quesille-Villalobos, Frontiers in microbiology 2019 - “...class G) such as genes that encode the phosphotransferase system (PTS; genes lmo0027, lmo0298, lmo0299, lmo1997, lmo2000, lmo2001, lmo2124, lmo2125, lmo2665, lmo2666 and lmo2708) ( Figure 2B and Supplementary Table S2 ). The effect of copper over the carbohydrate metabolism has been described in other bacterial...”
- “...among L. monocytogenes strains. Moreover, signals for other four genes were not detected (lmo0236, lmo1974, lmo1997 and lmo2175) in these two strains. Genomic information recently obtained demonstrated that those genes are not present in APA13-2 or Al152-2A strains (data not shown). FIGURE 3 Fold changes of...”
- Resilience in the Face of Uncertainty: Sigma Factor B Fine-Tunes Gene Expression To Support Homeostasis in Gram-Positive Bacteria
Guldimann, Applied and environmental microbiology 2016 - “...that B negatively regulates other PTS components, including Lmo1997, Lmo1998, Lmo2002, Lmo0427, Lmo0484, and Lmo2648 (72). A recent study by Wang et al. (73)...”
- Acid shock of Listeria monocytogenes at low environmental temperatures induces prfA, epithelial cell invasion, and lethality towards Caenorhabditis elegans
Neuhaus, BMC genomics 2013 - “...of a sugar ABC transporter (lmo1389), the IIA component of a mannose-specific phosphotransferase system (PTS, lmo1997), a protein similar to glutamate decarboxylases (lmo2434), and a stress protein (lmo2784). Down regulation of rsbR (lmo0889) encoding a positive regulator of B -activity was also approved by qRT-PCR. 16S...”
- “...by qRT-PCR: prfA , hly , flhB, cheA , lmo0109, lmo0847, lmo1740, rsbR , lmo1389, lmo1997, lmo2434, and lmo2784 (see Additional file 3 for more functional details). The validated genes checked at various time points () displayed a significant correlation (level of correlation = 0.966) between...”
- More
lmo0022 similar to PTS system, fructose-specific IIB component from Listeria monocytogenes EGD-e
35% identity, 51% coverage
APECO2_RS24175 PTS N-acetylgalactosamine transporter subunit IIB from Escherichia coli APEC O2-211
38% identity, 48% coverage
- Role of LsrR in the regulation of antibiotic sensitivity in avian pathogenic Escherichia coli
Yu, Poultry science 2020 - “...protein 0.70 APECO2_RS08735 yciN MULTISPECIES: hypothetical protein 0.70 APECO2_RS11755 yobF MULTISPECIES: DUF2527 domain-containing protein 0.69 APECO2_RS24175 tusB Sulfurtransferase TusB 0.78 APECO2_RS06985 yccX MULTISPECIES: acylphosphatase 0.75 APECO2_RS24945 yjbJ MULTISPECIES: CsbD family protein 0.64 APECO2_RS24850 yjbE Hypothetical protein 0.78 APECO2_RS03940 bolA MULTISPECIES: protein BolA 0.62 APECO2_RS11270 ydiZ MULTISPECIES:...”
c3888 PTS system, N-acetylgalactosamine-specific IIB component 2 from Escherichia coli CFT073
38% identity, 48% coverage
Z4485 PTS system, cytoplasmic, N-acetylgalactosamine-specific IIB component 2 (EIIB-AGA) from Escherichia coli O157:H7 EDL933
38% identity, 48% coverage
YhaY / b3133 N-acetyl-D-galactosamine specific PTS enzyme IIB component from Escherichia coli K-12 substr. MG1655 (see 3 papers)
NJ74_RS09985 PTS N-acetylgalactosamine transporter subunit IIB from Escherichia coli DH5[alpha]
38% identity, 48% coverage
- The Effects and Toxicity of Different Pyrene Concentrations on Escherichia coli Using Transcriptomic Analysis
Zhu, Microorganisms 2024 - “...than 5.0 fold (NJ74_RS00655, NJ74_RS17475, NJ74_RS04535, novel0293, NJ74_RS01070, novel0385, NJ74_RS11870, NJ74_RS08950, NJ74_RS04260, NJ74_RS11935, novel0132, NJ74_RS11920, NJ74_RS09985, NJ74_RS12985, NJ74_RS12400, NJ74_RS10665, novel0325, NJ74_RS07890, NJ74_RS12055, NJ74_RS21540, NJ74_RS17855, NJ74_RS04415, novel0200, NJ74_RS12045, NJ74_RS07895; Table 1 ). With regard to energy metabolism, many genes that were mostly up-regulated in this pathway belong...”
- “...were mainly up-regulated from 2.0 to 4.0 fold, with only three genes (NJ74_RS04255, NJ74_RS03620, and NJ74_RS09985) up-regulated from 5.0 to 6.0 fold ( Supplementary Table S11 ). In addition to the aforementioned pathways, the SoxRS system has also been shown to be associated with oxidative stress...”
ETAE_0679 PTS system, N-acetylgalactosamine-specific IIB from Edwardsiella tarda EIB202
41% identity, 44% coverage
- Coordinate regulation of carbohydrate metabolism and virulence by PtsH in pathogen Edwardsiella piscicida
Mao, Applied microbiology and biotechnology 2022 - “...system enzyme IID N-Acetylgalactosamine EIIA GalNAc ETAE_2532 agaF N-Acetylgalactosamine-specific PTS system enzyme IIA EIIB GalNAc ETAE_0679 agaV N-Acetylgalactosamine-specific PTS system enzyme IIB EIIC GalNAc ETAE_2534 agaW N-Acetylgalactosamine-specific PTS system enzyme IIC EIID GalNAc ETAE_2533 agaE N-Acetylgalactosamine-specific PTS system enzyme IID N-Acetylglucosamine EIIBC GlcNAc ETAE_2616 nagE N-Acetylglucosamine-specific...”
TC 4.A.6.1.4 / Q9KIQ4 AgaV, component of N-acetyl galactosamine (GalNAc or Aga) porter (used the same IIA protein (AgaF) as does 4.A.6.1.5) from Escherichia coli (see paper)
38% identity, 48% coverage
- substrates: N-acetylgalactosamine
SPD_1991 PTS system, IIB component from Streptococcus pneumoniae D39
35% identity, 48% coverage
TC 4.A.6.1.9 / Q97N92 PTS system, IIB component, component of The fucose PTS uptake transporter, IIA/IIB/IIC/IIDFuc (FcsABCD) (Manzoor et al. 2015). Expression in response to fucose is under the control of the FcsR transcriptional activator, and its DNA binding site has been identified from Streptococcus pneumoniae (see paper)
35% identity, 48% coverage
SSU05_0450 Phosphotransferase system, mannose/fructose/N-acetylgalactosamine-specific component IIB from Streptococcus suis 05ZYH33
36% identity, 50% coverage
BFP66_RS02210 PTS system mannose/fructose/N-acetylgalactosamine-transporter subunit IIB from Streptococcus suis
36% identity, 50% coverage
- The cadDX operon contributes to cadmium resistance, oxidative stress resistance, and virulence in zoonotic streptococci
Zhu, Veterinary research 2024 - “...file 7 , six genes related to the PTS transporter system (encoded by BFP66_RS02205 , BFP66_RS02210 , BFP66_RS02215 , BFP66_RS02220 , BFP66_RS02225 , and BFP66_RS02230 ) were upregulated in cadDX . The genes associated with fatty acid biosynthesis (encoded by BFP66_RS08345 , BFP66_RS08350 , and BFP66_RS08355...”
- A novel aquaporin Aagp contributes to Streptococcus suis H2O2 efflux and virulence
Zhu, Virulence 2023 - “...2.20 sugar ABC transporter substrate-binding protein; BFP66_RS00910 7.00 PTS sugar transporter subunit IIC; PTS system BFP66_RS02210 3.46 PTS system mannose/fructose/N-acetylgalactosamine-transporter subunit IIB; BFP66_RS02215 1.90 PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC; BFP66_RS02695 6.00 PTS glucose transporter subunit IIBC; BFP66_RS03575 14.07 PTS N-acetylgalactosamine transporter subunit IIA; BFP66_RS04315 3.47 PTS...”
SM12261_RS00360 PTS sugar transporter subunit IIB from Streptococcus mitis NCTC 12261
37% identity, 49% coverage
- Human Serum Supplementation Promotes Streptococcus mitis Growth and Induces Specific Transcriptomic Responses
Wei, Microbiology spectrum 2023 - “...2.07 N -acetylmuramoyl- l -alanine amidase family protein 17 SM12261_RS00245 1.67 GHKL domain-containing protein 18 SM12261_RS00360 agaB 1.83 PTS system mannose/fructose/ N -acetylgalactosamine-transporter subunit IIB SM12261_RS00365 manY 1.75 PTS mannose/fructose/sorbose/ N -acetylgalactosamine transporter subunit IIC SM12261_RS00370 manZ 2.12 PTS mannose/fructose/sorbose transporter family subunit IID SM12261_RS00375 manX...”
SP_RS00340 PTS sugar transporter subunit IIB from Streptococcus pneumoniae TIGR4
SP_0061 PTS system, IIB component from Streptococcus pneumoniae TIGR4
37% identity, 49% coverage
- Streptococcus pneumoniae metal homeostasis alters cellular metabolism
Burcham, Metallomics : integrated biometal science 2020 - “...Locus Tag Description CcpA 10.0 SP1557 SP_RS07675 uncharacterized protein, DegV (fatty-acid binding protein) 5.0 AgaB SP_RS00340 galactosamine PTS system transporter subunit IIB 3.3 GatB SP_RS03160 Galactose PTS 2.0 AdhB SP_RS01400 alcohol dehydrogenase (zinc) 2.0 NanU SP_RS08315 N-acetylneuraminate ABC transporter substrate-binding protein 2.0 NanE SP_RS08325 N-acetylmannosamine-6-phosphate-2-epimerase 1.4...”
- Combining the In Silico and In Vitro Assays to Identify Strobilanthes cusia Kuntze Bioactives against Penicillin-Resistant Streptococcus pneumoniae
Han, Pharmaceuticals (Basel, Switzerland) 2023 - “...metabolism-related pathways, which were partially marked on the volcano plot as the strH, PTS IIB (SP_0061), PTS IIC (SP_0062), galK, galM, LacA, LacB, LacD, nanE2, PurC, PurD, PurE, PurH. The 20 up-regulated proteins belonged to a large variety of protein families, and possessed diverse functions, such...”
- ManLMN is a glucose transporter and central metabolic regulator in Streptococcus pneumoniae
Fleming, Molecular microbiology 2016 - “...is de-repressed in DSP_0451 and DSP_1473. Transcription of SP_0061 as a representative of the GlcNAc/gal PTS (A) and SP_1186 as a representative of the...”
- “...were tested for each carbohydrate condition. Transcription of SP_0061 and SP_1185 as representatives of the GlcNAc/gal and lac PTS systems respectively was...”
- N-acetylgalactosamine utilization pathway and regulon in proteobacteria: genomic reconstruction and experimental characterization in Shewanella
Leyn, The Journal of biological chemistry 2012 - “...orthologous PTSV system is present in eight Streptococcus genomes (e.g. SP_0061- 64 in S. pneuAUGUST 10, 2012 * VOLUME 287 * NUMBER 33 moniae), where it has a...”
- Extracellular matrix formation enhances the ability of Streptococcus pneumoniae to cause invasive disease
Trappetti, PloS one 2011 - “...Sugar ABC transporter, ATP-binding protein; maltose/maltodextrin transport system ATP-binding 4.6 (13.8) 5.3 (9.3) (4.1) (1.0) SP_0061 SPG_0065 PTS system, IIB component; K02794 PTS system, mannose-specific IIB component 8.4 (10.8) (10.3) (1.6) 8.3 (3.8) SP_0083 SPG_0084 Two-component system, OmpR family, response regulator 7.3 (17.1) (5.2) - d...”
EQB38_RS16715 PTS sugar transporter subunit IIB from Enterococcus faecium
34% identity, 46% coverage
- Colonization of vancomycin-resistant Enterococcus faecium in human-derived colonic epithelium: unraveling the transcriptional dynamics of host-enterococcal interactions
Stege, FEMS microbes 2024 - “...ABC transporter system. A final cluster of seven upregulated genes (EQB38_RS16630, EQB38_RS16695, EQB38_RS16700, EQB38_RS16705, EQB38_RS16710, EQB38_RS16715, EQB38_RS16720) were predicted to encode a PTS system and regulatory genes). In addition, 13 genes, not contained in larger gene clusters, were significantly upregulated ( Table S4 , Fig. S6a...”
SPG_0065 PTS system, IIB component from Streptococcus pneumoniae G54
spr0060 Phosphotransferase system sugar-specific EIIB component from Streptococcus pneumoniae R6
SPD_0066 PTS system, IIB component from Streptococcus pneumoniae D39
SPD_RS00335 PTS sugar transporter subunit IIB from Streptococcus pneumoniae D39
37% identity, 49% coverage
- Extracellular matrix formation enhances the ability of Streptococcus pneumoniae to cause invasive disease
Trappetti, PloS one 2011 - “...ABC transporter, ATP-binding protein; maltose/maltodextrin transport system ATP-binding 4.6 (13.8) 5.3 (9.3) (4.1) (1.0) SP_0061 SPG_0065 PTS system, IIB component; K02794 PTS system, mannose-specific IIB component 8.4 (10.8) (10.3) (1.6) 8.3 (3.8) SP_0083 SPG_0084 Two-component system, OmpR family, response regulator 7.3 (17.1) (5.2) - d (1.8)...”
- Quantitative proteomic view associated with resistance to clinically important antibiotics in Gram-positive bacteria: a systematic review
Lee, Frontiers in microbiology 2015 - “...spr0562 Lin Up 1 Feng et al., 2011 Carbohydrate transport PTS system transporter subunit IIB spr0060 Lin Up 1 Feng et al., 2011 Carbohydrate transport Fructokinase scrK Lin Up 1 Feng et al., 2011 Fructose metabolism Glucokinase glcK Van Down 1 Scherl et al., 2006 Glucose...”
- Eukaryotic-type serine/threonine protein kinase StkP is a global regulator of gene expression in Streptococcus pneumoniae
Sasková, Journal of bacteriology 2007 - “...2.12 3.03 2.89 6.64 Other spr0059 spr0060 Beta-galactosidase 3 (bgaC) Phosphotransferase system sugar-specific EIIB component Cell wall-associated serine...”
- SPD_0090 Negatively Contributes to Virulence of Streptococcus pneumoniae
Cao, Frontiers in microbiology 2022 - “...spd _ 1996 0.66 0.029 SPD_0301 Sugar binding transcriptional regulator regR 0.71 0.001 Carbohydrate transport SPD_0066 PTS system, IIB component spd _ 0066 0.28 0.001 SPD_0067 PTS system, IIC component spd _ 0067 0.26 0.007 SPD_0068 PTS system, IID component spd _ 0068 0.23 0.001 SPD_0561...”
- Hemoglobin Induces Early and Robust Biofilm Development in Streptococcus pneumoniae by a Pathway That Involves comC but Not the Cognate comDE Two-Component System
Akhter, Infection and immunity 2021 (secret) - The Two-Component System 09 Regulates Pneumococcal Carbohydrate Metabolism and Capsule Expression
Hirschmann, Microorganisms 2021 - “...as indicated by RNA-seq ( Table S1 ). The agaR ( spd_0064 ), gadV ( spd_0066 ), celA ( spd_0277 ), eng ( spd_0335 ), and spd_1588 genes were used as targets (Primer list Table 4 ). The qPCR conditions using 20 ng/L cDNA as a...”
- “...TAGCCAATGATAGCTTCAGCA agaR ( spd_0064 ) qPCR agaR Forward qPCR agaR Reverse TCATTTCAATGTACGATGTCAG GTTTGCGTGCACGTGAAACG gadV ( spd_0066 ) qPCR gadV Forward qPCR gadV Reverse ACGACGAAGTTGTCAACAACG GAGACGTTGGCTATCGTATTT celA ( spd_0277 ) qPCR celA Forward qPCR celA Reverse ATGTTATGACTGCTGGTCGTC CCATTTCAGCAAAAAGTGCTAT eng (spd_0335) qPCR eng Forward qPCR eng Reverse GTCCGGTTCTTGCAGATAGC...”
- A Novel Iron Transporter SPD_1590 in Streptococcus pneumoniae Contributing to Bacterial Virulence Properties
Miao, Frontiers in microbiology 2018 - “...SPD_2063 Response regulator comE 0.77 0.001 SPD_1635 Galactose operon repressor galR 0.78 0.002 Carbohydrate transport SPD_0066 PTS system, IIB component SPD_0066 0.43 0.000 SPD_0068 PTS system, IID component SPD_0068 0.45 0.007 SPD_0561 PTS system, IIC component, putative SPD_0561 0.67 0.035 SPD_1047 PTS system, lactose-specific IIBC components...”
- Pneumococcal galactose catabolism is controlled by multiple regulators acting on pyruvate formate lyase
Al-Bayati, Scientific reports 2017 - “...grown anaerobically in CDM supplemented with galactose. GeneID Function Ratio a SPD_0065 Beta-galactosidase 3 3.2 SPD_0066 PTS system, IIB component 2.6 SPD_0067 PTS system, IIC component 2.4 SPD_0068 PTS system, IID component 2.7 SPD_0069 PTS system, IIA component 1.9 SPD_0094 Hypothetical protein 2.3 SPD_0095 Hypothetical protein...”
- N-acetylgalatosamine-Mediated Regulation of the aga Operon by AgaR in Streptococcus pneumoniae
Afzal, Frontiers in cellular and infection microbiology 2016 - “...Hypothetical protein 7.6 spd_0031 Hypothetical protein 4.1 spd_0032 Hypothetical protein 3.1 spd_0065 Beta-galactosidase, BgaC 2.0 spd_0066 PTS system, IIB component, GadV 3.6 spd_0067 PTS system, IIC component, GadW 3.5 spd_0068 PTS system, IID component, GadE 3.7 spd_0069 PTS system, IIA component, GadF 3.3 spd_0070 Sugar isomerase...”
- “...Ratio c Ratio d spd_0064 GntR-family transcriptional regulator, AgaR 26.0 spd_0065 Beta-galactosidase, BgaC 10.9 20.5 spd_0066 PTS system, IIB component, GadV 10.8 13.9 spd_0067 PTS system, IIC component, GadW 5.9 spd_0068 PTS system, IID component, GadE 8.0 25.2 spd_0069 PTS system, IIA component, GadF 8.5 13.5...”
- Integrated Translatomics with Proteomics to Identify Novel Iron-Transporting Proteins in Streptococcus pneumoniae
Yang, Frontiers in microbiology 2016 - “...3.69 0.000 354 gi|116516506 dacC D-alanyl-D-alanine carboxypeptidase 0.73 0.011 0.26 0.000 378 SUGAR/ION TRANSPORT gi|116516149 SPD_0066 PTS system, IIB component 23.36 0.006 261.8 0.000 30 gi|116516928 SPD_0090 ABC transporter, substrate-binding protein 11.99 0.017 250.12 0.000 45 gi|116516955 SPD_0262 PTS system, mannose/fructose/sorbose family protein, IID component 1.52...”
- Host glycan sugar-specific pathways in Streptococcus pneumoniae: galactose as a key sugar in colonisation and infection [corrected]
Paixão, PloS one 2015 - “...permease 10.3 SPD_0070 agaS Sugar isomerase 9.8 SPD_0063 strH Beta-N-acetylhexosaminidase 8.7 SPD_1663 treC Alpha,alpha-phosphotrehalase 8.0 SPD_0066 PTS system transporter subunit IIB 7.8 SPD_0287 Hyaluronate lyase 7.7 SPD_1495 Sugar ABC transporter sugar-binding protein 6.7 SPD_0293 PTS system transporter subunit IIA 6.5 SPD_1834 Bifunctional acetaldehyde-CoA/alcohol dehydrogenase 5.8 SPD_0292...”
- SPD_0410 negatively regulates capsule polysaccharide synthesis and virulence in <i>Streptococcus pneumoniae</i> D39
Tao, Frontiers in microbiology 2024 - “...Carbohydrate ABC transporter 1.25945 2.60E-06 SPD_RS07940 satB Sugar ABC transporter permease 1.20096 0.000206 Phosphotransferase system SPD_RS00335 gadV PTS system mannose/fructose/N-acetylgalactosamine-transporter subunit IIB 1.76673 9.74E-06 SPD_RS00340 gadW PTSmannose/fructose/sorbose/N- PTS system mannose/fructose/sorbose family transporter subunit IID 1.87046 3.00E-06 SPD_RS00345 gadE PTS sugar transporter subunit IIA 1.69409 3.80E-05 SPD_RS00350...”
HGB56_11975 PTS sugar transporter subunit IIA from Lactiplantibacillus plantarum WCFS1
F9UL56 PTS system, mannose-specific EIIAcomponent from Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
lp_0586 mannose PTS, EIIA from Lactobacillus plantarum WCFS1
44% identity, 40% coverage
- The Carbohydrate Metabolism of Lactiplantibacillus plantarum
Cui, International journal of molecular sciences 2021 - “...were encoded by fruA (HGB56_02940), fruA1-fruA2-fruB (HGB56_07725, HGB56_07730, HGB56_07735), pts9ABCD (HGB56_11950, HGB56_11955, HGB56_11960) and pts10AB (HGB56_11975, HGB56_11980) genes, respectively ( Supplementary Table S3-4 ). Fructose enters cells in the form of 6-phosphate-fructose through these PTSs, then 6-phosphate-fructose is transformed into 1, 6-2P-fructose at the action of...”
- Identification of key proteins and pathways in cadmium tolerance of Lactobacillus plantarum strains by proteomic analysis.
Zhai, Scientific reports 2017 - “...pts9AB; PTS system, mannose-specific EIIAB component 1.73 F9UL47 pts9D; PTS system, mannose-specific EIID component 1.82 F9UL56 pts10A; PTS system, mannose-specific EIIA component 1.52 F9UL57 pts10B; PTS system, mannose-specific EIIB component 3.91 F9URE1 pts19D; PTS system, N-acetylglucosaminespecific EIID component 1.79 F9URE3 pts19B; PTS system, N-acetylglucosaminespecific EIIB component...”
- Comparative analyses imply that the enigmatic Sigma factor 54 is a central controller of the bacterial exterior
Francke, BMC genomics 2011 - “...These include for instance: the genes lp_0562 ( nagA , encoding an N-acetyl-glucosamine-6-phosphate deacetylase) and lp_0586 ( pts10A , encoding a mannose PTS EIIA) in Lactobacillus plantarum WCFS1; the genes PP_0662 (encoding a threonine synthase), PP_4359 ( fliL , encoding a flagellar basal body-associated protein) and...”
Cbei_4559 PTS system sorbose subfamily IIB component from Clostridium beijerincki NCIMB 8052
36% identity, 49% coverage
NJ56_03335 PTS N-acetylgalactosamine transporter subunit IIB from Yersinia ruckeri
36% identity, 46% coverage
- Genome Sequence of the Fish Pathogen Yersinia ruckeri SC09 Provides Insights into Niche Adaptation and Pathogenic Mechanism
Liu, International journal of molecular sciences 2016 - “...be able to mediate various stress responses and virulence. By contrast, the Sec apparatus (NJ56_00285, NJ56_03335, NJ56_03340, NJ56_00965, NJ56_04460-70, NJ56_12650, NJ56_13745, and NJ56_04080) from SC09 appears to translocate polypeptides in an unstructured state. In line with previous findings, SC09 harbors a T4SS (type IV secretion system)...”
LSL_1716 PTS system, mannose-specific IIAB component from Lactobacillus salivarius subsp. salivarius UCC118
LSL_1716 PTS sugar transporter subunit IIB from Ligilactobacillus salivarius UCC118
31% identity, 49% coverage
- Special Issue "Functional Characterization of Lactic Acid Bacteria": Editorial
Rossi, Microorganisms 2023 - “...of mutant strains for the genes mostly upregulated in the presence of bile salts, LSL_1568, LSL_1716, and LSL_1709, were significantly lower than that of the wild-type strain under bile salt conditions. Therefore, the study provided an exhaustive insight into the variability of bile salt tolerance in...”
- Comparative Genomic Analysis Determines the Functional Genes Related to Bile Salt Resistance in Lactobacillus salivarius
Pan, Microorganisms 2021 - “...L. salivarius . In this study, we determined the global regulatory genes, including LSL_1568 , LSL_1716 and LSL_1709 , for bile salt tolerance in L. salivarius and provided a potential method for the rapid screening of bile salt-tolerant L. salivarius strains, based on PCR amplification of...”
- “...latter cluster was enriched in mannose- and N-acetylglucosamine-specific PTS pathways. In particular, two genes ( LSL_1716 and LSL_1715 ) encoding the PTS system transporter subunits IIB and IIC, respectively, were involved in mannose transmembrane transport. Two genes ( LSL_1714 and LSL_1713 ), which encode for the...”
TC 4.A.6.1.18 / B3W754 Phosphotransferase system sugar-specific EIIB component, component of Uptake porter/group translocator of galacto N-biose (Gal-β-1,3-GalNAc: galactose linked β-1,3 to N-acetylgalactosamine), lacto N-biose (Gal-β-1,3-GlcNAc: galactose linked β-1,3 to N-acetylglucosamine), and D-N-acetylgalactosamine (Bidart et al. 2014). The system is designated the GnbABCD system where GnbA = IIA, GnbB = IIB, GnbC = IIC, and GnbD = IID of the mannose-type PTS Enzyme II complex from Lactobacillus casei (strain BL23)
35% identity, 49% coverage
- substrates: Galacto-N-biose, Lacto-N-biose, N-acetyl galactosamine
tcdb comment: These disaccaride substrates are human milk oligosaccharides and glycoconjugates (Bidart et al. 2014)
YPO0834 putative PTS transport protein from Yersinia pestis CO92
YPTB3078 PTS system, N-acetylgalactosamine-specific IIB component from Yersinia pseudotuberculosis IP 32953
YP_3530 putative PTS transport protein from Yersinia pestis biovar Medievalis str. 91001
36% identity, 47% coverage
- Growth of Yersinia pseudotuberculosis in human plasma: impacts on virulence and metabolic gene expression
Rosso, BMC microbiology 2008 - “...1.611 (0.002) 0.731 (0.028) YPTB2962 YPO2644 conserved hypothetical protein (pseudogene. IS100) 2.68 (< 0.001) YPTB3078 YPO0834 putative PTS transport protein 1.742 (0.025) YPTB3190 (rpiA) YPO0915 ribose 5-phosphate isomerase A 0.601 (0.021) 0.641 (0.039) YPTB3195 (fbaA) YPO0920 fructose-bisphosphate aldolase class II 1.325 (0.048) 0.699 (0.015) YPTB3196 (pgk)...”
- Growth of Yersinia pseudotuberculosis in human plasma: impacts on virulence and metabolic gene expression
Rosso, BMC microbiology 2008 - “...component 1.611 (0.002) 0.731 (0.028) YPTB2962 YPO2644 conserved hypothetical protein (pseudogene. IS100) 2.68 (< 0.001) YPTB3078 YPO0834 putative PTS transport protein 1.742 (0.025) YPTB3190 (rpiA) YPO0915 ribose 5-phosphate isomerase A 0.601 (0.021) 0.641 (0.039) YPTB3195 (fbaA) YPO0920 fructose-bisphosphate aldolase class II 1.325 (0.048) 0.699 (0.015) YPTB3196...”
- Reannotation of Yersinia pestis Strain 91001 Based on Omics Data
Mao, The American journal of tropical medicine and hygiene 2016 - “...YP_3528, tagatose 6-phosphate kinase YP_3529, phosphosugar isomerase YP_3530, PTS transport protein YP_3531, PTS permease YP_3532, PTS permease YP_3533, PTS,...”
CPE2632 probable PTS system from Clostridium perfringens str. 13
37% identity, 46% coverage
- RNA-seq analysis of virR and revR mutants of Clostridium perfringens
Low, BMC genomics 2016 - “...(Fig. 4 ). Genes encoding ferredoxin (CPE2511 and CPE1065), PTS system proteins (CPE2629, CPE2631 and CPE2632) and more than 30 sporulation-related proteins are examples of the genes that were regulated only by VirR (Additional file 2 : Table S2). Genes encoding putative ABC transporters (CPE2031, CPE2081,...”
LSEI_0401 PTS system mannose/fructose/N-acetylgalactosamine-transporter subunit IIB from Lacticaseibacillus paracasei ATCC 334
LSEI_0401 Phosphotransferase system, mannose/fructose/N-acetylgalactosamine-specific component IIB from Lactobacillus casei ATCC 334
30% identity, 46% coverage
- Regulatory Mechanisms of L-Lactic Acid and Taste Substances in Chinese Acid Rice Soup (Rice-Acid) Fermented With a Lacticaseibacillus paracasei and Kluyveromyces marxianus
Liu, Frontiers in microbiology 2021 - “...with bitterness intensity ( r = 0.953 ). The expression levels of the two genes (LSEI_0401 and LSEI_2272) had a significant and negative correlation with astringency intensity ( r = 0.964 and 0.974 ). The expression levels of the three genes (LSEI_0322, LSEI_0775, and LSEI_1746) had...”
- “...of fermentation. The up-regulated genes exhibited positive effects on hexosaminidase (LSEI_0291), PTS system, mannose-specific components (LSEI_0401 and LSEI_0561), phosphoglucomutase (LSEI_0949), glutamine-fructose-6-phosphate transaminase (LSEI_1019), UTPglucose-1-phosphate uridylyltransferase (LSEI_1093), and glucosamine-6-phosphate deaminase (LSEI_2889). We further confirmed 17 key DEGs at corresponding positions of starch and sucrose metabolism. The comparison...”
EF0457 PTS system, IIB component from Enterococcus faecalis V583
31% identity, 49% coverage
Pcar_1933 mannose/fructose/N-acetylgalactosamine-specific component IIB from Pelobacter carbinolicus str. DSM 2380
30% identity, 47% coverage
dgaB / A0A0F6B8S7 D-glucosaminate PTS permease components EIIB (EC 2.7.1.203) from Salmonella typhimurium (strain 14028s / SGSC 2262) (see paper)
TC 4.A.6.1.17 / D0ZLR6 Putative phosphotransferase system enzyme IIB, component of D-glucosaminate group translocating uptake porter, DgaABCD (IIA-141 aas, IIB-161 aas, IIC-249 aas, and IID-285 aas, respectively) from Salmonella typhimurium (strain 14028s / SGSC 2262)
30% identity, 49% coverage
- substrates: D-glucosaminate
tcdb comment: Salmonella enterica subsp. enterica serovar Typhimurium (S. Typhimurium) uses d-glucosaminate (2-amino-2-deoxy-d-gluconic acid) as a carbon and nitrogen source via DgaABCD (d-glucosaminate PTS permease components EIIA, EIIB, EIIC, and EIID). Two other genes in the dga operon (dgaE and dgaF) are required for wild-type growth with d-glucosaminate. Transcription of dgaABCDEF is dependent on RpoN (σ54) and an RpoN-dependent activator gene, dgaR. Introduction of a plasmid bearing dgaABCDEF under the control of the lac promoter into E. coli strains allowed them to grow on minimal medium containing d-glucosaminate. d-Glucosaminate is transported and phosphorylated at the C-6 position by DgaABCD. DgaE converts the resulting d-glucosaminate-6-phosphate to 2-keto-3-deoxygluconate 6-phosphate (KDGP), which is subsequently cleaved by the aldolase DgaF to form glyceraldehyde-3-phosphate and pyruvate. DgaF catalyzes the same reaction as that catalyzed by Eda, a KDGP aldolase in the Entner-Doudoroff pathway, and the two enzymes can substitute for each other in their respective pathways. Orthologs of the dga genes are largely restricted to certain enteric bacteria and a few Firmicutes (Miller et al. 2013)
CD3279 PTS system, IIb component from Clostridium difficile 630
CD630_32790 PTS system mannose/fructose/N-acetylgalactosamine-transporter subunit IIB from Clostridioides difficile 630
34% identity, 48% coverage
- Genome-Wide Transcription Start Site Mapping and Promoter Assignments to a Sigma Factor in the Human Enteropathogen Clostridioides difficile
Soutourina, Frontiers in microbiology 2020 - “...TTGCTT A CD3245/PrdR CD3247 / prdC prdC Proline utilization T TGGCA TAGAAA TTGCTT T CD3245/PrdR CD3279 CD3279-CD3275 PTS Mannose/fructose/sorbose family, sugar-P isomerase T TGGCA TACTTT TTGCTT T CD3280 LevR-type # the transcriptional start sites were mapped by 5-end RNA-seq (see Supplementary Table S2 ). * as...”
- “...7 operons encoding phosphotransferase systems (PTS) belonging to the mannose ( CD0284 , CD0490 , CD3279 ), cellobiose ( CD0860 ) or mannitol/galactitol ( CD0040 , CD2283 , CD2327 ) sub-families ( Table 4 and Supplementary Figure S9 ). These PTS operons are associated with 5...”
- The flagellin FliC of Clostridium difficile is responsible for pleiotropic gene regulation during in vivo infection
Barketi-Klai, PloS one 2014 - “...PTS system, mannose/fructose/sorbose IIC component 11.76 CDR3139 CD630_32780 PTS system, mannose/fructose/sorbose IIA component 10.83 CDR3140 CD630_32790 PTS system, mannose/fructose/sorbose IIB component 7.75 CDR2862 CD630_30270 PTS system, glucose-specific IIA component 0.07 CDR2863 CD630_30280 Putative phosphosugar isomerase 0.06 CDR2864 CD630_30290 malY Bifunctional protein: cystathionine beta-lyase/repressor 0.05 CDR2865 CD630_30300...”
STM3771 putative phosphotransferase system enzyme IIB from Salmonella typhimurium LT2
SL1344_3736 PTS system mannose/fructose/N-acetylgalactosamine-transporter subunit IIB from Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344
30% identity, 49% coverage
- Salmonella serovar identification using PCR-based detection of gene presence and absence
Arrach, Journal of clinical microbiology 2008 - “...STM3125, STM3358, STM3546, STM3652, STM3653, STM3671, STM3771, STM3859, STM4066, STM4206, STM4215, STM4218, STM4447, STM4483, STM4498, STM4528, PSLT040,...”
- speG Is Required for Intracellular Replication of Salmonella in Various Human Cells and Affects Its Polyamine Metabolism and Global Transcriptomes
Fang, Frontiers in microbiology 2017 - “...reductase system; ygcX, ygcZ, garL, garR , and SL1344_2942, which are associated with glucarate metabolism; SL1344_3736 and SL1344_4467, which are related to the phosphotransferase system; cyoA, cyoB , and cyoC , which encode cytochrome-related proteins; and sdhA, sdhB, sdhC , and sdhD , which are involved...”
- “...2.760 ygcX SL1344_2941 Glucarate dehydratase 2.037 SL1344_2942 SL1344_2942 Glucarate dehydratase 1.257 Genes of Phosphotransferase System SL1344_3736 SL1344_3736 Putative PTS system protein 1.673 SL1344_4467 SL1344_4467 PTS transport system, IIB component 1.621 Genes of Cytochromes cyoA SL1344_0437 Cytochrome o ubiquinol oxidase subunit II 1.668 cyoB SL1344_0436 Cytochrome o...”
plu0835 PTS system, N-acetylgalactosamine-specific IIB component 2 (EIIB-AGA') (N-acetylgalactosamine-permease IIB component 2) (Phosphotransferase enzyme II, B component 2) from Photorhabdus luminescens subsp. laumondii TTO1
39% identity, 44% coverage
- Genetic and proteomic characterization of rpoB mutations and their effect on nematicidal activity in Photorhabdus luminescens LN2
Qiu, PloS one 2012 - “...0.87 0 Post-translational modification 61 PTS system, N-acetyl- galactosamine-specific IIB component 2 (EIIB-AGA) (N-acetyl- galactosamine-perme, plu0835 P. luminescens TT01 agaV Probable PTS system; Highly similar to PTS system, cytoplasmic, N-acetylgalactosamine-specific 6.51 17774.4 1 3.87 2.18 4.31 1.5 Uknown 2 Hypothetical protein, plu0661 P. luminescens TT01 Highly...”
- Photorhabdus luminescens genes induced upon insect infection
Münch, BMC genomics 2008 - “...3,3-fold ( 0.3) agaZ ( plu0833 ) tagatose-6-phosphate-Kinase agaS (plu0834) tagatose-6-phosphate ketose/aldose isomerase agaV ( plu0835 ) PTS-system, N-acetylgalactosamine-specific IIB component 2 (EIIB-AGA') agaC ( plu0836 ) PTS-system, N-acetylgalactosamine-specific IIC component 1 (EIIC-AGA) agaD ( plu0837 ) PTS-System, N-acetylgalactosamine-specific IID component (EIID-AGA) plu0838 unknown, putative PTS...”
Entcl_3812 PTS system mannose/fructose/N-acetylgalactosamine-transporter subunit IIB from [Enterobacter] lignolyticus SCF1
30% identity, 49% coverage
lp_2650 PTS galactosamine transporter subunit IIB from Lactiplantibacillus plantarum WCFS1
F9URE3 PTS system, N-acetylglucosamine-specific EIIB component from Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
lp_2650 N-acetylgalactosamine PTS, EIIB from Lactobacillus plantarum WCFS1
33% identity, 48% coverage
- Molecular Responses of Lactobacilli to Plant Phenolic Compounds: A Comparative Review of the Mechanisms Involved
López, Antioxidants (Basel, Switzerland) 2021 - “...lp_2647 pts19A : PTS system, N -acetylglucosamine/galactosamine-specific EIIA component OLE Immunomodulatory capacity [ 108 ] lp_2650 pts19B : PTS system, N -acetylglucosamine-specific EIIB component OLE Immunomodulatory capacity [ 108 ] lp_2460 prophage P2b protein 21 OLE Immunomodulatory capacity [ 108 ] a Reference describing the regulation...”
- Identification of key proteins and pathways in cadmium tolerance of Lactobacillus plantarum strains by proteomic analysis.
Zhai, Scientific reports 2017 - “...pts10B; PTS system, mannose-specific EIIB component 3.91 F9URE1 pts19D; PTS system, N-acetylglucosaminespecific EIID component 1.79 F9URE3 pts19B; PTS system, N-acetylglucosaminespecific EIIB component 1.70 F9URP8 pts20A; PTS system, cellobiose-specific EIIA component 2.47 F9URP9 pts20B; PTS system, cellobiose-specific EIIB component 2.99 F9UUH8 pts30BCA; PTS system, beta-glucosidespecific EIIBCA component...”
- Oleuropein Transcriptionally Primes Lactobacillus plantarum to Interact With Plant Hosts
Santamaría, Frontiers in microbiology 2019 - “...loci with confirmed immunomodulatory capacities such as components of the pts19ADCBR locus ( lp_2647 , lp_2650 ) the prophage P2b protein 21 ( lp_2460 ) ( van Hemmert et al., 2010 ) and components of the N -glucosamine/galactosamine phosphotransferase system ( lp_2647 and lp_2650 ) (...”
- “...of N -acetyl-glucosamine (GlcNAc) ( pts18CBA or lp_2531 ), N -acetyl-galactosamine (GalNAc) ( pts19B or lp_2650 ) and GlcNAc/GalNAc ( pts19A or lp_2647 ) were downregulated. Oleuropein Affects Biological Functions Involved in Cell Proliferation The DAVID analysis also enriched genes encompassed within several categories related to...”
- Identification of prebiotic fructooligosaccharide metabolism in Lactobacillus plantarum WCFS1 through microarrays
Saulnier, Applied and environmental microbiology 2007 - “...lp_1471 lp_1472 lp_1473 lp_1686 lp_1921 lp_2531 lp_2649 lp_2650 lp_2710 lp_2776 lp_2789 lp_2982 lp_2984 lp_3491 lp_3533 lp_3543 lp_3665 Mannitol PTS, EIICB...”
SAG1900 PTS system, IIB component from Streptococcus agalactiae 2603V/R
ID870_00430 PTS sugar transporter subunit IIB from Streptococcus agalactiae CJB111
35% identity, 43% coverage
- Adaptive response of neonatal sepsis-derived Group B Streptococcus to bilirubin
Hansen, Scientific reports 2018 - “...1.28E-04 2.46E-02 SAG0680 Hypothetical protein 0.41 1.29E-04 2.46E-02 SAG0325 Pyruvate formate-lyase-activating enzyme 1.81 1.91E-04 3.31E-02 SAG1900 PTS system transporter subunit IIB 1.55 2.67E-04 4.02E-02 SAG0795 Hypothetical protein 2.83 2.73E-04 4.02E-02 SAG1925 Sugar ABC transporter ATP-binding protein 2.02 3.37E-04 4.60E-02 SAG1441 Maltose/maltodextrin ABC transporter maltose/maltodextrin-binding protein 2.19...”
- Genomic Analyses Identify Manganese Homeostasis as a Driver of Group B Streptococcal Vaginal Colonization
Burcham, mBio 2022 - “...sugar transporter subunit IIB 9.85 ID870_00265 PTS sugar transporter subunit IIA 6.35 7.73 8.63 5.88 ID870_00430 PTS system mannose/fructose/ N -acetylgalactosamine-transporter subunit IIB 7.30 ID870_00990 PTS fructose transporter subunit IIB 9.43 19.55 21.30 ID870_00995 PTS sugar transporter subunit IIA 7.71 6.94 6.60 ID870_01290 PTS glucose transporter...”
KPN_04803 putative PTS permease from Klebsiella pneumoniae subsp. pneumoniae MGH 78578
29% identity, 46% coverage
CD0287 PTS system, IIb component from Clostridium difficile 630
CD630_02870, CDIF630erm_00411 PTS system mannose/fructose/N-acetylgalactosamine-transporter subunit IIB from Clostridioides difficile
28% identity, 49% coverage
- Temporal differential proteomes of Clostridium difficile in the pig ileal-ligated loop model
Janvilisri, PloS one 2012 - “...through phosphotransferase systems (PTS) including PtsG (CD2667), MalX (CD3030), and CD3137 were down-regulated, others including CD0287, GatC (CD2325), PtsH (CD2756), CD3068, and CD3069 were found to be up-regulated. These results suggest that the changes in metabolic states of C. difficile within the host environments may provide...”
- Iron Regulation in Clostridioides difficile
Berges, Frontiers in microbiology 2018 - “...0.14 2.61 0.62 CD630_02860 CDIF630erm_00410 PTS system mannose/fructose/sorbose transporter subunit IIA 2.27 -0.52 2.43 0.64 CD630_02870 CDIF630erm_00411 PTS system mannose/fructose/sorbose transporter subunit IIB 1.90 0.20 2.70 1.00 CD630_02880 CDIF630erm_00412 PTS system mannose/fructose/sorbose transporter subunit IIC 1.51 -0.14 2.68 0.06 CD630_02890 CDIF630erm_00413 PTS system mannose/fructose/sorbose transporter subunit...”
- “...2.61 0.62 CD630_02860 CDIF630erm_00410 PTS system mannose/fructose/sorbose transporter subunit IIA 2.27 -0.52 2.43 0.64 CD630_02870 CDIF630erm_00411 PTS system mannose/fructose/sorbose transporter subunit IIB 1.90 0.20 2.70 1.00 CD630_02880 CDIF630erm_00412 PTS system mannose/fructose/sorbose transporter subunit IIC 1.51 -0.14 2.68 0.06 CD630_02890 CDIF630erm_00413 PTS system mannose/fructose/sorbose transporter subunit IID...”
Entcl_4034 PTS system mannose/fructose/N-acetylgalactosamine-transporter subunit IIB from [Enterobacter] lignolyticus SCF1
32% identity, 48% coverage
- Multi-time series RNA-seq analysis of Enterobacter lignolyticus SCF1 during growth in lignin-amended medium
Orellana, PloS one 2017 - “...of cellobiose (Entcl_2546 and Entcl_3764), chitobiose (Entcl_2547 and Entcl_2548), maltose (Entcl_3261) and mannose (Entcl_4032, Entcl_4033, Entcl_4034 and Entcl_4036). Furthermore, many genes involved in the uptake of other sugars beside glucose were up-regulated after glucose uptake was stopped ( Fig 2C ) (Entcl_0166, Entcl_0167, Entcl_1205, Entcl_1207, Entcl_3382,...”
PTFA_BACSU / P26379 PTS system fructose-specific EIIA component; EIIA-Fru; Fructose-specific phosphotransferase enzyme IIA component; lev-PTS; p16 from Bacillus subtilis (strain 168) (see 3 papers)
TC 4.A.6.1.2 / P26379 PTFA aka LEVD aka SACL, component of Fructose group translocator, LevDEFG from Bacillus subtilis (see 3 papers)
38% identity, 32% coverage
- function: The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. The enzyme II LevDE PTS system is involved in fructose transport.
function: LevD and LevE act as negative regulators of the levanase operon. They may be involved in a PTS-mediated phosphorylation of a regulator. - substrates: fructose
LJ0739 phosphoenolpyruvate-dependent sugar phosphotransferase system EIIB, probable sorbose specific from Lactobacillus johnsonii NCC 533
33% identity, 43% coverage
CD630_02840, CDIF630erm_00408 PTS sugar transporter subunit IIA from Clostridioides difficile 630
CD0284 PTS system, IIa component from Clostridium difficile 630
35% identity, 39% coverage
- What's a Biofilm?-How the Choice of the Biofilm Model Impacts the Protein Inventory of Clostridioides difficile
Brauer, Frontiers in microbiology 2021 - “...et al., 2020 ). For instance, the galactitol-specific PTS component CDIF630erm_00104, the mannose-specific PTS components CDIF630erm_00408 and CDIF630_00409 and the ribitol-specific PTS component CDIF630erm_00620 were either found in higher amounts or exclusively in aggregate biofilms. Since toxin synthesis was recently found to be negatively controlled by...”
- Iron Regulation in Clostridioides difficile
Berges, Frontiers in microbiology 2018 - “...Phosphoglucomutase 2.75 0.22 3.20 0.06 CD630_27810 CDIF630erm_03044 mviN Transmembrane virulence factor 3.67 -0.93 4.13 0.78 CD630_02840 CDIF630erm_00408 PTS system mannose/fructose/sorbose transporter subunit IIA -0.04 0.88 CD630_02850 CDIF630erm_00409 PTS system mannose/fructose/sorbose transporter subunit IIB 1.86 0.14 2.61 0.62 CD630_02860 CDIF630erm_00410 PTS system mannose/fructose/sorbose transporter subunit IIA 2.27...”
- “...2.75 0.22 3.20 0.06 CD630_27810 CDIF630erm_03044 mviN Transmembrane virulence factor 3.67 -0.93 4.13 0.78 CD630_02840 CDIF630erm_00408 PTS system mannose/fructose/sorbose transporter subunit IIA -0.04 0.88 CD630_02850 CDIF630erm_00409 PTS system mannose/fructose/sorbose transporter subunit IIB 1.86 0.14 2.61 0.62 CD630_02860 CDIF630erm_00410 PTS system mannose/fructose/sorbose transporter subunit IIA 2.27 -0.52...”
- “...Both genes were found up-regulated under low iron conditions. The phosphotransferase uptake system for mannose/fructose/sorbose (CDIF630erm_00408 00413) was also found enhanced twothreefold at the transcriptional level. Mannose-derived and guanosine-activated compounds are important constituents of the Gram-positive cell wall. In contrast, the genes for the enzymes N...”
- Genome-Wide Transcription Start Site Mapping and Promoter Assignments to a Sigma Factor in the Human Enteropathogen Clostridioides difficile
Soutourina, Frontiers in microbiology 2020 - “...LevR-type CD0166 CD0166-CD0165 Peptidase, amino acid transporter 0.17* A TGGCA TAATAA TTGCTT A CD0167, GamR-type CD0284 CD0284-CD0289 PTS Mannose/fructose/sorbose family 0.2 to 0.3 T TGGCA CGGCAA TTGCTT A CD0283, LevR-type CD0395/hadA# hadAIBC-acdB-etfBA1 Leucine utilization < 0.001 (0.00001*) T TGGCA CGATTT ATGCTT T CD0402/LeuR CD0442/ord # ord-ortAB-oraSEF-orr-nhaC...”
- “...SigL-dependent promoters upstream of 7 operons encoding phosphotransferase systems (PTS) belonging to the mannose ( CD0284 , CD0490 , CD3279 ), cellobiose ( CD0860 ) or mannitol/galactitol ( CD0040 , CD2283 , CD2327 ) sub-families ( Table 4 and Supplementary Figure S9 ). These PTS operons...”
TC 4.A.6.1.25 / CAQ67973.1 CAQ67973.1 AhaB protein (Fragment), component of D-ribitol (D-aldonitol) (a pentitol) PTS Enzyme II complex RtlABCD from Lactobacillus casei BL23
32% identity, 45% coverage
gfrB / A0A0F6BB78 fructoselysine/glucoselysine PTS enzyme IIB component from Salmonella typhimurium (strain 14028s / SGSC 2262) (see paper)
TC 4.A.6.1.19 / V7IFY8 PTS system sorbose subfamily IIB component, component of PTS uptake system for glucoselysine and fructoselysine, GfrABCD from Salmonella enterica subsp. enterica serovar Cubana str. 76814
SL1344_4467 PTS sugar transporter subunit IIB from Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344
STM4536 putative PTS permease from Salmonella typhimurium LT2
30% identity, 46% coverage
- substrates: Fructoselysine, Glucoselysine
tcdb comment: Two glycases, GfrE and GfrF, are requred for the utilization of these two compounds for growth, respectively, and GfrF was shown to hydrolyze fructoselysine-6-P to lysine and fructose-6-P. Expression of the operon, gfrABCDEF, is regulated by a transcriptional activator, GfrR and sigma factor RpoN (Miller et al. 2015). GfrD affects proteolytic processing, a necessary but insufficient step for CadC activation, rendering CadC able to activate target genes involved in lysine metabolism (Lee et al. 2013) - speG Is Required for Intracellular Replication of Salmonella in Various Human Cells and Affects Its Polyamine Metabolism and Global Transcriptomes
Fang, Frontiers in microbiology 2017 - “...ygcX, ygcZ, garL, garR , and SL1344_2942, which are associated with glucarate metabolism; SL1344_3736 and SL1344_4467, which are related to the phosphotransferase system; cyoA, cyoB , and cyoC , which encode cytochrome-related proteins; and sdhA, sdhB, sdhC , and sdhD , which are involved in the...”
- “...SL1344_2942 Glucarate dehydratase 1.257 Genes of Phosphotransferase System SL1344_3736 SL1344_3736 Putative PTS system protein 1.673 SL1344_4467 SL1344_4467 PTS transport system, IIB component 1.621 Genes of Cytochromes cyoA SL1344_0437 Cytochrome o ubiquinol oxidase subunit II 1.668 cyoB SL1344_0436 Cytochrome o ubiquinol oxidase subunit I 1.406 cyoC SL1344_0716...”
- The Bacterial iprA Gene Is Conserved across Enterobacteriaceae, Is Involved in Oxidative Stress Resistance, and Influences Gene Expression in Salmonella enterica Serovar Typhimurium
Herman, Journal of bacteriology 2016 - “...1.0E300 PTS transport system genes SL1344_4466 SL1344_4467 SL1344_4468 SL1344_4469 SL1344_4470 SL1344_4471 PTS transporter PTS transporter PTS transporter PTS...”
- Isolation of highly persistent mutants of Salmonella enterica serovar typhimurium reveals a new toxin-antitoxin module
Slattery, Journal of bacteriology 2013 - “...the open reading frames distal to mrr (STM4528 to STM4536) with a kan cassette (Fig. 4B). After deletion of the kan cassette by site-specific recombination...”
- “...significantly reduced (Fig. 4C). Within the STM4528 to STM4536 deletion, we were intrigued that two of the predicted open reading frames, STM4528 and STM4529,...”
LCAZH_2665 PTS sugar transporter subunit IIB from Lacticaseibacillus paracasei
33% identity, 40% coverage
- Roles of adenine methylation in the physiology of Lacticaseibacillus paracasei
Zhao, Nature communications 2023 - “...subunit IID (LCAZH_2663), PTS sugar transporter subunit IIC (LCAZH_2664), and PTS sugar transporter subunit IIB (LCAZH_2665). In E. coli , Aga-PTSs are responsible for N-acetyl-galactosamine and galactosamine utilization 31 . These amino sugars are particularly required for bacterial cell wall synthesis. Therefore, the increase in uptake...”
agaB / Q8XAB8 AgaB (EC 2.7.1.193) from Escherichia coli O157:H7 (see 4 papers)
Z_RS21140 PTS galactosamine transporter subunit IIB from Escherichia coli O157:H7 str. EDL933
Z4492 PTS system, cytoplasmic, N-acetylgalactosamine-specific IIB component 1 (EIIB-AGA) from Escherichia coli O157:H7 EDL933
34% identity, 47% coverage
- Transcriptomic Analysis of Viable but Non-Culturable Escherichia coli O157:H7 Formation Induced by Low Temperature
Zhong, Microorganisms 2019 - “...OAT, SSTTA, ITTA 1 Z_RS26780, Z_RS26335, Z_RS25895, Z_RS25370, Z_RS24525, Z_RS24370, Z_RS23610, Z_RS23465, Z_RS22905, Z_RS21350, Z_RS21150, Z_RS21140, Z_RS21025, Z_RS19885, Z_RS18625, Z_RS16005, Z_RS12610, Z_RS12490, Z_RS09475, Z_RS09120, Z_RS04060, Z_RS03890, Z_RS02910, Z_RS02490, Z_RS01960, sec F, pst S, pst A, nep I, lam B, gld A, gcv T, gcv H, fuc...”
- Transcriptomic analysis reveals specific metabolic pathways of enterohemorrhagic Escherichia coli O157:H7 in bovine digestive contents
Segura, BMC genomics 2018 - “...-value Z2315 acpD FMN-dependent NADH-azoreductase 2.53 7.91E-05 5.12 7.34E-17 3.16 6.19E-07 4.77 7.25E-15 2.38 2.65E-04 Z4492 agaB PTS system galactosamine-specific IIB component NDE 3.01 2.87E-05 NDE 3.27 2.44E-06 NDE Z4493 agaC PTS system galactosamine-specific IIC component NDE 2.11 4.41E-03 NDE 2.15 1.61E-03 NDE Z4487 agaE PTS...”
Teth514_0135 PTS system sorbose subfamily IIB component from Thermoanaerobacter ethanolicus X514
31% identity, 48% coverage
plu0838 No description from Photorhabdus luminescens subsp. laumondii TTO1
31% identity, 43% coverage
- Photorhabdus luminescens genes induced upon insect infection
Münch, BMC genomics 2008 - “...PTS-system, N-acetylgalactosamine-specific IIC component 1 (EIIC-AGA) agaD ( plu0837 ) PTS-System, N-acetylgalactosamine-specific IID component (EIID-AGA) plu0838 unknown, putative PTS permease gatY ( plu0839 ) tagatose-bisphosphate aldolase GatY eutABC 3.5-fold ( 1.0) eutA ( plu2969 ) ethanolamine degradation eutB ( plu2970 ) ethanolamine-ammonia-lyase heavy chain eutC (...”
AgaB / b3138 galactosamine-specific PTS enzyme IIB component from Escherichia coli K-12 substr. MG1655 (see 2 papers)
TC 4.A.6.1.5 / P42909 PTPB aka AgaB aka B3138, component of Galactosamine (GalN or Gam) porter (used the same IIA protein (AgaF) as does 4.A.6.1.4) from Escherichia coli (see 4 papers)
b3138 N-acetylgalactosamine-specific enzyme IIB component of PTS from Escherichia coli str. K-12 substr. MG1655
34% identity, 47% coverage
EF2979 PTS system, IIB component from Enterococcus faecalis V583
OG1RF_12261 PTS system mannose/fructose/N-acetylgalactosamine-transporter subunit IIB from Enterococcus faecalis OG1RF
27% identity, 49% coverage
Entcl_3690 PTS system mannose/fructose/N-acetylgalactosamine-transporter subunit IIB from [Enterobacter] lignolyticus SCF1
33% identity, 45% coverage
I6G91_01130 PTS sugar transporter subunit IIB from Fannyhessea vaginae
29% identity, 48% coverage
CD630_02850, CDIF630_00409, CDIF630erm_00409 PTS sugar transporter subunit IIB from Clostridioides difficile 630
27% identity, 49% coverage
- What's a Biofilm?-How the Choice of the Biofilm Model Impacts the Protein Inventory of Clostridioides difficile
Brauer, Frontiers in microbiology 2021 - “...2020 ). For instance, the galactitol-specific PTS component CDIF630erm_00104, the mannose-specific PTS components CDIF630erm_00408 and CDIF630_00409 and the ribitol-specific PTS component CDIF630erm_00620 were either found in higher amounts or exclusively in aggregate biofilms. Since toxin synthesis was recently found to be negatively controlled by SigL/RpoN in...”
- Iron Regulation in Clostridioides difficile
Berges, Frontiers in microbiology 2018 - “...factor 3.67 -0.93 4.13 0.78 CD630_02840 CDIF630erm_00408 PTS system mannose/fructose/sorbose transporter subunit IIA -0.04 0.88 CD630_02850 CDIF630erm_00409 PTS system mannose/fructose/sorbose transporter subunit IIB 1.86 0.14 2.61 0.62 CD630_02860 CDIF630erm_00410 PTS system mannose/fructose/sorbose transporter subunit IIA 2.27 -0.52 2.43 0.64 CD630_02870 CDIF630erm_00411 PTS system mannose/fructose/sorbose transporter subunit...”
- “...3.67 -0.93 4.13 0.78 CD630_02840 CDIF630erm_00408 PTS system mannose/fructose/sorbose transporter subunit IIA -0.04 0.88 CD630_02850 CDIF630erm_00409 PTS system mannose/fructose/sorbose transporter subunit IIB 1.86 0.14 2.61 0.62 CD630_02860 CDIF630erm_00410 PTS system mannose/fructose/sorbose transporter subunit IIA 2.27 -0.52 2.43 0.64 CD630_02870 CDIF630erm_00411 PTS system mannose/fructose/sorbose transporter subunit IIB...”
SMU_100 PTS system mannose/fructose/N-acetylgalactosamine-transporter subunit IIB from Streptococcus mutans UA159
27% identity, 46% coverage
- Cnm of Streptococcus mutans is important for cell surface structure and membrane permeability
Naka, Frontiers in cellular and infection microbiology 2022 - “...transporter ATP-binding subunit 1029326 SMU_2149c 3.115 malX Maltose ABC transporter substrate-binding protein 1028671 SMU_1568 2.836 SMU_100 PTS system sorbose transporter subunit IIB 1029681 SMU_100 2.743 SMU_1178c Amino acid ABC transporter ATP-binding protein 1028485 SMU_1178c 2.646 SMU_2150c Cobalt transporter ATP-binding subunit 1029324 SMU_2150c 2.609 SMU_1938c ABC transporter...”
CPE2629 probable PTS system from Clostridium perfringens str. 13
31% identity, 40% coverage
- RNA-seq analysis of virR and revR mutants of Clostridium perfringens
Low, BMC genomics 2016 - “...by RevR (44) (Fig. 4 ). Genes encoding ferredoxin (CPE2511 and CPE1065), PTS system proteins (CPE2629, CPE2631 and CPE2632) and more than 30 sporulation-related proteins are examples of the genes that were regulated only by VirR (Additional file 2 : Table S2). Genes encoding putative ABC...”
CDIF630erm_00620 PTS sugar transporter subunit IIA from Clostridioides difficile
36% identity, 39% coverage
agaF / Q8XAC4 AgaF (EC 2.7.1.193) from Escherichia coli O157:H7 (see 4 papers)
Z4488 putative phosphotransferase system enzyme subunit from Escherichia coli O157:H7 EDL933
ECs4014 N-acetyl-galactosamine / galactosamine PTS system enzyme IIA component from Escherichia coli O157:H7 str. Sakai
33% identity, 39% coverage
- Transcriptomic analysis reveals specific metabolic pathways of enterohemorrhagic Escherichia coli O157:H7 in bovine digestive contents
Segura, BMC genomics 2018 - “...agaE PTS system N-acetylgalactosamine-specific IID component NDE 3.97 1.62E-10 2.60 4.74E-05 3.99 6.14E-11 2.44 1.35E-04 Z4488 agaF PTS system N-acetylgalactosamine-specific IIA component NDE 3.23 1.41E-08 NDE 3.20 7.02E-09 NDE Z4485 agaV PTS system N-acetylgalactosamine-specific IIB component NDE 6.10 6.41E-23 3.22 5.89E-07 4.79 1.45E-14 2.52 1.40E-04 Z4486...”
- Carbohydrate utilization by enterohaemorrhagic Escherichia coli O157:H7 in bovine intestinal content
Bertin, Environmental microbiology 2013 - “...manA , nagE , and nanAT genes were designed according to the EDL933 genome sequence (Z4488, Z4117 and Z416, Z0927, Z2616, Z0826, Z4583 and Z4582 respectively). The PCR products were purified using the Qiaquick Purification PCR kit (Qiagen) and digested with the relevant enzymes. The PCR...”
- Global effect of RpoS on gene expression in pathogenic Escherichia coli O157:H7 strain EDL933
Dong, BMC genomics 2009 - “...Sucrose hydrolase Z3947 8.3 0.4 4.0 0.5 19 O-Island 108 Unknown (Phage or Prophage Related) Z4488 7.8 0.2 5.6 0.4 4 O-Island 126 Putative enzyme Z4803 6.4 0.9 2.4 0.1 17 O-Island 134 Putative enzyme Z5114 7.4 0.3 4.9 0.4 6 O-Island 148 LEE-encoded virulence protein...”
- Altered utilization of N-acetyl-D-galactosamine by Escherichia coli O157:H7 from the 2006 spinach outbreak
Mukherjee, Journal of bacteriology 2008 - “...in the agaF gene coding for EIIAAga/Gam (annotated as Z4488 in EDL933 and as ECs4014 in Sakai) in both EC4042 and EC4191, leading to a Gly91Ser substitution....”
- Altered utilization of N-acetyl-D-galactosamine by Escherichia coli O157:H7 from the 2006 spinach outbreak
Mukherjee, Journal of bacteriology 2008 - “...for EIIAAga/Gam (annotated as Z4488 in EDL933 and as ECs4014 in Sakai) in both EC4042 and EC4191, leading to a Gly91Ser substitution. To ascertain the frequency...”
- “...the agaF gene from the Sakai strain (annotated as ECs4014) was cloned into the expression vector pJF118HE downstream of the tac promoter such that the...”
SP_0323 PTS sugar transporter subunit IIB from Streptococcus pneumoniae TIGR4
34% identity, 41% coverage
- The Effect of Impaired Polyamine Transport on Pneumococcal Transcriptome
Nakamya, Pathogens (Basel, Switzerland) 2021 - “...nagA 2.3 <0.0001 N-acetylglucosamine 6-phosphate deacetylase SP_0321 SP_0321 2.3 <0.0001 PTS N-acetylgalactosamine transporter subunit IIA SP_0323 SP_0323 2.6 <0.0001 PTS N-acetylgalactosamine PTS system EIIB SP_1277 pyrB 2.4 <0.0001 Aspartate carbamoyltransferase SP_1014 dapA 4.3 <0.0001 4-hydroxy-tetrahydrodipicolinate synthase SP_1013 asd 5.5 <0.0001 Aspartate-semialdehyde dehydrogenase FDR (False discovery rate)....”
- Polyamine Synthesis Effects Capsule Expression by Reduction of Precursors in Streptococcus pneumoniae
Ayoola, Frontiers in microbiology 2019 - “...3.7 SP_2168 SP_2168 Putative fucose operon repressor 1.9 SP_0321 SP_0321 PTS system, IIA component 2.4 SP_0323 SP_0323 PTS system, IIB component 3.7 SP_0324 SP_0324 PTS system, IIC component 3.7 SP_0325 SP_0325 PTS system, IID component 3.5 glgB SP_1121 1,4-Alpha-glucan branching enzyme 2.1 glgC SP_1122 Glucose-1-phosphate adenylyltransferase...”
- Multi-omic profiling to assess the effect of iron starvation in Streptococcus pneumoniae TIGR4
Jiménez-Munguía, PeerJ 2018 - “...Downregulated 38498 SP_0164, SP_0165 2/2 Downregulated 38510 SP_0220, SP_0221, SP_0222 3/14 Downregulated 38529 SP_0321, SP_0322, SP_0323, SP_0324, SP_0325, SP_0326 6/6 Downregulated 38533 SP_0352, SP_0354 2/9 Downregulated 38546 SP_0412, SP_0413 2/2 Downregulated 38547 SP_0416, SP_0417 2/2 Downregulated 38533 SP_0352, SP_0354 2/9 Downregulated 38546 SP_0412, SP_0413 2/2 Downregulated...”
- The biofilm inhibitor Carolacton inhibits planktonic growth of virulent pneumococci via a conserved target
Donner, Scientific reports 2016 - “...transporter subunit IID 4.56 5.10E-123 sp_0322 glucuronyl hydrolase 4.73 2.58E-100 sp_0327 hypothetical protein 4.41 5.05E-74 sp_0323 PTS system transporter subunit IIB 4.80 2.75E-95 sp_0326 preprotein translocase subunit yajC 4.55 5.11E-74 sp_0321 PTS system transporter subunit IIA 4.96 6.23E-89 Carbon metabolism/Pentose phosphate pathway sp_0318 carbohydrate kinase 4.13...”
TC 4.A.6.1.14 / Q8DR76 Phosphotransferase system sugar-specific EII component, component of Probable PTS uptake porter (IIA - IID) of disaccharides of gluconate and N-acetyglucosamine derived from degradation of hyaluronate and chondroitin by hyaluronidase (Marion et al. 2012). The cytoplasmic disaccharide may be hydrolyzed by the enzyme Ugl from Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
SPD_0295 PTS system, IIB component from Streptococcus pneumoniae D39
spr0293 Phosphotransferase system sugar-specific EII component from Streptococcus pneumoniae R6
34% identity, 41% coverage
- substrates: Gluconate, N-acetyglucosamine
- Time-resolved dual RNA-seq reveals extensive rewiring of lung epithelial and pneumococcal transcriptomes during early infection
Aprianto, Genome biology 2016 - “...non-glucose transporters were activated ( p <0.05, FC>2) in the cps2E strain: SPD_0089, celC , SPD_0295, SPD_0232/33/34, rafE , and malD . e We validated the data by qRT-PCR for three sugar importers: malD (polysaccharides), rafE (oligosaccharide), and SPD_0234 (non-glucose disaccharide). By removing epithelial mucus prior...”
- “...their substrates are SPD_0089 (disaccharides: galactose, mannose, N-acetylmannosamine), celC (disaccharides: cellobiose, gentiobiose), SPD_0232/33/34 (disaccharides: cellobiose), SPD_0295 (disaccharides: lactose and lactulose), rafE (oligosaccharides: raffinose, stachyose, melliobiose) and malD (polysaccharides: maltotitriol, maltodextrine, glycogen) (Fig. 7d ). At the same time, four genes were repressed in unencapsulated S. pneumoniae...”
- Streptococcus pneumoniae can utilize multiple sources of hyaluronic acid for growth
Marion, Infection and immunity 2012 - “...were used for the ugl mutant (PTS enzyme IIB [EIIB], spr0293), and primers P.9 and P.5 were used for the spr0293-5 mutant (spr0296) (Table 2). As hyl is...”
- “...family PTS transporter of unknown specificity (spr0291 and spr0293 to spr0295) (Fig. 3D). The PTS is the major mechanism of carbohydrate transport for many...”
EF3211 PTS system, IIB component from Enterococcus faecalis V583
34% identity, 41% coverage
B9H01_05890 PTS system mannose/fructose/N-acetylgalactosamine-transporter subunit IIB from Streptococcus suis
34% identity, 41% coverage
- PPNet: Identifying Functional Association Networks by Phylogenetic Profiling of Prokaryotic Genomes
Li, Microbiology spectrum 2023 - “...highly enriched in multiple molecular functions, which included protein-N (PI)/phosphohistidine-sugar phosphotransferase activity (B9H01_05885; B9H01_05880 and B9H01_05890), kinase activity (B9H01_05910; B9H01_05890 and B9H01_05900), lyase activity (B9H01_05850; B9H01_05870), and d -glucosamine phosphotransferase system (PTS) permease activity (B9H01_05885; B9H01_05880). The function of the other genes of this module included...”
CPF_0401 PTS system, mannose/fructose/sorbose family, IIB component from Clostridium perfringens ATCC 13124
28% identity, 44% coverage
YP_3533 Phosphotransferase system, mannose/fructose-specific component IIA from Yersinia pestis biovar Medievalis str. 91001
YPTB3081 PTS system, N-acetylgalactosamine-specific IIA component from Yersinia pseudotuberculosis IP 32953
33% identity, 40% coverage
- Reannotation of Yersinia pestis Strain 91001 Based on Omics Data
Mao, The American journal of tropical medicine and hygiene 2016 - “...PTS permease YP_3532, PTS permease YP_3533, PTS, mannose-/fructose-specific component IIA YP_3534, 2-deoxy-D-gluconate 3-dehydrogenase YP_3535,...”
- High-throughput analysis of Yersinia pseudotuberculosis gene essentiality in optimised in vitro conditions, and implications for the speciation of Yersinia pestis
Willcocks, BMC microbiology 2018 - “...substrates. However, while Y. pseudotuberculosis has an essential PTS gene specific to N-acetylgalactosamine uptake ( yptb3081 ), a glycan particularly associated with intestinal mucosal surfaces [ 62 ], Y. pestis has a glucose-specific PTS component ( ypo2995 ), appropriate for a pathogen adapted to replicating in...”
SPy0631 putative PTS dependent N-acetyl-galactosamine-IIB component from Streptococcus pyogenes M1 GAS
31% identity, 41% coverage
RUMGNA_00962 hypothetical protein from Ruminococcus gnavus ATCC 29149
33% identity, 41% coverage
I6G91_00565 PTS system mannose/fructose/N-acetylgalactosamine-transporter subunit IIB from Fannyhessea vaginae
27% identity, 44% coverage
- A New PNA-FISH Probe Targeting Fannyhessea vaginae
Sousa, Frontiers in cellular and infection microbiology 2021 - “...GAVG_1017, obtained from GenBank: AP012332.1) or F. vaginae (Fw CCTCATGCAAAATGTGATGC; Rv CCAAAACAGAAGCACGGAAT; amplifying the locus I6G91_00565, obtained from GenBank: CP065631.1) were designed with CLC genomics workbench version 21 (QIAGEN). Primer specificity was specifically designed to differentiate these two species in this controlled in vitro study and...”
TC 4.A.6.1.25 / CAQ67974.1 CAQ67974.1 PTS system, mannose-specific IIAB component, component of D-ribitol (D-aldonitol) (a pentitol) PTS Enzyme II complex RtlABCD from Lactobacillus casei BL23
31% identity, 39% coverage
YPO0837 putative PTS permease protein from Yersinia pestis CO92
32% identity, 40% coverage
- Yersinia pestis evolution on a small timescale: comparison of whole genome sequences from North America
Auerbach, PloS one 2007 - “...YES YPO0342 T/G H/Q - 471,201 non-synonymous NO YPO0449 C/A C/F - 917,155 non-synonymous YES YPO0837 A/G S/G - 1,939,841 non-synonymous YES YPO1701 A/G L/P - 2,273,616 non-synonymous YES YPO2000 G/C T/R - 2,278,317 non-synonymous YES YPO2005 A/G V/A m 2,300,659 non-synonymous YES YPO2029 T/G D/A...”
PFREUD_10820 PTS sugar transporter subunit IIA from Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
32% identity, 41% coverage
ETAE_2532 PTS system, N-acetylgalactosamine-specific IIA from Edwardsiella tarda EIB202
35% identity, 37% coverage
- Coordinate regulation of carbohydrate metabolism and virulence by PtsH in pathogen Edwardsiella piscicida
Mao, Applied microbiology and biotechnology 2022 - “...enzyme IIC subunit EIID Man ETAE_1557 manZ Mannose-specific PTS system enzyme IID N-Acetylgalactosamine EIIA GalNAc ETAE_2532 agaF N-Acetylgalactosamine-specific PTS system enzyme IIA EIIB GalNAc ETAE_0679 agaV N-Acetylgalactosamine-specific PTS system enzyme IIB EIIC GalNAc ETAE_2534 agaW N-Acetylgalactosamine-specific PTS system enzyme IIC EIID GalNAc ETAE_2533 agaE N-Acetylgalactosamine-specific PTS...”
SG2427 putative PTS system IIA component from Sodalis glossinidius str. 'morsitans'
32% identity, 37% coverage
Q8Y5Q4 Lmo2002 protein from Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
lmo2002 similar to PTS mannose-specific enzyme IIB component from Listeria monocytogenes EGD-e
LM6179_2771 PTS sugar transporter subunit IIB from Listeria monocytogenes 6179
27% identity, 46% coverage
- Proteomic Analysis of Listeria monocytogenes FBUNT During Biofilm Formation at 10°C in Response to Lactocin AL705
Melian, Frontiers in microbiology 2021 - “...lmo0784 Q8Y8V8 PTS mannose transporter subunit IID lmo2000 Q8Y5Q6 PTS mannose transporter subunit IIB lmo2002 Q8Y5Q4 Ferrichrome-binding protein lmo1959 Q8Y5U6 Heavy metal-transporting ATPase lmo1853 Q8Y647 Vitamin metabolism Demethylmenaquinone methyltransferase lmo1931/ubiE P67055 Dihydropteroate synthase lmo0224/sul Q8YAC2 1,4-dihydroxy-2-naphthoate octaprenyltransferase mo1677/menA Q8Y6K7 Precorrin-3 methylase lmo1197/cbiF Q8Y7S4 Uncharacterized Hypothetical protein...”
- Signals behind Listeria monocytogenes virulence mechanisms
Meireles, Gut microbes 2024 - “...stress, inhibiting the transcription of the lmo1997-lmo2004 operon, that encodes a phosphoenolpyruvate-carbohydrate phosphotransferase system, being lmo2002 the most critical gene to resist to oxidative stress. 175 Additionally, Lm is able to use inorganic sulfur thiosulfate and H 2 S as L-cysteine sources, supporting its growth and...”
- Listeria monocytogenes GshF contributes to oxidative stress tolerance via regulation of the phosphoenolpyruvate-carbohydrate phosphotransferase system
Chen, Microbiology spectrum 2023 - “...were upregulated in response to these stress conditions. Notably, the deletion of iiB man ( lmo2002 ) enhanced oxidative stress tolerance to copper ions, whereas overexpression of iiB man reduced this resistance. In conclusion, our study provides the first evidence that L. monocytogenes GshF plays a...”
- “...suppress the transcription of phosphoenolpyruvate-carbohydrate phosphotransferase system genes lmo1997-lmo2004 , among which iiB man ( lmo2002 ) was identified as the most critical gene for resisting oxidative stress. These findings enhance our understanding of how L. monocytogenes adapts to its environment and provide valuable insights for...”
- DegU-mediated suppression of carbohydrate uptake in Listeria monocytogenes increases adaptation to oxidative stress
Chen, Applied and environmental microbiology 2023 (secret) - New Insights into the Lactic Acid Resistance Determinants of Listeria monocytogenes Based on Transposon Sequencing and Transcriptome Sequencing Analyses
Liu, Microbiology spectrum 2023 - “...mannose transporter subunit IID 0.0514 9.43E-34 lmo2001 lmo2001 PTS mannose transporter subunit IIC 0.0472 1.58E-40 lmo2002 lmo2002 PTS mannose transporter subunit IIB 0.1204 1.07E-17 lmo2096 lmo2096 PTS galacticol transporter subunit IIC 0.1197 4.27E-09 lmo2098 lmo2098 PTS galacticol transporter subunit IIA 0.1191 1.33E-03 lmo2135 lmo2135 PTS fructose...”
- YjbH mediates the oxidative stress response and infection by regulating SpxA1 and the phosphoenolpyruvate-carbohydrate phosphotransferase system (PTS) in Listeria monocytogenes
Cheng, Gut microbes 2021 - “...Yes lmo2650 PTS L-ascorbate-specific enzyme IIB 4.02 Yes lmo1255 PTS trehalose-specific enzyme IIBC 2.93 Yes lmo2002 PTS mannose-specific enzyme IIB 2.72 Yes lmo0027 PTS beta-glucosides specific enzyme IIABC 2.55 Yes lmo0022 PTS fructose-specific enzyme IIB 2.24 Yes lmo2685 PTS cellbiose-specific enzyme IIB 2.16 Yes lmo2683 PTS...”
- Proteomic Analysis of Listeria monocytogenes FBUNT During Biofilm Formation at 10°C in Response to Lactocin AL705
Melian, Frontiers in microbiology 2021 - “...IIB lmo0784 Q8Y8V8 PTS mannose transporter subunit IID lmo2000 Q8Y5Q6 PTS mannose transporter subunit IIB lmo2002 Q8Y5Q4 Ferrichrome-binding protein lmo1959 Q8Y5U6 Heavy metal-transporting ATPase lmo1853 Q8Y647 Vitamin metabolism Demethylmenaquinone methyltransferase lmo1931/ubiE P67055 Dihydropteroate synthase lmo0224/sul Q8YAC2 1,4-dihydroxy-2-naphthoate octaprenyltransferase mo1677/menA Q8Y6K7 Precorrin-3 methylase lmo1197/cbiF Q8Y7S4 Uncharacterized Hypothetical...”
- Virulence gene repression promotes Listeria monocytogenes systemic infection
Pombinho, Gut microbes 2020 (secret) - Resilience in the Face of Uncertainty: Sigma Factor B Fine-Tunes Gene Expression To Support Homeostasis in Gram-Positive Bacteria
Guldimann, Applied and environmental microbiology 2016 - “...negatively regulates other PTS components, including Lmo1997, Lmo1998, Lmo2002, Lmo0427, Lmo0484, and Lmo2648 (72). A recent study by Wang et al. (73) that used...”
- More
- Transcriptome analysis of Listeria monocytogenes exposed to biocide stress reveals a multi-system response involving cell wall synthesis, sugar uptake, and motility
Casey, Frontiers in microbiology 2014 - “...LM6179_2769 LM6179_2769 PTS system mannose/fructose/sorbose family IID subunit 66.88 LM6179_2770 LM6179_2770 PTS system protein 48.23 LM6179_2771 LM6179_2771 PTS system mannose/fructose/sorbose family IIB subunit 21.06 Glycolysis LM6179_0815 gpmA Phosphoglycerate mutase family protein 29.83 LM6179_2641 pgcA Phosphoglucomutase/phosphomannomutase 5.33 LM6179_2081 glcK Glucose kinase 4.21 LM6179_2321 pyk Pyruvate kinase 3.31...”
SPV1_10229 PTS system fructose subfamily IIA component from Mariprofundus ferrooxydans PV-1
30% identity, 39% coverage
- Mariprofundus ferrooxydans PV-1 the first genome of a marine Fe(II) oxidizing Zetaproteobacterium
Singer, PloS one 2011 - “..., however PV-1 possesses a predicted operon (SPV1_t10271, SPV1_10194, SPV1_10199, SPV1_10204, SPV1_10209, SPV1_10214, SPV1_10219, SPV1_10224, SPV1_10229, SPV1_10234, SPV1_, SPV1_10239) encoding for a phosphoenolypyruvate-dependent sugar phosphotransferase system (PTS), which is the major carbohydrate transport system in bacteria [37] . The PTS enzyme II is a fructose/mannose-specific transporter...”
DW662_04200 PTS sugar transporter subunit IIA from Streptococcus gallolyticus
33% identity, 30% coverage
- Genome-Based Drug Target Identification in Human Pathogen Streptococcus gallolyticus
Qureshi, Frontiers in genetics 2021 - “...shown bonding (dotted lines) with the ligand. Phosphotransferase system (PTS) fructose transporter subunit IIA ( DW662_04200 ) is a protein that is involved in phosphoenolpyruvate-dependent sugar PTS. In bacteria, it is a major carbohydrate transport system. PTS catalyzes the translocation with naturally occurring phenomenon of phosphorylation...”
LMOf6854_2063 PTS system, mannose/fructose/sorbose family, IIB component from Listeria monocytogenes str. 1/2a F6854
27% identity, 46% coverage
SGO_0047 PTS system, IIA component from Streptococcus gordonii str. Challis substr. CH1
32% identity, 32% coverage
spr0063 Phosphotransferase system sugar-specific EII component from Streptococcus pneumoniae R6
SPD_0069 PTS system, IIA component from Streptococcus pneumoniae D39
SPD_RS00350, SP_0064 PTS sugar transporter subunit IIA from Streptococcus pneumoniae TIGR4
31% identity, 32% coverage
- Reactive Oxygen Species Contribute to the Bactericidal Effects of the Fluoroquinolone Moxifloxacin in Streptococcus pneumoniae
Ferrándiz, Antimicrobial agents and chemotherapy 2016 - “...(dagA) spr0524 spr0535c-0532 spr1704c-1703 (amiEF) spr0648 spr0063 spr0875 (pmrA) spr1203 spr1216c-1215 spr1352 (bta) spr1559 spr1817 spr2035 Transport: amino...”
- Environmental and genetic regulation of Streptococcus pneumoniae galactose catabolic pathways
Kareem, Nature communications 2024 - “...genes Gene name Gene number Function GAL+ManNAc+15 versus GAL GAL+ManNAc+30 versus GAL ManNAc versus GAL SPD_0069 PTS system transporter subunit IIA 0.20 0.33 0.56 SPD_0088 ABC transporter permease 0.41 1.65 3.24 SPD_0090 ABC transporter substrate-binding protein 0.27 1.37 4.00 SPD_0262 PTS system, mannose/fructose/sorbose family protein, IID...”
- Pneumococcal galactose catabolism is controlled by multiple regulators acting on pyruvate formate lyase
Al-Bayati, Scientific reports 2017 - “...IIB component 2.6 SPD_0067 PTS system, IIC component 2.4 SPD_0068 PTS system, IID component 2.7 SPD_0069 PTS system, IIA component 1.9 SPD_0094 Hypothetical protein 2.3 SPD_0095 Hypothetical protein 2 SPD_0128 MutT/nudix family protein 2.3 SPD_0145 Hypothetical protein 2 SPD_0148 Ransporter, major facilitator family protein 2.8 SPD_0149...”
- N-acetylgalatosamine-Mediated Regulation of the aga Operon by AgaR in Streptococcus pneumoniae
Afzal, Frontiers in cellular and infection microbiology 2016 - “...3.6 spd_0067 PTS system, IIC component, GadW 3.5 spd_0068 PTS system, IID component, GadE 3.7 spd_0069 PTS system, IIA component, GadF 3.3 spd_0070 Sugar isomerase domain protein, AgaS 6.4 spd_0071 Aldose 1-epimerase, GalM 2.0 spd_0088 ABC transporter, permease protein 5.9 spd_0089 ABC transporter, permease protein 6.4...”
- “...spd_0067 PTS system, IIC component, GadW 5.9 spd_0068 PTS system, IID component, GadE 8.0 25.2 spd_0069 PTS system, IIA component, GadF 8.5 13.5 spd_0070 Sugar isomerase domain protein, AgaS 20.5 5.6 spd_0071 Aldose 1-epimerase, GalM 3.4 21.8 a Gene numbers refer to D39 locus tags ....”
- The Small Molecule DAM Inhibitor, Pyrimidinedione, Disrupts Streptococcus pneumoniae Biofilm Growth In Vitro
Yadav, PloS one 2015 - “...binding -1.4 (0.03) SPD_0315 (cps2A) integral membrane regulatory protein Cps2A DNA replication -2.0 (0.03) Transport SPD_0069 PTS system, IIA component phosphoenolpyruvate-dependent sugar phosphotransferase system -2.6 (0.01) SPD_0076 potassium uptake protein, Trk family protein cation transmembrane transporter activity -1.5 (0.01) SPD_0224 iron(III) ABC transporter, permease protein transport...”
- Host glycan sugar-specific pathways in Streptococcus pneumoniae: galactose as a key sugar in colonisation and infection [corrected]
Paixão, PloS one 2015 - “...SPD_0068 PTS system transporter subunit IID 25.4 SPD_1053 lacA Galactose 6-phosphate isomerase subunit LacA 24.5 SPD_0069 PTS system transporter subunit IIA 23.9 SPD_1052 lacB Galactose 6-phosphate isomerase subunit LacB 21.7 SPD_0071 galM Aldose 1-epimerase 19.4 SPD_1050 lacD Tagatose 1,6-diphosphate aldolase 17.6 SPD_0559 PTS system transporter subunit...”
- SPD_0410 negatively regulates capsule polysaccharide synthesis and virulence in <i>Streptococcus pneumoniae</i> D39
Tao, Frontiers in microbiology 2024 - “...family transporter subunit IID 1.87046 3.00E-06 SPD_RS00345 gadE PTS sugar transporter subunit IIA 1.69409 3.80E-05 SPD_RS00350 gadF PTS sugar transporter subunit IIA 2.01639 9.26E-08 SPD_RS03020 spd_0560 PTS sugar transporter subunit IIB 1.92547 0.001491 SPD_RS03025 spd_0561 PTS galactitol transporter subunit IIC 1.23677 0.000476 Glucose metabolism SPD_RS00330 bgaC...”
- The Effect of Impaired Polyamine Transport on Pneumococcal Transcriptome
Nakamya, Pathogens (Basel, Switzerland) 2021 - “...<0.0001 L-fuculose phosphate aldolase SP_1853 galK 6.1 <0.0001 Galactokinase SP_0066 galM 2.7 <0.0001 Galactose mutarotase SP_0064 SP_0064 3.4 <0.0001 PTS mannose PTS system EIIA SP_0645 SP_0645 8.8 <0.0001 PTS galactose PTS system EIIA SP_0646 SP_0646 9.0 <0.0001 PTS galactose PTS system EIIB SP_2164 SP_2164 3.7 <0.0001...”
SM12261_RS00375 PTS sugar transporter subunit IIA from Streptococcus mitis NCTC 12261
31% identity, 32% coverage
TC 4.A.6.1.18 / B3W757 Phosphotransferase system sugar-specific EII component, component of Uptake porter/group translocator of galacto N-biose (Gal-β-1,3-GalNAc: galactose linked β-1,3 to N-acetylgalactosamine), lacto N-biose (Gal-β-1,3-GlcNAc: galactose linked β-1,3 to N-acetylglucosamine), and D-N-acetylgalactosamine (Bidart et al. 2014). The system is designated the GnbABCD system where GnbA = IIA, GnbB = IIB, GnbC = IIC, and GnbD = IID of the mannose-type PTS Enzyme II complex from Lactobacillus casei (strain BL23)
32% identity, 31% coverage
- substrates: Galacto-N-biose, Lacto-N-biose, N-acetyl galactosamine
tcdb comment: These disaccaride substrates are human milk oligosaccharides and glycoconjugates (Bidart et al. 2014)
SAG1950 PTS system, IIB component from Streptococcus agalactiae 2603V/R
gbs1938 Unknown from Streptococcus agalactiae NEM316
28% identity, 39% coverage
TC 4.A.6.1.14 / Q8DR78 Phosphotransferase system sugar-specific EII component, component of Probable PTS uptake porter (IIA - IID) of disaccharides of gluconate and N-acetyglucosamine derived from degradation of hyaluronate and chondroitin by hyaluronidase (Marion et al. 2012). The cytoplasmic disaccharide may be hydrolyzed by the enzyme Ugl from Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
spr0291 Phosphotransferase system sugar-specific EII component from Streptococcus pneumoniae R6
SPD_0293 PTS system, IIA component from Streptococcus pneumoniae D39
SPV_0293, SP_0321 PTS sugar transporter subunit IIA from Streptococcus pneumoniae TIGR4
37% identity, 38% coverage
- substrates: Gluconate, N-acetyglucosamine
- A genomic approach to understand interactions between Streptococcus pneumoniae and its bacteriophages
Leprohon, BMC genomics 2015 - “...spr1777 RNA polymerase rpoB G827C R276P spr1923 Hypothetical protein G690C G691C Q230H A231P R6-DP1 R spr0291 Phosphotransferase system sugar-specific EII component C-101G spr1130 McrB subunit of McrBC restriction endonuclease T985G d G986C d C329A spr1445 Dipeptidase M24 family G918A M306I spr1453 Major facilitator transporter T-187G a...”
- Multiple mutations and increased RNA expression in tetracycline-resistant Streptococcus pneumoniae as determined by genome-wide DNA and mRNA sequencing
Lupien, The Journal of antimicrobial chemotherapy 2015 - “...4h 5 30S ribosomal protein S10 1i 2j 3k 4 spr0219 spr0291 G178T G178T G178T G178T C157T D60Y D60Y D60Y D60Y R53C D175- 180 phosphoglycerate mutase WT WT WT WT...”
- Hyaluronic acid derived from other streptococci supports Streptococcus pneumoniae in vitro biofilm formation
Yadav, BioMed research international 2013 - “...size in base pair hysA spr0286 TGTCGTTCGAACAGTCAGGG 120bp TTGTTGATGGCACGAGGTGT ugl spr0292 ATCACCATGATCTCGGCTTC 97bp GCAGCTTTCAAGGTTGCTTC PTS-EIIA spr0291 TCTCGGGTTTGAACTTAGCCA 96bp GGGCCGCCACTACTGATTTA nanA spr1536 CCAATGCTTCAAATGGTCAG 120bp TATAGAATGCTGGGGCCTTG nanB spr1531 ATTGGCTCACTCCACGTTTT 94bp ATGCACGTTATGGTGGGACT bgaA spr0565 CAAGCCAGCCGTGAACGCTATAAGG 128bp GAGTGGGCAGTCAGGGTGAATTTCC strH spr0057 GGTTTTTCCGTTGGCAGTAA 121bp GCTCAAACGCATCGTAGACA lytA spr1754 CGTCCCAGGCACCATTATCA 95bp CTGGCGGAAAGACCCAGAAT comA spr0043...”
- Genomic characterization of ciprofloxacin resistance in a laboratory-derived mutant and a clinical isolate of Streptococcus pneumoniae
Lupien, Antimicrobial agents and chemotherapy 2013 - “...Gene function spr0084 spr0085 spr0086 spr0129 spr0291 spr0309 spr0310 spr0335 Conserved hypothetical protein Hypothetical protein Hypothetical protein...”
- Streptococcus pneumoniae can utilize multiple sources of hyaluronic acid for growth
Marion, Infection and immunity 2012 - “...of a mannose family PTS transporter of unknown specificity (spr0291 and spr0293 to spr0295) (Fig. 3D). The PTS is the major mechanism of carbohydrate transport...”
- RegR, a global LacI/GalR family regulator, modulates virulence and competence in Streptococcus pneumoniae
Chapuy-Regaud, Infection and immunity 2003 - “...SPN8195 to -8198 for the kdg operon; SP0321 to -0325, spr0291 to -0295, and SPN8201 to -8203 for the pts operon; and SP0326 and -0327, spr0296 and -0297, and...”
- Hemoglobin Induces Early and Robust Biofilm Development in Streptococcus pneumoniae by a Pathway That Involves comC but Not the Cognate comDE Two-Component System
Akhter, Infection and immunity 2021 (secret) - Pneumococcal 6-Phospho-β-Glucosidase (BglA3) Is Involved in Virulence and Nutrient Metabolism
Terra, Infection and immunity 2016 - “...by other loci, such as celBCD as well as SPD_0293 and SPD_0295-7 loci, which are implicated in cellobiose and hyaluronic acid transport, respectively (3, 14,...”
- Integrated Translatomics with Proteomics to Identify Novel Iron-Transporting Proteins in Streptococcus pneumoniae
Yang, Frontiers in microbiology 2016 - “...gi|116516955 SPD_0262 PTS system, mannose/fructose/sorbose family protein, IID component 1.52 0.035 5 0.000 126 gi|116515558 SPD_0293 PTS system, IIA component 1.8 0.000 86.51 0.000 144 gi|116516148 SPD_0560 PTS system, IIB component, putative 7.05 0.023 21.12 0.000 269 gi|116517184 SPD_0561 PTS system, IIC component, putative 2.84 0.030...”
- Host glycan sugar-specific pathways in Streptococcus pneumoniae: galactose as a key sugar in colonisation and infection [corrected]
Paixão, PloS one 2015 - “...transporter subunit IIB 7.8 SPD_0287 Hyaluronate lyase 7.7 SPD_1495 Sugar ABC transporter sugar-binding protein 6.7 SPD_0293 PTS system transporter subunit IIA 6.5 SPD_1834 Bifunctional acetaldehyde-CoA/alcohol dehydrogenase 5.8 SPD_0292 Gluconate 5-dehydrogenase 5.3 SPD_1409 Sugar ABC transporter ATP-binding protein 4.8 SPD_1934 malX Maltose/maltodextrin ABC transporter maltose/maltodextrin-binding protein 4.8...”
- The Effect of Impaired Polyamine Transport on Pneumococcal Transcriptome
Nakamya, Pathogens (Basel, Switzerland) 2021 - “...hydrolase SP_1415 nagB 3.2 <0.0001 Glucosamine 6-phosphate deaminase SP_2056 nagA 2.3 <0.0001 N-acetylglucosamine 6-phosphate deacetylase SP_0321 SP_0321 2.3 <0.0001 PTS N-acetylgalactosamine transporter subunit IIA SP_0323 SP_0323 2.6 <0.0001 PTS N-acetylgalactosamine PTS system EIIB SP_1277 pyrB 2.4 <0.0001 Aspartate carbamoyltransferase SP_1014 dapA 4.3 <0.0001 4-hydroxy-tetrahydrodipicolinate synthase SP_1013...”
- Polyamine Synthesis Effects Capsule Expression by Reduction of Precursors in Streptococcus pneumoniae
Ayoola, Frontiers in microbiology 2019 - “...4.1 fucA SP_2166 L -Fuculose phosphate aldolase 3.7 SP_2168 SP_2168 Putative fucose operon repressor 1.9 SP_0321 SP_0321 PTS system, IIA component 2.4 SP_0323 SP_0323 PTS system, IIB component 3.7 SP_0324 SP_0324 PTS system, IIC component 3.7 SP_0325 SP_0325 PTS system, IID component 3.5 glgB SP_1121 1,4-Alpha-glucan...”
- Multi-omic profiling to assess the effect of iron starvation in Streptococcus pneumoniae TIGR4
Jiménez-Munguía, PeerJ 2018 - “...SP_0152 2/3 Downregulated 38498 SP_0164, SP_0165 2/2 Downregulated 38510 SP_0220, SP_0221, SP_0222 3/14 Downregulated 38529 SP_0321, SP_0322, SP_0323, SP_0324, SP_0325, SP_0326 6/6 Downregulated 38533 SP_0352, SP_0354 2/9 Downregulated 38546 SP_0412, SP_0413 2/2 Downregulated 38547 SP_0416, SP_0417 2/2 Downregulated 38533 SP_0352, SP_0354 2/9 Downregulated 38546 SP_0412, SP_0413...”
- High-resolution analysis of the pneumococcal transcriptome under a wide range of infection-relevant conditions
Aprianto, Nucleic acids research 2018 - “...carbohydrate import, including transporters of galactosamine ( gadVWEF ), cellobiose (SPV_0232-4, celBCD ), hyaluronate-derived oligosaccharides (SPV_0293, SPV_0295-7), galactose (SPV_0559-61), ascorbic acid ( ulaABC ) and mannose (SPV_1989-92). Out of the 48 genes, 31 genes are preceded by a catabolite control protein A (CcpA)-binding site, which suggests...”
- The biofilm inhibitor Carolacton inhibits planktonic growth of virulent pneumococci via a conserved target
Donner, Scientific reports 2016 - “...sp_0323 PTS system transporter subunit IIB 4.80 2.75E-95 sp_0326 preprotein translocase subunit yajC 4.55 5.11E-74 sp_0321 PTS system transporter subunit IIA 4.96 6.23E-89 Carbon metabolism/Pentose phosphate pathway sp_0318 carbohydrate kinase 4.13 1.30E-67 sp_0320 gluconate 5-dehydrogenase 4.08 1.82E-78 sp_0317 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxyphosphogluconate aldolase 3.82 6.60E-64 sp_0319 hypothetical protein...”
- Genome-wide identification of Streptococcus pneumoniae genes essential for bacterial replication during experimental meningitis
Molzen, Infection and immunity 2011 - “...hypothetical protein 0.8ns 2.3 0.2 Transport and binding SP_0321 SP_1715 SP_1887 SP_2037 amiF a ns , not significant; NA, not available. genes, respectively...”
ID870_00190 PTS system mannose/fructose/N-acetylgalactosamine-transporter subunit IIB from Streptococcus agalactiae CJB111
SAK_1910 PTS system, IIB component, mannose/fructose/sorbose family from Streptococcus agalactiae A909
28% identity, 39% coverage
Teth514_0132 PTS system fructose subfamily IIA component from Thermoanaerobacter ethanolicus X514
35% identity, 40% coverage
SPy1058 putative phosphotransferase system (PTS), enzyme II component B from Streptococcus pyogenes M1 GAS
Spy49_0834 PTS system, IIB component from Streptococcus pyogenes NZ131
32% identity, 31% coverage
SPD_1992 PTS system, IIA component from Streptococcus pneumoniae D39
34% identity, 35% coverage
- Deletion of the Zinc Transporter Lipoprotein AdcAII Causes Hyperencapsulation of Streptococcus pneumoniae Associated with Distinct Alleles of the Type I Restriction-Modification System
Durmort, mBio 2020 - “...PTS system, IIC component 1.94 1.74 1.60 SPD_1991 PTS system, IIB component 1.83 1.45 1.52 SPD_1992 PTS system, IIA component 2.03 1.79 1.68 SPD_1993 fucU Fucose operon FucU protein 2.33 2.10 1.83 SPD_1994 fucA l -Fuculose phosphate aldolase 2.17 2.33 1.63 SPD_1995 fcsK l -Fuculose kinase...”
- Transcriptional and metabolic effects of glucose on Streptococcus pneumoniae sugar metabolism
Paixão, Frontiers in microbiology 2015 - “...enzyme IIC 0.51 SPD_1989 PTS system, IID component 0.63 SPD_1991 PTS system, IIB component 0.78 SPD_1992 PTS system, IIA component 0.76 a Subtable of Tables S2 S4 . b Values of ln-ratio. Positive values indicate upregulation and negative values indicate downregulation . c As reviewed by...”
- A random six-phase switch regulates pneumococcal virulence via global epigenetic changes
Manso, Nature communications 2014 - “...psaA Manganese, substrate-binding lipoprotein 2.6 2.9 2.7 SPD_1535 scrR Sucrose operon repressor 2.2 2.1 2.4 SPD_1992 PTS system, IIA component 2.7 2.6 2.4 SPD_1993 fucU L -fuculose transport protein 2.2 2.6 2.2 SPD_1994 fucA L -fuculose phosphate aldolase 2.2 2.5 2.0 SPD_1995 fucK L -fuculose kinase...”
Y801_STRP6 / Q5XCC7 Probable phosphotransferase enzyme IIB component M6_Spy0801; PTS system EIIB component; EC 2.7.1.- from Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
31% identity, 31% coverage
- function: The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active -transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane.
TC 4.A.6.1.9 / Q97N91 PTS system, IIA component, component of The fucose PTS uptake transporter, IIA/IIB/IIC/IIDFuc (FcsABCD) (Manzoor et al. 2015). Expression in response to fucose is under the control of the FcsR transcriptional activator, and its DNA binding site has been identified from Streptococcus pneumoniae (see paper)
SP_2164 PTS sugar transporter subunit IIA from Streptococcus pneumoniae TIGR4
34% identity, 35% coverage
MXAN_6534 PTS system, mannose/fructose/sorbose family, IIB component from Myxococcus xanthus DK 1622
25% identity, 48% coverage
BFP66_RS02225 PTS sugar transporter subunit IIA from Streptococcus suis
31% identity, 32% coverage
- The cadDX operon contributes to cadmium resistance, oxidative stress resistance, and virulence in zoonotic streptococci
Zhu, Veterinary research 2024 - “...to the PTS transporter system (encoded by BFP66_RS02205 , BFP66_RS02210 , BFP66_RS02215 , BFP66_RS02220 , BFP66_RS02225 , and BFP66_RS02230 ) were upregulated in cadDX . The genes associated with fatty acid biosynthesis (encoded by BFP66_RS08345 , BFP66_RS08350 , and BFP66_RS08355 ) were downregulated. We also found...”
RUMGNA_00960 hypothetical protein from Ruminococcus gnavus ATCC 29149
29% identity, 39% coverage
SG2426 putative PTS system IIB component from Sodalis glossinidius str. 'morsitans'
25% identity, 42% coverage
EF3046 PTS system, IIA component from Enterococcus faecalis V583
26% identity, 38% coverage
- Tracing the Enterococci from Paleozoic Origins to the Hospital
Lebreton, Cell 2017 - “...insertions), EF2562 (2 distinct insertions), EF2570 (2 distinct insertions), EF2578, EF2579 (two distinct insertions), EF2582, EF3046 and EF3277. The genomes of mutants EF2559 and , with centrally located insertions, were re-sequenced to confirm that transposon insertion was the only genetic difference with the WT strain prior...”
HMPREF9171_0332 PTS sugar transporter subunit IIA from Streptococcus agalactiae ATCC 13813
30% identity, 43% coverage
gbs1890 Unknown from Streptococcus agalactiae NEM316
SAG1902 PTS system, IIA component from Streptococcus agalactiae 2603V/R
29% identity, 43% coverage
- Streptococcal phosphotransferase system imports unsaturated hyaluronan disaccharide derived from host extracellular matrices
Oiki, PloS one 2019 - “...disaccharide; HA) was also constructed in E . coli for X-ray crystallography. To clone the gbs1890 gene encoding EIIA HA , PCR was performed using primers specific for EIIA HA ( Table 1 , gbs1890_F and gbs1890_R) as described above. The gene fragment was ligated into...”
- Adaptive response of neonatal sepsis-derived Group B Streptococcus to bilirubin
Hansen, Scientific reports 2018 - “...IID 1.87 1.06E-06 5.81E-04 SAG0547 Hypothetical protein 1.32 1.22E-06 5.81E-04 SAG0118 Ribokinase 1.12 2.96E-05 1.13E-02 SAG1902 PTS system transporter subunit IIA 1.34 4.07E-05 1.29E-02 SAG1899 PTS system transporter subunit IIC 1.83 5.82E-05 1.59E-02 SAG0169 Formate acetyltransferase 1.32 1.26E-04 2.46E-02 SAG1350 Surface antigen-like protein 2.02 1.28E-04 2.46E-02...”
- Genetic islands of Streptococcus agalactiae strains NEM316 and 2603VR and their presence in other Group B streptococcal strains
Herbert, BMC microbiology 2005 - “...sag0649, sag1333, sag1404, sag1407-8, sag1462 and sag2063 clp proteases sag1294 and sag1585 Transporters sag1517, sag1998-90, sag1902 and sag1934 Regulators sag0048, sag0124, sag0169, sag 0637, sag0644, sag1128, sag1332, sag1359, sag1409 ( rogB ), sag1463 (encoding a RALP) , sag1791, and sag1956-7 ( rgf ) Encoding other proteins...”
SSU05_0453 Phosphotransferase system, mannose/fructose-specific component IIA from Streptococcus suis 05ZYH33
30% identity, 32% coverage
PTRA_LACCA / Q9RGG5 PTS system sorbose-specific EIIA component; EIIA-Sor; Sorbose-specific phosphotransferase enzyme IIA component from Lacticaseibacillus casei (Lactobacillus casei) (see paper)
Q9RGG5 protein-Npi-phosphohistidine-L-sorbose phosphotransferase (subunit 4/4) (EC 2.7.1.206) from Lacticaseibacillus casei (see paper)
29% identity, 40% coverage
- function: The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitant with their translocation across the cell membrane. The enzyme II SorABCD PTS system is involved in L-sorbose transport.
LJ1655 phosphoenolpyruvate-dependent sugar phosphotransferase system EIIB, probable mannose specific from Lactobacillus johnsonii NCC 533
29% identity, 44% coverage
UC7_RS14510 PTS sugar transporter subunit IIA from Enterococcus caccae ATCC BAA-1240
30% identity, 38% coverage
BAB1_2096 PTS system fructose subfamily IIA component from Brucella melitensis biovar Abortus 2308
BAW_12010 PTS sugar transporter subunit IIA from Brucella abortus
36% identity, 30% coverage
- The regulon of Brucella abortus two-component system BvrR/BvrS reveals the coordination of metabolic pathways required for intracellular life
Rivas-Solano, PloS one 2022 - “...45 ] BAW_12009, BAB1_2095 Predicted protein with unknown function [ 24 ] BAW_12010, ptsM , BAB1_2096 PTS system fructose subfamily transporter subunit IIA [ 21 , 24 ] ptsO NPr phosphocarrier protein:histidine phosphorylation site in HPr protein. Participates in B . melitensis PTS [ 21 ,...”
- “...Glyceraldehyde 3-phosphate dehydrogenase 2 BAW_11665 BAB1_1742 pgk Phosphoglycerate kinase: G-protein beta WD-40 repeat 1 BAW_12010 BAB1_2096 ND PTS system fructose subfamily transporter subunit IIA * 2 BAW_10366 BAB1_0382 ND Cysteine desulfurase 1 BAW_20108 BAB2_0109 gnd 6-phosphogluconate dehydrogenase, catalyzes the formation of D-ribulose 5-phosphate form 6-phospho-D-gluconate *...”
- Proteomics-based confirmation of protein expression and correction of annotation errors in the Brucella abortus genome
Lamontagne, BMC genomics 2010 - “...HslV BAB2_0988 ArgB BAB1_0787 GlyA BAB1_1280 Unknown BAB1_2087 HisE BAB2_0990 Unknown BAB1_0789 RibD BAB1_1286 GloA BAB1_2096 PTS system IIA BAB2_0991 DapD BAB1_0790 RibE BAB1_1294 Aminotransferase subunit BAB2_0993 DapE BAB1_0813 CysD BAB1_1297 Unknown BAB1_2109 AccD BAB2_1009 MgsA BAB1_0817 Unknown; conserved BAB1_1376 UreA BAB1_2133 Unknown BAB2_1012 DapB BAB1_0826...”
- The regulon of Brucella abortus two-component system BvrR/BvrS reveals the coordination of metabolic pathways required for intracellular life
Rivas-Solano, PloS one 2022 - “...[ 21 , 45 ] BAW_12009, BAB1_2095 Predicted protein with unknown function [ 24 ] BAW_12010, ptsM , BAB1_2096 PTS system fructose subfamily transporter subunit IIA [ 21 , 24 ] ptsO NPr phosphocarrier protein:histidine phosphorylation site in HPr protein. Participates in B . melitensis PTS...”
- “...gap Glyceraldehyde 3-phosphate dehydrogenase 2 BAW_11665 BAB1_1742 pgk Phosphoglycerate kinase: G-protein beta WD-40 repeat 1 BAW_12010 BAB1_2096 ND PTS system fructose subfamily transporter subunit IIA * 2 BAW_10366 BAB1_0382 ND Cysteine desulfurase 1 BAW_20108 BAB2_0109 gnd 6-phosphogluconate dehydrogenase, catalyzes the formation of D-ribulose 5-phosphate form 6-phospho-D-gluconate...”
MMSR116_RS15270 PTS sugar transporter subunit IIA from Methylobacterium mesophilicum SR1.6/6
30% identity, 38% coverage
EF1801 PTS system, IIA component from Enterococcus faecalis V583
29% identity, 31% coverage
Atu0031 PTS system, IIA component from Agrobacterium tumefaciens str. C58 (Cereon)
31% identity, 38% coverage
DVU1632 PTS system, IIA component from Desulfovibrio vulgaris Hildenborough
31% identity, 39% coverage
- Large-scale genetic characterization of the model sulfate-reducing bacterium, Desulfovibrio vulgaris Hildenborough
Trotter, Frontiers in microbiology 2023 - “...y -axis is random. (D) Comparison of fitness values for DVU0829 ( x -axis) and DVU1632 ( y -axis) across all 757 experiments. In panels B and D, lines show x =0, y =0, and x = y . Among the 19 genes uniquely essential in...”
- “...Price et al., 2018 ). For example, the phosphotransferase system (PTS) proteins PtsI (DVU0829) and DVU1632 (a putative EII-A enzyme) are highly cofit ( r =0.89), with both genes sharing fitness defects in a number of experiments with alternative nitrogen sources ( Figure 1D ). In...”
RL0033 PTS system, mannose-specific IIAB component (EIIAB-Man) (Mannose-permease IIAB component) (Phosphotransferase enzyme II, AB component) (EIII-Man). from Rhizobium leguminosarum bv. viciae 3841
31% identity, 38% coverage
blr8147 PTS system IIA component from Bradyrhizobium japonicum USDA 110
29% identity, 38% coverage
Entcl_4033 PTS sugar transporter subunit IIB from [Enterobacter] lignolyticus SCF1
29% identity, 41% coverage
- Multi-time series RNA-seq analysis of Enterobacter lignolyticus SCF1 during growth in lignin-amended medium
Orellana, PloS one 2017 - “...degradation of cellobiose (Entcl_2546 and Entcl_3764), chitobiose (Entcl_2547 and Entcl_2548), maltose (Entcl_3261) and mannose (Entcl_4032, Entcl_4033, Entcl_4034 and Entcl_4036). Furthermore, many genes involved in the uptake of other sugars beside glucose were up-regulated after glucose uptake was stopped ( Fig 2C ) (Entcl_0166, Entcl_0167, Entcl_1205, Entcl_1207,...”
TC 4.A.6.1.8 / Q82ZC7 PTS system, IIB component, component of The gluconate PTS uptake system. IIAGnt and IIBGnt form a high affinity 2:2 heterotetrameric complex from Enterococcus faecalis (see paper)
EF3137 PTS system, IIB component from Enterococcus faecalis V583
26% identity, 50% coverage
Pcar_1934 phosphotransferase system, mannose/fructose-specific component IIA from Pelobacter carbinolicus str. DSM 2380
29% identity, 38% coverage
ECs5002 sorbose-permease PTS system IIA component from Escherichia coli O157:H7 str. Sakai
Z5617 putative sorbose PTS component from Escherichia coli O157:H7 EDL933
33% identity, 34% coverage
- Genetic diversity among Escherichia coli O157:H7 isolates and identification of genes linked to human infections
Wu, Infection and immunity 2008 - “...Z5615, Z5616, Z5617, ECS4941, ECS4999, ECs5000, ECs5001, and ECs5002) genes, as well as genes for several transporters, including a putative iron and...”
- Genetic diversity among Escherichia coli O157:H7 isolates and identification of genes linked to human infections
Wu, Infection and immunity 2008 - “...and Z5613) and utilization (Z5613, Z5614, Z5615, Z5616, Z5617, ECS4941, ECS4999, ECs5000, ECs5001, and ECs5002) genes, as well as genes for several...”
B9H01_05900, BFP66_RS03575 PTS sugar transporter subunit IIA from Streptococcus suis
27% identity, 38% coverage
- PPNet: Identifying Functional Association Networks by Phylogenetic Profiling of Prokaryotic Genomes
Li, Microbiology spectrum 2023 - “...which included protein-N (PI)/phosphohistidine-sugar phosphotransferase activity (B9H01_05885; B9H01_05880 and B9H01_05890), kinase activity (B9H01_05910; B9H01_05890 and B9H01_05900), lyase activity (B9H01_05850; B9H01_05870), and d -glucosamine phosphotransferase system (PTS) permease activity (B9H01_05885; B9H01_05880). The function of the other genes of this module included gluconate 5-dehydrogenase, M13 family metallopeptidase, muramidase-released...”
- A novel aquaporin Aagp contributes to Streptococcus suis H2O2 efflux and virulence
Zhu, Virulence 2023 - “...IIB; BFP66_RS02215 1.90 PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC; BFP66_RS02695 6.00 PTS glucose transporter subunit IIBC; BFP66_RS03575 14.07 PTS N-acetylgalactosamine transporter subunit IIA; BFP66_RS04315 3.47 PTS lactose/cellobiose transporter subunit IIA; BFP66_RS04320 3.65 PTS lactose transporter subunits IICB; BFP66_RS08510 10.66 PTS cellobiose transporter subunit IIC; BFP66_RS08530 53.00 PTS...”
H16_A0324 phosphotransferase system, fructose-specific component IIA from Ralstonia eutropha H16
30% identity, 33% coverage
NMCC_0140 PTS system, IIAB component from Neisseria meningitidis 053442
30% identity, 41% coverage
- Evolution of Sequence Type 4821 Clonal Complex Meningococcal Strains in China from Prequinolone to Quinolone Era, 1972-2013
Guo, Emerging infectious diseases 2018 - “...Putative RmuC-like protein NMCC_0137 Putative metallo-dependent hydrolase NMCC_0138 Putative periplasmic DNA ligase (polydeoxyribonucleotide synthase [ATP]) NMCC_0140 ptsIIA Phosphotransferase system, enzyme IIA (protein IIA) NMCC_0141 ptsH Phosphocarrier protein HPr (phosphotransferase system, histidine-containing protein) NMCC_0142 ptsI Phosphoenolpyruvate-protein phosphotransferase (phosphotransferase system, enzyme I; protein I) NMCC_0158 porB Major outer-membrane...”
c4985 Putative sorbose PTS component from Escherichia coli CFT073
32% identity, 34% coverage
NGO2036 putative sugar transport PTS system IIA protein from Neisseria gonorrhoeae FA 1090
29% identity, 41% coverage
- Dinner date: Neisseria gonorrhoeae central carbon metabolism and pathogenesis
Potter, Emerging topics in life sciences 2024 - “...Histidine-Containing Phosphocarrier (HPr) NGO2037 NEIS2025 ptsI PTS Enzyme I NGO2038 NEIS2024 ptsL PTS Enzyme IIA NGO2036 NEIS2026 pyk Pyruvate Kinase NGO1881 NEIS0074 sdhBADC Succinate Dehydrogenase NGO0920-0923 NEIS0928- NEIS0925 Table 2. Glossary of Abbreviations used in this review Abbreviation Description Acetyl-CoA Acetyl-Coenzyme A AHU phenotype Arginine, Hypoxanthine,...”
EF_2271 PTS sugar transporter subunit IIB from Enterococcus faecalis V583
23% identity, 40% coverage
Dde_1775 PTS system fructose subfamily IIA component from Desulfovibrio desulfuricans G20
29% identity, 38% coverage
GALLO_0118 Putative PTS system, mannose-specific IIB component from Streptococcus gallolyticus UCN34
26% identity, 44% coverage
SMc02753 PUTATIVE IIA COMPONENT OF PTS SYSTEM PROTEIN from Sinorhizobium meliloti 1021
30% identity, 38% coverage
- Members of the Sinorhizobium meliloti ChvI regulon identified by a DNA binding screen
Bélanger, BMC microbiology 2013 - “...a 176-bp fragment (genomic origin from 48523 to 48699) coding for the region upstream of SMc02753, including its start codon. A single clone contained a 395-bp region spanning the upstream sequence of chvI and past the translational start site (genomic origin from 51887 to 52281). These...”
- HPrK regulates succinate-mediated catabolite repression in the gram-negative symbiont Sinorhizobium meliloti
Pinedo, Journal of bacteriology 2009 - “...protein (SMc02437), HPr (SMc02754), EIIA-type proteins ManX (SMc02753) and EIIANtr (SMc01141), and HPrK (SMc02752) are present in the chromosome....”
- Sinorhizobium meliloti mutants lacking phosphotransferase system enzyme HPr or EIIA are altered in diverse processes, including carbon metabolism, cobalt requirements, and succinoglycan production
Pinedo, Journal of bacteriology 2008 - “...similar to ptsH (coding for HPr in E. coli) and smc02753 (manX) (coding a protein similar to the N-terminal half of E. coli ManX, which contains an EIIAMan PTS...”
- “...was purified and used for further study. A manX (smc02753) in-frame deletion mutant was constructed in a similar manner. The primers used to construct the manX...”
NGK_2200 putative sugar transport PTS system IIA protein from Neisseria gonorrhoeae NCCP11945
29% identity, 41% coverage
SMU_RS08905 PTS system mannose/fructose/N-acetylgalactosamine-transporter subunit IIB from Streptococcus mutans UA159
26% identity, 44% coverage
DQM59_RS01355 PTS system mannose/fructose/N-acetylgalactosamine-transporter subunit IIB from Streptococcus mutans
26% identity, 44% coverage
- Adaptation to simulated microgravity in Streptococcus mutans
Fernander, NPJ microgravity 2022 - “...I(+280/96) DQM59_RS00680 / DQM59_RS00685 0.53 F98V DQM59_RS03205 1.00 I(236/20) acnA / DQM59_RS07205 0.62 C 464493/495 DQM59_RS01355 0.93 P169L DQM59_RS03185 (trkA) 0.18 S191* DQM59_RS07640 (lytS) 0.15 Q229* DQM59_RS07640 (lytS) 0.11 K15N DQM59_RS10195 (sprV) 0.06 F52V DQM59_RS10195 (sprV) 0.60 V81F vicK 0.38 I407F vicK 0.26 A237D vicK 0.20...”
SGO_1892 PTS system, fructose(mannose)-specific IIB from Streptococcus gordonii str. Challis substr. CH1
32% identity, 38% coverage
S3638 putative sorbose-permease PTS system IIA component from Shigella flexneri 2a str. 2457T
33% identity, 34% coverage
HV360_06705 PTS sugar transporter subunit IIA from Tetragenococcus halophilus
29% identity, 39% coverage
CAC1458 PTS system, fructose(mannose)-specific IIB from Clostridium acetobutylicum ATCC 824
26% identity, 44% coverage
- Sugar uptake by the solventogenic clostridia
Mitchell, World journal of microbiology & biotechnology 2016 - “...(Voigt et al. 2014 ). The same study implicated the PTS encoded by cac1457 / cac1458 / cac1459 / cac1460 in mannose transport. In both cases, however, residual uptake of the respective sugars was observed to occur in the mutants. It is therefore apparent that a...”
NMB2046 PTS system, IIAB component from Neisseria meningitidis MC58
29% identity, 41% coverage
TC 4.A.6.1.8 / Q82ZC8 PTS system, IIA component, component of The gluconate PTS uptake system. IIAGnt and IIBGnt form a high affinity 2:2 heterotetrameric complex from Enterococcus faecalis (see paper)
EF3136 PTS system, IIA component from Enterococcus faecalis V583
OG1RF_12399 PTS sugar transporter subunit IIA from Enterococcus faecalis OG1RF
26% identity, 39% coverage
gfrA / A0A0F6BB77 fructoselysine/glucoselysine PTS enzyme IIA component from Salmonella typhimurium (strain 14028s / SGSC 2262) (see paper)
TC 4.A.6.1.19 / V7IHL6 PTS system fructose IIA component, component of PTS uptake system for glucoselysine and fructoselysine, GfrABCD from Salmonella enterica subsp. enterica serovar Cubana str. 76814
SL1344_4466, STM14_5449 PTS sugar transporter subunit IIA from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
STM4535 putative PTS permease from Salmonella typhimurium LT2
25% identity, 32% coverage
- substrates: Fructoselysine, Glucoselysine
tcdb comment: Two glycases, GfrE and GfrF, are requred for the utilization of these two compounds for growth, respectively, and GfrF was shown to hydrolyze fructoselysine-6-P to lysine and fructose-6-P. Expression of the operon, gfrABCDEF, is regulated by a transcriptional activator, GfrR and sigma factor RpoN (Miller et al. 2015). GfrD affects proteolytic processing, a necessary but insufficient step for CadC activation, rendering CadC able to activate target genes involved in lysine metabolism (Lee et al. 2013) - Novel DNA Binding and Regulatory Activities for σ54 (RpoN) in Salmonella enterica Serovar Typhimurium 14028s
Bono, Journal of bacteriology 2017 - “...STM14_5014h STM14_5102 STM14_5108 STM14_5155 STM14_5249 STM14_5449 STM0368f STM0448f STM0462f STM0577f STM0649.Sf STM0665f STM0830f STM1285f STM1303f STM1690f...”
- Modulating Salmonella Typhimurium's Response to a Changing Environment through Bacterial Enhancer-Binding Proteins and the RpoN Regulon
Hartman, Frontiers in molecular biosciences 2016 - “...in at least two animal hosts and RpoN-regulated genes argT, glnA, glnL , and gfrACDEF (SL1344_4466, 44684471) were attenuated in at least two animal hosts (Chaudhuri et al., 2013 ). Table 1 54 -dependent genes and associated bEBPs in S. Typhimurium a . Locus tag b...”
- The Bacterial iprA Gene Is Conserved across Enterobacteriaceae, Is Involved in Oxidative Stress Resistance, and Influences Gene Expression in Salmonella enterica Serovar Typhimurium
Herman, Journal of bacteriology 2016 - “...(Table 2). The PTS transport system (found in genes SL1344_4466 through SL1344_ 4471) is increased in expression in the iprA mutant in log phase (with a single...”
- “...1.0E300 1.0E300 PTS transport system genes SL1344_4466 SL1344_4467 SL1344_4468 SL1344_4469 SL1344_4470 SL1344_4471 PTS transporter PTS transporter PTS...”
- A Mannose Family Phosphotransferase System Permease and Associated Enzymes Are Required for Utilization of Fructoselysine and Glucoselysine in Salmonella enterica Serovar Typhimurium
Miller, Journal of bacteriology 2015 - “...components EIIA, EIIB, EIIC, and EIID; locus numbers STM14_5449 to STM14_5454 in S. Typhimurium 14028s). Genes coding for two predicted deglycases within the...”
- “...here that the predicted gfrABCDEF operon, encoded by STM14_5449 to STM14_5454, is responsible for utilization of both fructoselysine and glucoselysine in S....”
- Probing the ArcA regulon under aerobic/ROS conditions in Salmonella enterica serovar Typhimurium
Morales, BMC genomics 2013 - “...regulator STM4405 STM14_5290 ytfJ 3.2 1.45 2.31 - 67 GTTAATCATATGTGC 3.30E-05 putative transcriptional regulator STM4535 STM14_5449 - 2.7 1.04 2.76 - 98 GTTAACAGAGGGAAA 9.50E-05 putative PTS permease STM4467 STM14_5361 1.83 1.02 2.07 - 271 GTTAATTATTTGTTT 6.50E-06 arginine deiminase STM1130 STM14_1293 nanM 2.58 1.01 2.92 + 115...”
- Use of a promiscuous, constitutively-active bacterial enhancer-binding protein to define the σ⁵⁴ (RpoN) regulon of Salmonella Typhimurium LT2
Samuels, BMC genomics 2013 - “...fdhF 10 + 18.2 4527564 4527547 TGGCATAAAACATGCATA STM4367 yjeB 3.8 + 14.1 4610407 4610424 TGGCAGATATTTTGCTTG STM4535 12 + 18.3 4794881 4794898 TGGCACGCCGCTTGCTCT Sites located within the enriched ORF : STM0131 ftsQ 7.6 + 6.2 153598 153615 TGGAACGCGTCTTGCAGG STM0155 4.1 + 9.5 182767 182784 CGGCATGGCATTTGCCAG STM0322 proA...”
- Probing the ArcA regulon under aerobic/ROS conditions in Salmonella enterica serovar Typhimurium
Morales, BMC genomics 2013 - “...transcriptional regulator STM4405 STM14_5290 ytfJ 3.2 1.45 2.31 - 67 GTTAATCATATGTGC 3.30E-05 putative transcriptional regulator STM4535 STM14_5449 - 2.7 1.04 2.76 - 98 GTTAACAGAGGGAAA 9.50E-05 putative PTS permease STM4467 STM14_5361 1.83 1.02 2.07 - 271 GTTAATTATTTGTTT 6.50E-06 arginine deiminase STM1130 STM14_1293 nanM 2.58 1.01 2.92 +...”
- FNR is a global regulator of virulence and anaerobic metabolism in Salmonella enterica serovar Typhimurium (ATCC 14028s)
Fink, Journal of bacteriology 2007 - “...arginine repressor 0.325 0.181 1.6 2.5 STM4535 STM4535 5-TAAGCCAGCAGGTAGATACG-3 5-CGACATAAAGAGATCGATAACC-3 139 Putative PTS permease 6.053 8.217 2.6 3.0...”
CPE0320 hypothetical protein from Clostridium perfringens str. 13
29% identity, 37% coverage
T643_RS18905 PTS sugar transporter subunit IIA from Klebsiella pneumoniae MRSN 1319
22% identity, 38% coverage
- Multidrug resistant pathogens respond differently to the presence of co-pathogen, commensal, probiotic and host cells
Chan, Scientific reports 2018 - “..._2, T643_RS11485) and 3 upregulated (aminotransferase, T643_RS18930; cimH , T643_RS19470; PTS system fructose IIA component, T643_RS18905) genes were tested. For A . baumannii , 3 downregulated ( papD , T634_RS02055; mmsA _1, T634_RS14320; EamA-like transporter, T634_RS10710) and 4 upregulated ( pilN , T634_RS16475; NAD family protein,...”
KP1_0760 putative PTS permease from Klebsiella pneumoniae NTUH-K2044
22% identity, 38% coverage
LCAZH_0403 PTS system mannose/fructose/N-acetylgalactosamine-transporter subunit IIB from Lacticaseibacillus paracasei
25% identity, 44% coverage
- Roles of adenine methylation in the physiology of Lacticaseibacillus paracasei
Zhao, Nature communications 2023 - “...in the pglX mutant, including fructose/mannose PTS IIA component (LCAZH_0402), PTS sugar transporter subunit IIB (LCAZH_0403), PTS sugar transporter subunit IIC (LCAZH_0404), PTS system mannose/fructose/sorbose family transporter subunit IID (LCAZH_0405), and PTS sugar transporter (LCAZH_0406). In addition, it is interesting to note that there was an...”
ATM98_08065 PTS system mannose/fructose/N-acetylgalactosamine-transporter subunit IIB from Streptococcus sp. A12
50% identity, 13% coverage
- A single system detects and protects the beneficial oral bacterium Streptococcus sp. A12 from a spectrum of antimicrobial peptides
Lee, Molecular microbiology 2021 - “...Another interesting finding was a cluster of genes predicted to encode a mannose PTS (ATM98_08060, ATM98_08065, ATM98_08070, ATM98_08075 and ATM98_08080) was downregulated in the pcfK mutant strain ( Figure 4B ), and a two-component ABC transporter (ATM98_05230 and ATM98_05225) annotated as ABC-type CcmA multidrug resistance system...”
- “...of a cluster of genes annotated as components for a mannose phosphotransferase system (PTS; ATM98_08060, ATM98_08065, ATM98_08070, ATM98_08075 and ATM98_08080). The mannose PTS system in organisms such as L. lactis, Listeria monocytogenes and Enterococcus faecalis can function as a receptor for Class IIa bacteriocins (i.e. non-lantibiotics)...”
S0128 putative PTS enzyme II B component from Shigella flexneri 2a str. 2457T
29% identity, 39% coverage
AgaX / b0129 putative PTS enzyme IIA component YadI from Escherichia coli K-12 substr. MG1655 (see 3 papers)
yadI / P36881 putative PTS enzyme IIA component YadI from Escherichia coli (strain K12) (see 2 papers)
29% identity, 39% coverage
D5AP56 PTS system, IIA component from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
30% identity, 32% coverage
Ethha_0817 PTS system mannose/fructose/N-acetylgalactosamine-transporter subunit IIB from Ethanoligenens harbinense YUAN-3
25% identity, 43% coverage
P7E32_11190, P7F73_07975 PTS sugar transporter subunit IIA from Enterobacter sp. EC-ML559
27% identity, 39% coverage
- Comprehensive Analysis of Virulence Determinants and Genomic Islands of blaNDM-1-Producing Enterobacter hormaechei Clinical Isolates from Greece
Mavroidi, Antibiotics (Basel, Switzerland) 2023 - “...pilN, pilO2, pilP, pilV, pilM Locus 3: pilM, pilN, pilO2, pilP Flagella fliZACDST fliZACDST Fimbriae P7E32_11190, P7E32_11195, P7E32_11200, P7E32_11205, P7E32_11210, P7E32_11215, P7E32_11220, P7E32_11225, P7E32_11230 P7F73_07975, P7F73_07980, P7F73_07985, P7F73_07990, P7F73_07995, P7F73_08000, P7F73_08005, P7F73_08010, P7F73_08015 # Differences among the strains are denoted in bold. ARGs: antimicrobial resistance genes;...”
- “...pilO2, pilP Flagella fliZACDST fliZACDST Fimbriae P7E32_11190, P7E32_11195, P7E32_11200, P7E32_11205, P7E32_11210, P7E32_11215, P7E32_11220, P7E32_11225, P7E32_11230 P7F73_07975, P7F73_07980, P7F73_07985, P7F73_07990, P7F73_07995, P7F73_08000, P7F73_08005, P7F73_08010, P7F73_08015 # Differences among the strains are denoted in bold. ARGs: antimicrobial resistance genes; HMRGs: heavy-metal resistance genes. antibiotics-12-01549-t002_Table 2 Table 2 Identification...”
EF0628 PTS system, IIA component, putative from Enterococcus faecalis V583
28% identity, 38% coverage
- The Intraperitoneal Transcriptome of the Opportunistic Pathogen Enterococcus faecalis in Mice
Muller, PloS one 2015 - “...mobile genetic elements including 7 phages [ 57 ] and a PAI (genes ef0479 to ef0628 in the V583 sequence [ 9 ]). In general, few PAI genes are differently expressed in our infection model. As mentioned before, the enterococcal cytolysin is significantly induced in vivo...”
- Occurrence of putative pathogenicity islands in enterococci from distinct species and of differing origins
Semedo-Lemsaddek, Applied and environmental microbiology 2009 - “...(ef0556) ef0571 ef0590 gls24-like (ef0604) ef0609 ef0617 ef0628 * Corresponding author. Mailing address: Faculdade de Ciencias da Universidade de Lisboa,...”
- “...loci cbh to esp, ef0551 to ef0571, and ef0628. After chi-square analysis of contingency tables, a statistically significant association was found between the...”
- Survey of genomic diversity among Enterococcus faecalis strains by microarray-based comparative genomic hybridization
Aakra, Applied and environmental microbiology 2007 - “...previously (29). It comprises the region from EF0479 to EF0628 in the V583 genome and contains several virulence factors. The PAI is a "mosaic" of several IS...”
- “...to EF0166; phage01, EF0303 to EF0355; PAI, EF0479 to EF0628; phage03, EF1417 to EF1489; efaB5, EF1847 to EF1895; phage04, EF1988 to EF2043; phage05, EF2084 to...”
- Molecular characterization of a widespread, pathogenic, and antibiotic resistance-receptive Enterococcus faecalis lineage and dissemination of its putative pathogenicity island
Nallapareddy, Journal of bacteriology 2005 - “...gls24-like (ef0604) Forward ef0609 Forward Reverse Reverse ef0617 Forward ef0628 Forward Reverse Reverse PAIout 381 576 508 825 955 547 392 548 565 578 562 404...”
- “...proposed an 150-kb region as an E. faecalis PAI (ef0479 to ef0628 of V583) and indicated that there were only subtle differences in this region in two of the E....”
OG1RF_10346 PTS sugar transporter subunit IIA from Enterococcus faecalis OG1RF
27% identity, 38% coverage
PTRA_KLEPN / P37080 PTS system sorbose-specific EIIA component; EIIA-Sor; EIII-F-Sor; Sorbose-specific phosphotransferase enzyme IIA component from Klebsiella pneumoniae (see 2 papers)
TC 4.A.6.1.3 / P37080 PTRA aka SORF, component of Sorbose porter from Klebsiella pneumoniae (see 2 papers)
34% identity, 29% coverage
- function: The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitant with their translocation across the cell membrane. The enzyme II SorABFM PTS system is involved in L-sorbose transport.
- substrates: Sorbose
SSA_0220 PTS system, mannose-specific IIB component, putative from Streptococcus sanguinis SK36
45% identity, 13% coverage
- A Novel Regulator Modulates Glucan Production, Cell Aggregation and Biofilm Formation in Streptococcus sanguinis SK36
Zhu, Frontiers in microbiology 2018 - “...Essential for the Growth of S. sanguinis RNA-seq data revealed that a gene cluster (SSA_0219, SSA_0220, SSA_0221, SSA_0222, and SSA_0224) showed high fold upregulation in brpL (fold change > 110 for all of the five genes) and relative downregulation in ciaR (fold change < 0.25 for...”
- “...confirmed SSA_0222 was over-expressed in brpL ( Figure 9A ). Genome annotation predicts that SSA_0219, SSA_0220, SSA_0221, and SSA_0222 were PTS system mannose-specific transporter subunits, while the function of SSA_0224 was unknown (Supplementary Datasheet 1 ). Since PTS genes are related to the uptake of carbohydrate...”
- Heterologous expression of sahH reveals that biofilm formation is autoinducer-2-independent in Streptococcus sanguinis but is associated with an intact activated methionine cycle
Redanz, The Journal of biological chemistry 2012 - “...3.44 3.19 3.88 4.41 Down-regulated SSA_0068 SSA_0220 adhE/alcohol-acetaldehyde dehydrogenase, putative PTS system, mannose-specific IIB component, putative 3.84...”
EF2980 PTS system, IIA component from Enterococcus faecalis V583
29% identity, 33% coverage
dgaA / A0A0F6B8S8 D-glucosaminate PTS permease components EIIA (EC 2.7.1.203) from Salmonella typhimurium (strain 14028s / SGSC 2262) (see paper)
TC 4.A.6.1.17 / D0ZLR7 Putative phosphotransferase system enzyme IIA, component of D-glucosaminate group translocating uptake porter, DgaABCD (IIA-141 aas, IIB-161 aas, IIC-249 aas, and IID-285 aas, respectively) from Salmonella typhimurium (strain 14028s / SGSC 2262)
STY4013 putative PTS system protein from Salmonella enterica subsp. enterica serovar Typhi str. CT18
STM3772 putative phosphotransferase system enzyme IIA from Salmonella typhimurium LT2
34% identity, 38% coverage
- substrates: D-glucosaminate
tcdb comment: Salmonella enterica subsp. enterica serovar Typhimurium (S. Typhimurium) uses d-glucosaminate (2-amino-2-deoxy-d-gluconic acid) as a carbon and nitrogen source via DgaABCD (d-glucosaminate PTS permease components EIIA, EIIB, EIIC, and EIID). Two other genes in the dga operon (dgaE and dgaF) are required for wild-type growth with d-glucosaminate. Transcription of dgaABCDEF is dependent on RpoN (σ54) and an RpoN-dependent activator gene, dgaR. Introduction of a plasmid bearing dgaABCDEF under the control of the lac promoter into E. coli strains allowed them to grow on minimal medium containing d-glucosaminate. d-Glucosaminate is transported and phosphorylated at the C-6 position by DgaABCD. DgaE converts the resulting d-glucosaminate-6-phosphate to 2-keto-3-deoxygluconate 6-phosphate (KDGP), which is subsequently cleaved by the aldolase DgaF to form glyceraldehyde-3-phosphate and pyruvate. DgaF catalyzes the same reaction as that catalyzed by Eda, a KDGP aldolase in the Entner-Doudoroff pathway, and the two enzymes can substitute for each other in their respective pathways. Orthologs of the dga genes are largely restricted to certain enteric bacteria and a few Firmicutes (Miller et al. 2013) - Identification of core and variable components of the Salmonella enterica subspecies I genome by microarray
Anjum, Infection and immunity 2005 - “...putative fructose and mannose-specific phosphotransferase (PTS) system (STY4013 to STY4016); and a carbamate kinase and arginine deaminase (STY4804-STY4805; see...”
- “...identity with c5349 and c5350, respectively), Enterococcus faecalis (STY4013 to STY4016 have 43 to 63% amino acid identity to EF2980 to EF977, respectively),...”
- Peeling back the many layers of competitive exclusion
Maurer, Frontiers in microbiology 2024 - “...Unknown sugars STM3780-85 ; STM1128 ; STM4535-8 + STM3774-75 ; STM2289-91 ; STM1613 + + STM3772 + Gluconate hex R ; edd + 5-Keto-4-deoxyuronate kduDI + + Idonate idn R TODK crp + + Methyl-galactose mglCAB ; galS crp + + Maltose malZ ; malGF K...”
- Use of a promiscuous, constitutively-active bacterial enhancer-binding protein to define the σ⁵⁴ (RpoN) regulon of Salmonella Typhimurium LT2
Samuels, BMC genomics 2013 - “...rsr 15 + 21.2 3684734 3684717 TGGCACGCTGGTTGCAAT STM3568 rpoH 22 + 18.9 3736836 3736819 TGGCACGGTTGTTGCTCG STM3772 dgaA 3.6 + 20.3 3972484 3972467 TGGCACAACCTTTGCTCT STM_R0167 glmZ 15 + 19.5 4141620 4141637 TGGCACGTTATGTGCAAT STM4007 glnA 4.2 + 19.2 4217110 4217093 TGGCACAGATTTCGCTTT STM4172 zraP 29 + 17.4 4388217 4388234...”
- Transcriptome analysis of genes controlled by luxS/autoinducer-2 in Salmonella enterica serovar Typhimurium
Jesudhasan, Foodborne pathogens and disease 2010 - “...enzyme IIC Putative tagatose 6-phosphate kinase 1 pduO STM3772 STM1669 STM2617 STM1255 dmsA glgB2 hscC STM0293 yfiD ynfK focA yccD STM3142 malM STM3191 glxR...”
For advice on how to use these tools together, see
Interactive tools for functional annotation of bacterial genomes.
The PaperBLAST database links 793,807 different protein sequences to 1,259,118 scientific articles. Searches against EuropePMC were last performed on March 13 2025.
PaperBLAST builds a database of protein sequences that are linked
to scientific articles. These links come from automated text searches
against the articles in EuropePMC
and from manually-curated information from GeneRIF, UniProtKB/Swiss-Prot,
BRENDA,
CAZy (as made available by dbCAN),
BioLiP,
CharProtDB,
MetaCyc,
EcoCyc,
TCDB,
REBASE,
the Fitness Browser,
and a subset of the European Nucleotide Archive with the /experiment tag.
Given this database and a protein sequence query,
PaperBLAST uses protein-protein BLAST
to find similar sequences with E < 0.001.
To build the database, we query EuropePMC with locus tags, with RefSeq protein
identifiers, and with UniProt
accessions. We obtain the locus tags from RefSeq or from MicrobesOnline. We use
queries of the form "locus_tag AND genus_name" to try to ensure that
the paper is actually discussing that gene. Because EuropePMC indexes
most recent biomedical papers, even if they are not open access, some
of the links may be to papers that you cannot read or that our
computers cannot read. We query each of these identifiers that
appears in the open access part of EuropePMC, as well as every locus
tag that appears in the 500 most-referenced genomes, so that a gene
may appear in the PaperBLAST results even though none of the papers
that mention it are open access. We also incorporate text-mined links
from EuropePMC that link open access articles to UniProt or RefSeq
identifiers. (This yields some additional links because EuropePMC
uses different heuristics for their text mining than we do.)
For every article that mentions a locus tag, a RefSeq protein
identifier, or a UniProt accession, we try to select one or two
snippets of text that refer to the protein. If we cannot get access to
the full text, we try to select a snippet from the abstract, but
unfortunately, unique identifiers such as locus tags are rarely
provided in abstracts.
PaperBLAST also incorporates manually-curated protein functions:
- Proteins from NCBI's RefSeq are included if a
GeneRIF
entry links the gene to an article in
PubMed®.
GeneRIF also provides a short summary of the article's claim about the
protein, which is shown instead of a snippet.
- Proteins from Swiss-Prot (the curated part of UniProt)
are included if the curators
identified experimental evidence for the protein's function (evidence
code ECO:0000269). For these proteins, the fields of the Swiss-Prot entry that
describe the protein's function are shown (with bold headings).
- Proteins from BRENDA,
a curated database of enzymes, are included if they are linked to a paper in PubMed
and their full sequence is known.
- Every protein from the non-redundant subset of
BioLiP,
a database
of ligand-binding sites and catalytic residues in protein structures, is included. Since BioLiP itself
does not include descriptions of the proteins, those are taken from the
Protein Data Bank.
Descriptions from PDB rely on the original submitter of the
structure and cannot be updated by others, so they may be less reliable.
(For SitesBLAST and Sites on a Tree, we use a larger subset of BioLiP so that every
ligand is represented among a group of structures with similar sequences, but for
PaperBLAST, we use the non-redundant set provided by BioLiP.)
- Every protein from EcoCyc, a curated
database of the proteins in Escherichia coli K-12, is included, regardless
of whether they are characterized or not.
- Proteins from the MetaCyc metabolic pathway database
are included if they are linked to a paper in PubMed and their full sequence is known.
- Proteins from the Transport Classification Database (TCDB)
are included if they have known substrate(s), have reference(s),
and are not described as uncharacterized or putative.
(Some of the references are not visible on the PaperBLAST web site.)
- Every protein from CharProtDB,
a database of experimentally characterized protein annotations, is included.
- Proteins from the CAZy database of carbohydrate-active enzymes
are included if they are associated with an Enzyme Classification number.
Even though CAZy does not provide links from individual protein sequences to papers,
these should all be experimentally-characterized proteins.
- Proteins from the REBASE database
of restriction enzymes are included if they have known specificity.
- Every protein with an evidence-based reannotation (based on mutant phenotypes)
in the Fitness Browser is included.
- Sequence-specific transcription factors (including sigma factors and DNA-binding response regulators)
with experimentally-determined DNA binding sites from the
PRODORIC database of gene regulation in prokaryotes.
- Putative transcription factors from RegPrecise
that have manually-curated predictions for their binding sites. These predictions are based on
conserved putative regulatory sites across genomes that contain similar transcription factors,
so PaperBLAST clusters the TFs at 70% identity and retains just one member of each cluster.
- Coding sequence (CDS) features from the
European Nucleotide Archive (ENA)
are included if the /experiment tag is set (implying that there is experimental evidence for the annotation),
the nucleotide entry links to paper(s) in PubMed,
and the nucleotide entry is from the STD data class
(implying that these are targeted annotated sequences, not from shotgun sequencing).
Also, to filter out genes whose transcription or translation was detected, but whose function
was not studied, nucleotide entries or papers with more than 25 such proteins are excluded.
Descriptions from ENA rely on the original submitter of the
sequence and cannot be updated by others, so they may be less reliable.
Except for GeneRIF and ENA,
the curated entries include a short curated
description of the protein's function.
For entries from BioLiP, the protein's function may not be known beyond binding to the ligand.
Many of these entries also link to articles in PubMed.
For more information see the
PaperBLAST paper (mSystems 2017)
or the code.
You can download PaperBLAST's database here.
Changes to PaperBLAST since the paper was written:
- November 2023: incorporated PRODORIC and RegPrecise. Many PRODORIC entries were not linked to a protein sequence (no UniProt identifier), so we added this information.
- February 2023: BioLiP changed their download format. PaperBLAST now includes their non-redundant subset. SitesBLAST and Sites on a Tree use a larger non-redundant subset that ensures that every ligand is represented within each cluster. This should ensure that every binding site is represented.
- June 2022: incorporated some coding sequences from ENA with the /experiment tag.
- March 2022: incorporated BioLiP.
- April 2020: incorporated TCDB.
- April 2019: EuropePMC now returns table entries in their search results. This has expanded PaperBLAST's database, but most of the new entries are of low relevance, and the resulting snippets are often just lists of locus tags with annotations.
- February 2018: the alignment page reports the conservation of the hit's functional sites (if available from from Swiss-Prot or UniProt)
- January 2018: incorporated BRENDA.
- December 2017: incorporated MetaCyc, CharProtDB, CAZy, REBASE, and the reannotations from the Fitness Browser.
- September 2017: EuropePMC no longer returns some table entries in their search results. This has shrunk PaperBLAST's database, but has also reduced the number of low-relevance hits.
Many of these changes are described in Interactive tools for functional annotation of bacterial genomes.
PaperBLAST cannot provide snippets for many of the papers that are
published in non-open-access journals. This limitation applies even if
the paper is marked as "free" on the publisher's web site and is
available in PubmedCentral or EuropePMC. If a journal that you publish
in is marked as "secret," please consider publishing elsewhere.
Many important articles are missing from PaperBLAST, either because
the article's full text is not in EuropePMC (as for many older
articles), or because the paper does not mention a protein identifier such as a locus tag, or because of PaperBLAST's heuristics. If you notice an
article that characterizes a protein's function but is missing from
PaperBLAST, please notify the curators at UniProt
or add an entry to GeneRIF.
Entries in either of these databases will eventually be incorporated
into PaperBLAST. Note that to add an entry to UniProt, you will need
to find the UniProt identifier for the protein. If the protein is not
already in UniProt, you can ask them to create an entry. To add an
entry to GeneRIF, you will need an NCBI Gene identifier, but
unfortunately many prokaryotic proteins in RefSeq do not have
corresponding Gene identifers.
References
PaperBLAST: Text-mining papers for information about homologs.
M. N. Price and A. P. Arkin (2017). mSystems, 10.1128/mSystems.00039-17.
Europe PMC in 2017.
M. Levchenko et al (2017). Nucleic Acids Research, 10.1093/nar/gkx1005.
Gene indexing: characterization and analysis of NLM's GeneRIFs.
J. A. Mitchell et al (2003). AMIA Annu Symp Proc 2003:460-464.
UniProt: the universal protein knowledgebase.
The UniProt Consortium (2016). Nucleic Acids Research, 10.1093/nar/gkw1099.
BRENDA in 2017: new perspectives and new tools in BRENDA.
S. Placzek et al (2017). Nucleic Acids Research, 10.1093/nar/gkw952.
The EcoCyc database: reflecting new knowledge about Escherichia coli K-12.
I. M. Keeseler et al (2016). Nucleic Acids Research, 10.1093/nar/gkw1003.
The MetaCyc database of metabolic pathways and enzymes.
R. Caspi et al (2018). Nucleic Acids Research, 10.1093/nar/gkx935.
CharProtDB: a database of experimentally characterized protein annotations.
R. Madupu et al (2012). Nucleic Acids Research, 10.1093/nar/gkr1133.
The carbohydrate-active enzymes database (CAZy) in 2013.
V. Lombard et al (2014). Nucleic Acids Research, 10.1093/nar/gkt1178.
The Transporter Classification Database (TCDB): recent advances
M. H. Saier, Jr. et al (2016). Nucleic Acids Research, 10.1093/nar/gkv1103.
REBASE - a database for DNA restriction and modification: enzymes, genes and genomes.
R. J. Roberts et al (2015). Nucleic Acids Research, 10.1093/nar/gku1046.
Deep annotation of protein function across diverse bacteria from mutant phenotypes.
M. N. Price et al (2016). bioRxiv, 10.1101/072470.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory