PaperBLAST

PaperBLAST Hits for CharProtDB::CH_123433 glucosamine-6-phosphate deaminase (Candida albicans) (182 a.a., MDEYLGLAPS...)

Show query sequence

>CharProtDB::CH_123433 glucosamine-6-phosphate deaminase (Candida albicans)
MDEYLGLAPSDLQSYHYFMYDKFFNHIDIPRENIHILNGLAANIDEECANYEKKIKQYGR
IDLFLGGLGPEGHLAFNEAGSSRNSKTRKVELVESTIKANCRFFGNDESKVPKYALSVGI
STILDNSDEIAIIVLGKSKQFALDKTVNGKPNDPKYPSSYLQDHANVLIVCDNAAAGLKS
KL

Running BLASTp...

Found 132 similar proteins in the literature:

NAG1 glucosamine-6-phosphate deaminase from Candida albicans (see 4 papers)
100% identity, 100% coverage

• CharProtDB CGD description: glucosamine-6-phosphate deaminase; enzyme of N-acetylglucosamine utilization; required for wild-type hyphal growth and mouse virulence; converts glucosamine 6-P to fructose 6-P; reaction is reversible in vitro; gene is GlcNAc-induced

Q04802 Glucosamine-6-phosphate isomerase from Candida albicans (strain SC5314 / ATCC MYA-2876)
99% identity, 73% coverage

• Evidence that intracellular stages of Leishmania major utilize amino sugars as a major carbon source
  Naderer, PLoS pathogens 2010
  • “...T. brucei (D0AAS0), E. coli (B7LKT5), Y. pestis (A4TNY0), H. sapiens (P46926) and C. albicans (Q04802) were aligned with ClustalW and edited with Boxshade, whereby identical or similar residues are boxed in black or grey, respectively. The arrow marks the residue His143 in E. coli ,...”

SG0858 glucosamine-6-phosphate deaminase from Sodalis glossinidius str. 'morsitans'
52% identity, 63% coverage

• Identification of overexpressed genes in Sodalis glossinidius inhabiting trypanosome-infected self-cured tsetse flies
  Hamidou, Frontiers in microbiology 2014
  • “...microarray results were controlled, using quantitative PCR (qPCR), on a subset of four genes (SG0845, SG0858, SG0895, and SG1978) that were shown to be differentially expressed in microarray experiments between the two groups of flies; these genes were among the highest overexpressed in refractory flies. Primers,...”
  • “...addition, among the most highly overexpressed genes in refractory flies were those encoding glucosamine-6-phosphate deaminase (SG0858). This enzyme participates in amino sugar metabolism, particularly in the conversion of glucosamine into ammonium and fructose. S. glossinidius was suspected to favor trypanosome establishment in the insect midgut through...”

BT4127 glucosamine-6-phosphate isomerase from Bacteroides thetaiotaomicron VPI-5482
53% identity, 65% coverage

• Discovery of β-1,4-D-mannosyl-N-acetyl-D-glucosamine phosphorylase involved in the metabolism of N-glycans
  Nihira, The Journal of biological chemistry 2013
  • “...(BT2430) and D-glucosamine 6-phosphate deaminase (BT0258, BT3587, or BT4127) to enter the glycolysis. SEPTEMBER 20, 2013 * VOLUME 288 * NUMBER 38 Thus, BT1033...”

YPTB1119 putative glucosamine-6-phosphate isomerase from Yersinia pseudotuberculosis IP 32953
A4TNY0 Glucosamine-6-phosphate deaminase from Yersinia pestis (strain Pestoides F)
YPO2627 putative glucosamine-6-phosphate isomerase from Yersinia pestis CO92
YPK_2997 glucosamine-6-phosphate isomerase from Yersinia pseudotuberculosis YPIII
52% identity, 65% coverage

• IscR is essential for yersinia pseudotuberculosis type III secretion and virulence
  Miller, PLoS pathogens 2014
  • “...b(562) cybC 6.7 YPTB1117 putative N-acetylglucosamine regulatory protein nagC 2.5 YPTB1118 N-acetylglucosamine-6-phosphate deacetylase nagA 4.1 YPTB1119 putative glucosamine-6-phosphate isomerase nagB 5.9 YPTB1120 N-acetylglucosamine-specific IIABC component nagE 5.2 YPTB1148 dihydrolipoamide succinyltransferase sucB 2.1 YPTB1149 succinyl-CoA synthetase beta chain sucC 3.0 YPTB1150 succinyl-CoA synthetase alpha chain sucD 3.1...”
• Growth of Yersinia pseudotuberculosis in human plasma: impacts on virulence and metabolic gene expression
  Rosso, BMC microbiology 2008
  • “...(0.011) YPTB1079 YPO2586 conserved hypothetical protein 0.559 (0.025) YPTB1080 YPO2587 conserved hypothetical protein 0.644 (0.026) YPTB1119 (nagB) YPO2627 putative glucosamine-6-phosphate isomerase 0.654 (0.027) YPTB1140 YPO1106 conserved hypothetical protein 0.705 (0.034) YPTB1166 (gpmA) YPO1133 phosphoglycerate mutase 1 3.178 (< 0.001) YPTB1290 (bglA) YPO1254 6-phospho-beta-glucosidase 1.802 (0.008) YPTB1327...”
• Evidence that intracellular stages of Leishmania major utilize amino sugars as a major carbon source.
  Naderer, PLoS pathogens 2010
  • “...L. major (UniProt: Q4Q4U6), T. cruzi (Q4D0F2), T. brucei (D0AAS0), E. coli (B7LKT5), Y. pestis (A4TNY0), H. sapiens (P46926) and C. albicans (Q04802) were aligned with ClustalW and edited with Boxshade, whereby identical or similar residues are boxed in black or grey, respectively. The arrow marks...”
• Growth of Yersinia pseudotuberculosis in human plasma: impacts on virulence and metabolic gene expression
  Rosso, BMC microbiology 2008
  • “...YPO2586 conserved hypothetical protein 0.559 (0.025) YPTB1080 YPO2587 conserved hypothetical protein 0.644 (0.026) YPTB1119 (nagB) YPO2627 putative glucosamine-6-phosphate isomerase 0.654 (0.027) YPTB1140 YPO1106 conserved hypothetical protein 0.705 (0.034) YPTB1166 (gpmA) YPO1133 phosphoglycerate mutase 1 3.178 (< 0.001) YPTB1290 (bglA) YPO1254 6-phospho-beta-glucosidase 1.802 (0.008) YPTB1327 YPO1295 putative...”
• Genome-Scale Mapping Reveals Complex Regulatory Activities of RpoN in Yersinia pseudotuberculosis
  Mahmud, mSystems 2020
  • “...3.5 TGGGCATAATTTTTGCCA 10.6 54,28 YPK_2901 NA 19 IrGAs14 3296918 10.0 8.8 7.9 TAGGCACGAGATTTGCAT 10.7 54,32,28,38 YPK_2997 YPK_2996 E 168, 189, 199 IrGAs15 3347078 3.5 NA NA TTGGCAAGAAATCTGCAC + 10.7 38,70,54,28 YPK_3045 NA 5, 7, 3 IrGAs16 3383005 13.6 11.8 9.3 ATGGCACGGATTTTGCCC 10.8 38,24,54,70 YPK_3075 YPK_3074 43,...”
  • “...activated transcription. Results are shown for expression under virulence-inducing conditions for YPK_0329, YPK_1886, YPK_1894, YPK_2927, YPK_2997, YPK_3010, YPK_3075, YPK_3613, YPK_3887, and YPK_3962 and for expression during stationary phase at 26C for YPK_2908 and YPK_2909. Values represent means SEM of three independent experiments. (Right) Schematic illustration of...”

B3MMZ7 Glucosamine-6-phosphate isomerase from Drosophila ananassae
49% identity, 64% coverage

• Proteomic analysis by iTRAQ in red claw crayfish, Cherax quadricarinatus, hematopoietic tissue cells post white spot syndrome virus infection.
  Jeswin, Fish & shellfish immunology 2016
  • “...6-phosphogluconate dehydrogenase E9GAM5 676 6 2 1.6 Enoyl-CoA hydratase F0J8W9 153 9.4 1 0.68 GF15148 B3MMZ7 82 4.4 1 0.6 GMP synthase E1ZYK1 205 2.5 1 2.32 Phosphoglycerate mutase 2 B0X5F6 122 3.5 1 0.7 Tudor staphylococcal nuclease G1ARD5 311 4.5 3 0.6 Signal transduction 14-3-3...”

ESA_02661 glucosamine-6-phosphate deaminase from Cronobacter sakazakii ATCC BAA-894
ESA_02661 hypothetical protein from Enterobacter sakazakii ATCC BAA-894
51% identity, 66% coverage

• Sialic acid utilization by Cronobacter sakazakii
  Joseph, Microbial informatics and experimentation 2013
  • “...+ + + + + + + + + + + + + + nagB ESA_02661 Glucosamine-6-phosphate deaminase + + + + + + + + + + + + + + neuC ESA_03772 UDP-N-acetylglucosamine 2-epimerase + + + + + + + + + +...”

TDE_0337 glucosamine-6-phosphate deaminase from Treponema denticola ATCC 35405
51% identity, 65% coverage

• Characterization of a potential ABC-type bacteriocin exporter protein from Treponema denticola
  Tanaka-Kumazawa, BMC oral health 2016
  • “...fold change (KT-3 versus wild type) TDE_0499 hypothetical protein 50.5 TDE_2748 acetyltransferase, GNAT family 30.0 TDE_0337 glucosamine-6-phosphate deaminase 19.5 TDE_2214 hypothetical protein 17.9 TDE_0561 hypothetical protein 16.0 TDE_0614 precorrin-4 C11-methyltransferase 16.0 TDE_0506 DNA-damage-inducible protein J, putative 15.3 TDE_1848 hypothetical protein 15.2 TDE_0307 hypothetical protein 14.3 TDE_2378...”

VSAL_I2812 glucosamine-6-phosphate deaminase from Aliivibrio salmonicida LFI1238
VSAL_I2812 glucosamine-6-phosphate deaminase from Vibrio salmonicida LFI1238
51% identity, 66% coverage

• The genome sequence of the fish pathogen Aliivibrio salmonicida strain LFI1238 shows extensive evidence of gene decay
  Hjerde, BMC genomics 2008
  • “...cytosol by a PTS transporter (VSAL_I0703- I0708). Cytoplasmic enzymes (VSAL_I2581- I2582, VSAL_I2584- I2585, VSAL_I0830 and VSAL_I2812) convert the transport products into fructose-6-P, acetate and ammonia. In the absence of chitin, the perisplasmic chitin oligosaccharide binding protein CBP (VSAL_I2576) binds to the chitin sensor/kinase ChiS (VSAL_I2575) and...”

GlmD / b0678 glucosamine-6-phosphate deaminase (EC 3.5.99.6) from Escherichia coli K-12 substr. MG1655 (see 28 papers)
nagB / P0A759 glucosamine-6-phosphate deaminase (EC 3.5.99.6) from Escherichia coli (strain K12) (see 27 papers)
NAGB_ECOLI / P0A759 Glucosamine-6-phosphate deaminase; GlcN6P deaminase; GNPDA; Glucosamine-6-phosphate isomerase; EC 3.5.99.6 from Escherichia coli (strain K12) (see 3 papers)
NAGB_ECO57 / P0A760 Glucosamine-6-phosphate deaminase; GlcN6P deaminase; GNPDA; Glucosamine-6-phosphate isomerase; EC 3.5.99.6 from Escherichia coli O157:H7 (see paper)
1deaA / P0A759 Structure and catalytic mechanism of glucosamine 6-phosphate deaminase from escherichia coli at 2.1 angstroms resolution (see paper)
nagB / PDB|1CD5 GlcN6P deaminase; EC 3.5.99.6 from Escherichia coli K12 (see 14 papers)
B7LKT5 Glucosamine-6-phosphate deaminase from Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
NP_415204 glucosamine-6-phosphate deaminase from Escherichia coli str. K-12 substr. MG1655
b0678 glucosamine-6-phosphate deaminase from Escherichia coli str. K-12 substr. MG1655
51% identity, 65% coverage

• function: Catalyzes the reversible isomerization-deamination of glucosamine 6-phosphate (GlcN6P) to form fructose 6-phosphate (Fru6P) and ammonium ion.
  catalytic activity: alpha-D-glucosamine 6-phosphate + H2O = beta-D-fructose 6- phosphate + NH4(+) (RHEA:12172)
  subunit: Homohexamer; trimer of disulfide-linked dimers.
• function: Catalyzes the reversible isomerization-deamination of glucosamine 6-phosphate (GlcN6P) to form fructose 6-phosphate (Fru6P) and ammonium ion.
  catalytic activity: alpha-D-glucosamine 6-phosphate + H2O = beta-D-fructose 6- phosphate + NH4(+) (RHEA:12172)
  subunit: Homohexamer; trimer of disulfide-linked dimers.
• Ligand: phosphate ion (1deaA)
• Exposure of E. coli to DNA-Methylating Agents Impairs Biofilm Formation and Invasion of Eukaryotic Cells via Down Regulation of the N-Acetylneuraminate Lyase NanA
  Di, Frontiers in microbiology 2016
  • “...SECONDARY METABOLITES 5.78 3272 0.00024 N-acetylneuraminate lyase nanA P0A6L4 1.68 3674 0.000046 Glucosamine-6-phosphate deaminase nagB P0A760 1.72 2441 0.0042 Tryptophanase tnaA P0A853 1.30 1408 0.0029 Polyribonucleotide nucleotidyltransferase pnp P05055 +1.09 2400 0.0063 Glutamate decarboxylase beta gadB P69910 GLYCEROPHOSPHOLIPID METABOLISM 1.65 2131 0.0032 Aerobic glycerol-3-phosphate dehydrogenase glpD...”
• Evidence that intracellular stages of Leishmania major utilize amino sugars as a major carbon source.
  Naderer, PLoS pathogens 2010
  • “...protein sequences of L. major (UniProt: Q4Q4U6), T. cruzi (Q4D0F2), T. brucei (D0AAS0), E. coli (B7LKT5), Y. pestis (A4TNY0), H. sapiens (P46926) and C. albicans (Q04802) were aligned with ClustalW and edited with Boxshade, whereby identical or similar residues are boxed in black or grey, respectively....”
• The Nitrogen Regulatory PII Protein (GlnB) and N-Acetylglucosamine 6-Phosphate Epimerase (NanE) Allosterically Activate Glucosamine 6-Phosphate Deaminase (NagB) in Escherichia coli.
  Rodionova, Journal of bacteriology 2018
  • GeneRIF: We provide evidence here that NanE, GlcNAc-6P epimerase, and the uridylylated PII protein allosterically activate NagB by direct protein-protein interactions.
• The tertiary origin of the allosteric activation of E. coli glucosamine-6-phosphate deaminase studied by sol-gel nanoencapsulation of its T conformer.
  Zonszein, PloS one 2014
  • GeneRIF: Data indicate the existence of tertiary mixed forms at glucosamine-6-phosphate deaminase (EcGNPDA) T conformers.
• Why does Escherichia coli grow more slowly on glucosamine than on N-acetylglucosamine? Effects of enzyme levels and allosteric activation of GlcN6P deaminase (NagB) on growth rates.
  Alvarez-Añorve, Journal of bacteriology 2005
  • GeneRIF: strains carrying a wild-type deaminase (nagB) gene, increasing the level of the NagB protein or the rate of GlcN uptake increased the growth rate, which showed that both enzyme induction and sugar transport were limiting.
• Comparative NanoUPLC-MS^E analysis between magainin I-susceptible and -resistant Escherichia coli strains
  Cardoso, Scientific reports 2017
  • “...A 8787.3 Environmental Information Processing P0A6K3 DEF_ECOLI Downregulated 392.11 0.52 0.46 Peptide deformylase 1932.8 Metabolism P0A759 NAGB_ECOLI Downregulated 276.4 0.51 0.37 Glucosamine-6-phosphate deaminase 2977.4 Metabolism P0ABT2 DPS_ECOLI Downregulated 32750.34 0.51 0.03 DNA protection during starvation protein 1869.5 Genetic Information Processing P0A6Y8 DNAK_ECOLI Downregulated 19211.09 0.51 0.02...”
• The EcoCyc Database
  Karp, EcoSal Plus 2018 (secret)
• Genome-Scale Mapping of Escherichia coli σ54 Reveals Widespread, Conserved Intragenic Binding
  Bonocora, PLoS genetics 2015
  • “...- b0643 ybeL 225 8.124 IA08 702665 8 C TGGC CTGCTTTA TGC A 702663 + b0678 nagB - b0679 nagE 485 10.647 IA09 797417 4 CCA GC ACGGTTT TTGC A 797422 + b0766 ybhA - b0767 pgl 368 10.051 IA10 1098490 6 A TGGC TTATTATA TGC...”
• Metabolic shift of Escherichia coli under salt stress in the presence of glycine betaine
  Metris, Applied and environmental microbiology 2014
  • “...b2266 b0757 b0759 b3431 b2053 b0220 b4014 b4014 b2684 b0678 b1482 b4376 b1896 b1897 b0133 b3403 b1062 b3310 b1581 b2464 b2104 b2465 b0740 b1414 b2898 b3003...”
• An expanded genome-scale model of Escherichia coli K-12 (iJR904 GSM/GPR)
  Reed, Genome biology 2003
  • “...alpha subunit Acetate CoA-transferase 2.8.3.8 b1694 ydiF Putative acetyl-CoA:acetoacetyl-CoA transferase alpha subunit Acetate CoA-transferase 3.1.1.31 b0678 nagB Glucosamine-6-phosphate deaminase 6-Phosphogluconolactonase (Pgl) 3.1.1.31 b3718 yieK Putative isomerase 6-Phosphogluconolactonase (Pgl) 3.1.1.31 b3141 agaI Putative galactosamine-6-phosphate isomerase 6-Phosphogluconolactonase (Pgl) 3.2.1.68 b3431 glgX Glycosyl hydrolase Isoamylase 3.5.1.2 b1524 yneH Putative...”
• Physiological studies of Escherichia coli strain MG1655: growth defects and apparent cross-regulation of gene expression
  Soupene, Journal of bacteriology 2003
  • “...resulted in elevated levels of expression of the nagBACD (b0678 to b0675) and nagE (b0679) operons (but see below). The products of these operons are...”
  • “...b3417 b3416 malP malQ 3.9 2.9 0.3 0.6 b0679 nagE 0.9 3.3 b0678 b0677 b0676 b0675 nagB nagA nagC nagD 1.1 1.1 1.1 1.6 4.4 3.7 1.8 1.0 b3730 b3729 glmU glmS 1.3...”
• Combined, functional genomic-biochemical approach to intermediary metabolism: interaction of acivicin, a glutamine amidotransferase inhibitor, with Escherichia coli K-12
  Smulski, Journal of bacteriology 2001
  • “...b3828 b3856 b0635 b2113 b3291 b4219 b3161 b0085 b0109 b0678 b1223 b2159 b0568 b4238 b4237 b2673 b2674 b1739 b4376 b1896 b1897 b0134 b3403 b4107 b4101 b0242...”

HI0141 glucosamine-6-phosphate isomerase (nagB) from Haemophilus influenzae Rd KW20
50% identity, 65% coverage

• Sialic acid mediated transcriptional modulation of a highly conserved sialometabolism gene cluster in Haemophilus influenzae and its effect on virulence
  Jenkins, BMC microbiology 2010
  • “...sialometabolism (Figure 1 ). The genes for sialic acid catabolism ( HI0140 ( nagA ), HI0141 ( nagB ), HI0142 ( nanA ), HI0144 ( nanK ), HI0145 ( nanE ) and including HI0143 ( siaR )) and procurement ( HI0146 ( siaP ), HI1047 (...”
• Sialic Acid metabolism and systemic pasteurellosis
  Steenbergen, Infection and immunity 2005
  • “...presumed to encode a cytidyltransferase, whereas HI0141 and HI0140 encode glucosamine deaminase and N-acetylglucosamine deacetylase, respectively. Bent arrows...”
• Gene expression changes triggered by exposure of Haemophilus influenzae to novobiocin or ciprofloxacin: combined transcription and translation analysis
  Gmuender, Genome research 2001
  • “...hi0088 hi1545 hi0189 hi0465 hi0446 hi1727 hi1181 hi1177 hi0548 hi0141 hi0913 hi1179 hi0509 hi0628 hi1636 hi1178 hi1729 hi1728 hi1180 a Gene product 10 min 60...”

STM0684 glucosamine-6-phosphate deaminase from Salmonella typhimurium LT2
51% identity, 65% coverage

• Salmonella enterica serovar typhimurium colonizing the lumen of the chicken intestine grows slowly and upregulates a unique set of virulence and metabolism genes
  Harvey, Infection and immunity 2011
  • “...Carbohydrate transport and metabolism STM2433 STM4231 STM2190 STM0684 STM0685 STM2431 crr lamB mglB nagB nagE ptsH Glucose-specific IIA component Maltoporin...”

A6T6C1 Glucosamine-6-phosphate deaminase from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
51% identity, 65% coverage

• Disruption of KPC-producing Klebsiella pneumoniae membrane via induction of oxidative stress by cinnamon bark (Cinnamomum verum J. Presl) essential oil
  Yang, PloS one 2019
  • “...B5XWS2 Glycan metabolism Control 86 Glucokinase glk A6TC33 Energy synthesis Control 87 Glucosamine-6-phosphate deaminase nagB A6T6C1 Carbohydrate metabolism Control 88 Glutamate 5-kinase proB A6T562 Protein biosynthesis Control 89 Glycerol-3-phosphate acyltransferase plsB A6TGV0 Phospholipid biosynthesis Control 90 Histidine biosynthesis bifunctional protein HisB hisB A6TBC5 Protein biosynthesis Control...”

An16g09070 uncharacterized protein from Aspergillus niger
50% identity, 50% coverage

• Cytosolic streaming in vegetative mycelium and aerial structures of Aspergillus niger
  Bleichrodt, Studies in mycology 2013
  • “...glucosyltransferase) tpsB - Aspergillus niger An12g07470 975 Weak similarity to cyanovirin-N CV-N - Nostoc ellipsosporum An16g09070 973 Strong similarity to glucosamine-6-phosphate deaminase from patent WO9835047-A1 - Escherichia coli An07g03770 967 Strong similarity to Cu,Zn superoxide dismutase sodC - Aspergillus fumigatus An16g05930 960 Strong similarity to hypothetical...”
• Genomic analysis of the secretion stress response in the enzyme-producing cell factory Aspergillus niger
  Guillemette, BMC genomics 2007
  • “...An09g06400 similar to chitinase CHIA Aspergillus nidulans -2.1 0.5 *1.0 0.008 2.4 0.3 2.3 0.8 An16g09070 similar to glucosamine-6-phosphate deaminase A. fumigatus *-1.2 0.5 *1.4 0.2 2.1 0.08 2.4 0.7 Unclassified An08g03960 hypothetical endoplasmic reticulum associated protein 2.1 0.09 1.7 0.07 3.3 1.0 1.6 0.06 An02g00120...”

VV2_1200 6-phosphogluconolactonase from Vibrio vulnificus CMCP6
52% identity, 65% coverage

• SOLiD sequencing of four Vibrio vulnificus genomes enables comparative genomic analysis and identification of candidate clade-specific virulence genes
  Gulig, BMC genomics 2010
  • “...(NanE, VV2_0734), N-acetylmannosamine kinase (NanK, VV2_0735), and N-acetylglucosamine-6-phosphate deacetylase (NagA, VV2_0736). Because the nagB gene (VV2_1200, glucosamine-6-P deaminase) is in the V. vulnificus core genome, the clade 2 strains and 99-738 DP-B5 uniquely have the ability to assimilate exogenous sialic acid into central metabolism as fructose-6-phosphate,...”

Q4QP46 Glucosamine-6-phosphate deaminase from Haemophilus influenzae (strain 86-028NP)
50% identity, 65% coverage

• Novel protein identification methods for biomarker discovery via a proteomic analysis of periodontally healthy and diseased gingival crevicular fluid samples.
  Baliban, Journal of clinical periodontology 2012
  • “...polymerase subunit alpha 3 2.3 6.5 A7I3U0 RL7_CAMHC 50S ribosomal protein L7/L12 2 1.5 3.0 Q4QP46 NAGB_HAEI8 Glucosamine-6-phosphate deaminase 1 1.0 3.0 A5GDA7 ARLY_GEOUR Argininosuccinate lyase 1 1.0 2.0 Chronic Periodontitis Q2RRP5 RBL2_RHORT Ribulose bisphosphate carboxylase 12 18.4 46.1 P42316 SCOB_BACSU Probable succinyl-CoA:3-ketoacid-coenzyme A transferase sub...”

Afu8g04070 glucosamine-6-phosphate deaminase, putative from Aspergillus fumigatus Af293
51% identity, 48% coverage

• Stress Responses Elicited by Glucose Withdrawal in Aspergillus fumigatus
  Emri, Journal of fungi (Basel, Switzerland) 2022
  • “...https://bioconductor.org/packages/release/bioc/html/DESeq2.html ; accessed on 15 November 2022). 2.8. Detecting Allele-Specific Expression The expression of the Afu8g04070, Afu8g04080, Afu8g04090, Afu8g04100, Afu8g04110, Afu8g04120, and Afu8g04130 genes and their paralogues (Afu1g00480, Afu1g00470, Afu1g00460, Afu1g00450, Afu1g00440, Afu1g00420, and Afu1g00410, respectively) was studied as follows: For each gene pair and RNA...”
  • “...exist in duplicated forms in the genome of A. fumigatus Af293 [ 37 ]. The Afu8g04070 (putative glucosamine-6-phosphate deaminase), Afu8g04100 (putative N-acetylglucosamine-6-phosphate deacetylase), and Afu8g04110 (putative N-acetyl glucosamine transporter) genes are part of a gene set containing seven genes far from the telomeres of chromosome 8....”
• Evolutionary Analysis of Sequence Divergence and Diversity of Duplicate Genes in Aspergillus fumigatus
  Yang, Evolutionary bioinformatics online 2012
  • “...1.54 [1.78, 1.00] Afu8g04060 1.74 [1.85, 0.86] Afu2g10920 1.57 [2.32, 2.09] Afu3g03410 1.95 [2.24, 1.52] Afu8g04070 1.66 [1.85, 0.92] Afu1g00480 2.98 [2.01, 0.19] Afu3g07830 1.67 [2.27, 1.88] Afu1g06710 2.55 [2.08, 0.69] Afu2g10840 1.81 [1.29, 0.01] Afu6g11810 2.47 [1.61, 0.10] Afu4g12050 1.84 [2.22, 1.62] Afu1g00530 3.55 [1.99,...”

Afu1g00480 glucosamine-6-phosphate deaminase, putative from Aspergillus fumigatus Af293
51% identity, 48% coverage

• Stress Responses Elicited by Glucose Withdrawal in Aspergillus fumigatus
  Emri, Journal of fungi (Basel, Switzerland) 2022
  • “...expression of the Afu8g04070, Afu8g04080, Afu8g04090, Afu8g04100, Afu8g04110, Afu8g04120, and Afu8g04130 genes and their paralogues (Afu1g00480, Afu1g00470, Afu1g00460, Afu1g00450, Afu1g00440, Afu1g00420, and Afu1g00410, respectively) was studied as follows: For each gene pair and RNA sequencing sample we counted the number of reads exactly matching only the...”
• Evolutionary Analysis of Sequence Divergence and Diversity of Duplicate Genes in Aspergillus fumigatus
  Yang, Evolutionary bioinformatics online 2012
  • “...1.74 [1.85, 0.86] Afu2g10920 1.57 [2.32, 2.09] Afu3g03410 1.95 [2.24, 1.52] Afu8g04070 1.66 [1.85, 0.92] Afu1g00480 2.98 [2.01, 0.19] Afu3g07830 1.67 [2.27, 1.88] Afu1g06710 2.55 [2.08, 0.69] Afu2g10840 1.81 [1.29, 0.01] Afu6g11810 2.47 [1.61, 0.10] Afu4g12050 1.84 [2.22, 1.62] Afu1g00530 3.55 [1.99, 0.39] Afu4g09700 1.89 [2.21,...”

Z0825 glucosamine-6-phosphate deaminase from Escherichia coli O157:H7 EDL933
51% identity, 65% coverage

• Transcriptomic analysis reveals specific metabolic pathways of enterohemorrhagic Escherichia coli O157:H7 in bovine digestive contents
  Segura, BMC genomics 2018
  • “...2.85 1.52E-04 NDE Z0824 nagA N-acetylglucosamine 6-phosphate deacetylase 2.37 7.39E-06 2.95 2.19E-08 NDE NDE NDE Z0825 nagB Glucosamine 6-phosphate deaminase 3.44 1.74E-07 4.49 7.20E-12 NDE NDE NDE Z0826 nagE PTS system N-acetylglucosamine-specific IIABC component 3.31 4.52E-08 4.11 9.49E-12 NDE 2.25 3.91E-04 NDE Z4583 nanA N-acetylneuraminate lyase...”

5hj5B / Q9KKS5 Crystal structure of tertiary complex of glucosamine-6-phosphate deaminase from vibrio cholerae with beta-d-glucose-6-phosphate and fructose-6-phosphate
52% identity, 64% coverage

• Ligands: fructose -6-phosphate; 6-o-phosphono-beta-d-glucopyranose (5hj5B)

VCA1025 glucosamine-6-phosphate isomerase from Vibrio cholerae O1 biovar eltor str. N16961
52% identity, 65% coverage

• Catabolism of mucus components influences motility of Vibrio cholerae in the presence of environmental reservoirs
  Reddi, PloS one 2018
  • “...(nan-nag cluster) [ 34 , 35 ]. GlcN-6P is further metabolized by glucosamine-6-phosphate deaminase, NagB (VCA1025), into Fructose-6-phosphate (Fru-6P), which enters central metabolism ( Fig 2 ). 10.1371/journal.pone.0201383.g002 Fig 2 Schematic of Neu5Ac and GlcNAc catabolic pathways. A) The catabolic pathway of N -acetylneuraminic acid (Neu5Ac,...”
• Quorum sensing-regulated chitin metabolism provides grazing resistance to Vibrio cholerae biofilms
  Sun, The ISME journal 2015
  • “...subunit IIC 2.17 VC1284 6-Phospho-beta-glucosidase 1.77 VC1285 Hypothetical protein 1.06 VC2217 Beta- N -acetylhexosaminidase 1.93 VCA1025 Glucosamine-6-phosphate deaminase 1.48 Abbreviations: ABC, ATP-binding cassette; PTS, phosphotransferase system....”
• Sialic acid catabolism confers a competitive advantage to pathogenic vibrio cholerae in the mouse intestine
  Almagro-Moreno, Infection and immunity 2009
  • “...AP_004802 None None None None None VC1784 VC1776 VC1782 VC1781 VC1783 VC0994 VCA1025 VC1778 VC1779 VC1777 None None VC1775 VC1773 VC1774 a A A A A A A C C C A A...”

VF_2357 glucosamine-6-phosphate deaminase from Vibrio fischeri ES114
VF_2357 glucosamine-6-phosphate deaminase from Aliivibrio fischeri ES114
50% identity, 66% coverage

• The N-acetyl-D-glucosamine repressor NagC of Vibrio fischeri facilitates colonization of Euprymna scolopes
  Miyashiro, Molecular microbiology 2011
  • “...= endochitinase; VF_0807 = NagA; VF_0808 = NagE; VF_1598 = exochitinase; VF_2139 = chitoologosaccharide-binding protein; VF_2357 = NagB; VF_A0013 = chitin-binding protein; VF_A0143 = N -acetylglucosamine-binding protein; and VF_A0715 = chitodextrinase precursor. Values are of triplicate biological replicates and normalized by wild-type levels. Error bars indicate...”

VPA0038 glucosamine-6-phosphate isomerase from Vibrio parahaemolyticus RIMD 2210633
51% identity, 65% coverage

• Fis Connects Two Sensory Pathways, Quorum Sensing and Surface Sensing, to Control Motility in Vibrio parahaemolyticus
  Tague, Frontiers in microbiology 2021
  • “...153-bp, 385-bp, and 545bp DNA regions upstream of flhA (VP2235-VP2231), lafB (VPA1550-VPA1557), araB (VPA1674), nagB (VPA0038), gntK (VP0063), and scrABC (VPA1513) respectively, were used as inputs for Fis binding. The regulatory regions of qrr1 (193-bp), qrr2 (338-bp), qrr3 (162-bp), qrr4 (287-bp), and qrr5 (177-bp) were also...”
  • “...probes of P araB (VPA1674, L-ribulokinase, L-arabinose catabolism), 154-bp and 120-bp probes of P nagB (VPA0038, glucosamine-6-phosphate isomerase, D-glucosamine catabolism), and a138-bp probe of P gntK (VP0063, gluconokinase, D-gluconate catabolism) were used in EMSAs. The EMSA probes were PCR amplified using Phusion Hifidelity Polymerase in 50l...”
• Chitin Heterodisaccharide, Released from Chitin by Chitinase and Chitin Oligosaccharide Deacetylase, Enhances the Chitin-Metabolizing Ability of Vibrio parahaemolyticus
  Hirano, Journal of bacteriology 2019 (secret)
• Insights into Vibrio parahaemolyticus CHN25 response to artificial gastric fluid stress by transcriptomic analysis
  Sun, International journal of molecular sciences 2014
  • “...glgC ) Chn25_1047 2.336 Glucose-1-phosphate adenylyltransferase VP0829 ( nagA ) Chn25_0825 2.027 N -acetylglucosamine-6-phosphate deacetylase VPA0038 ( nagB ) Chn25A_0033 2.5647 Glucosamine-6-phosphate deaminase Glycolysis/gluconeogenesis VPA0566 Chn25A_1136 5.8196 Alcohol dehydrogenase VPA0180 Chn25A_0182 2.2002 Phospho-beta-glucosidase B VP2157 Chn25_2026 4.6439 Glyceraldehyde-3-phosphate dehydrogenase Aminoacyl-tRNA biosynthesis VP2470 Chn25_2407 2.0793 Tyrosyl-tRNA synthetase...”
  • “...and d -amino acid dehydrogenase small subunit (VP0623) showed down-regulated expression. In addition, the nagE (VPA0038) gene encoding a glucosamine-6-phosphate deaminase that converts fructose-6-phpsphate to glucN-phosphate were up-regulated in the AGF stress. It has been reported that urease located on bacterial cell surface may create a...”

I1C2J3 Glucosamine-6-phosphate isomerase from Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880)
RO3G_07378 glucosamine-6-phosphate isomerase 1 from Rhizopus delemar RA 99-880
49% identity, 59% coverage

• Fob1 and Fob2 Proteins Are Virulence Determinants of Rhizopus oryzae via Facilitating Iron Uptake from Ferrioxamine
  Liu, PLoS pathogens 2015
  • “...factor 1 R . oryzae RO3G_13794 1 4.4E7 0 0 0 0 163 18.7 6.02 I1C2J3 Glucosamine-6-phosphate isomerase 1 R . oryzae RO3G_07378 1 0 0 0 0 0 298 33.4 6.48 I1C4Y4 Histone H4 R . oryzae RO3G_08122 1 1.8E7 1.3E7 0 0 0 103...”
• Fob1 and Fob2 Proteins Are Virulence Determinants of Rhizopus oryzae via Facilitating Iron Uptake from Ferrioxamine
  Liu, PLoS pathogens 2015
  • “...4.4E7 0 0 0 0 163 18.7 6.02 I1C2J3 Glucosamine-6-phosphate isomerase 1 R . oryzae RO3G_07378 1 0 0 0 0 0 298 33.4 6.48 I1C4Y4 Histone H4 R . oryzae RO3G_08122 1 1.8E7 1.3E7 0 0 0 103 11.4 11.36 I1BZG8 Uncharacterized protein R. oryzae...”

PMI0454 glucosamine-6-phosphate deaminase from Proteus mirabilis HI4320
50% identity, 66% coverage

• Pathogenesis of <i>Proteus mirabilis</i> Infection
  Armbruster, EcoSal Plus 2018 (secret)

HCAG_08152 glucosamine-6-phosphate deaminase from Histoplasma mississippiense (nom. inval.)
52% identity, 60% coverage

• Comparative Proteomic Analysis of Histoplasma capsulatum Yeast and Mycelium Reveals Differential Metabolic Shifts and Cell Wall Remodeling Processes in the Different Morphotypes
  Almeida, Frontiers in microbiology 2021
  • “...related to chitin production in H. capsulatum , such as glucosamine-fructose-6-phosphate aminotransferase (HCAG_04088), glucosamine-6-phosphate deaminase (HCAG_08152) and N -acetylglucosamine-phosphate mutase (HCAG_00064), were also more abundant in the yeast form. In contrast, the enzyme nucleoside-diphosphate-sugar epimerase, which catalyzes the conversion of UDP- N -acetylgalactosamine into UDP- N...”

E7F0E2 Glucosamine-6-phosphate isomerase from Danio rerio
XP_684147 glucosamine-6-phosphate isomerase 2 from Danio rerio
47% identity, 64% coverage

• A proteomic insight into the midgut proteome of Ornithodoros moubata females reveals novel information on blood digestion in argasid ticks.
  Oleaga, Parasites & vectors 2017
  • “...(T) 0.13 0.09 Hydrolase activity Unfed-Fed EST_Acari B7PLL4 Fructose-1,6-bisphosphatase 1.95 1.22 Hydrolase activity Unfed-Fed EST_Acari E7F0E2 Glucosamine-6-phosphate isomerase (T) 0.98 0.98 Isomerase activity Unfed-Fed mRNA_Om B7PK21 Glucosylceramidase (T) 1.01 0.62 Hydrolase activity Unfed-Fed mRNA_Om A2V728 Glutamine: fructose-6-phosphate aminotransferase (T) 0.06 0.22 Transferase activity Unfed-Fed EST_Acari B7PLJ6...”
• Involvement of Glucosamine 6 Phosphate Isomerase 2 (GNPDA2) Overproduction in β-Amyloid- and Tau P301L-Driven Pathomechanisms.
  Lachén-Montes, Biomolecules 2024
  • GeneRIF: Involvement of Glucosamine 6 Phosphate Isomerase 2 (GNPDA2) Overproduction in beta-Amyloid- and Tau P301L-Driven Pathomechanisms.

GL50803_8245 Glucosamine-6-phosphate deaminase from Giardia intestinalis
48% identity, 65% coverage

• Unraveling the role of cAMP signaling in Giardia: insights into PKA-mediated regulation of encystation and subcellular interactions
  Shih, mSphere 2024
  • “...of ( A ) MYB2-NLuc (GL50803_8722), ( B ) CWP1-NLuc (GL50803_5638), ( C ) G6PI-B-NLuc (GL50803_8245), and ( D ) GNPNAT-NLuc (GL50803_14259) in dCas9-Ctrl and PKAc-g848 knockdown cell lines. Representative IFA images ( E ) and quantification of 24 h encysting cells ( F ) and...”
• Encystation stimuli sensing is mediated by adenylate cyclase AC2-dependent cAMP signaling in Giardia
  Shih, Nature communications 2023
  • “...cell lines. d h Relative expression levels of GalNAc biosynthesis enzymes ( d ) G6PI-B-NLuc (GL50803_8245), ( e ) GNPNAT-NLuc (GL50803_14259), ( f ) PGM3-NLuc (GL50803_16069), ( g ) UAP-NLuc (GL50803_16217), and ( h ) UAE-NLuc (GL50803_7982) from dCas9-Ctrl and AC2-g4159 knockdown. i , j Representative...”
• A cell-cycle-dependent GARP-like transcriptional repressor regulates the initiation of differentiation in Giardia lamblia
  Shih, Proceedings of the National Academy of Sciences of the United States of America 2022
  • “...P < 0.01. (EG) Relative expression levels of GalNAc enzymes for ( E ) G6PI-B-NLuc (GL50803_8245), ( F ) UAE-NLuc (GL50803_7982), and ( G ) GNPNAT-NLuc (GL50803_14259) in dCas9-Ctrl, MYB2-gRNA669, and GLP4-gRNA362 backgrounds. Data are mean SD from three independent experiments. ** P < 0.001, ****...”
• A Detailed Gene Expression Map of Giardia Encystation
  Rojas-López, Genes 2021
  • “...cyst-wall are highly induced at this stage of encystation (glucose 6-phosphate N-acetyltransferase (GL50803_14259), glucosamine-6-phosphate deaminase (GL50803_8245), phosphoglucosamine mutase (GL50803_16069), UDP-glucose 4-epimerase (GL50803_7982), and UDP-N-acetylglucosamine pyrophosphorylase (GL50803_16217)), at the same time as the cyst wall proteins CWP-1 to -3, and High cysteine non-variant cyst protein HCNP (GL50803_40376,...”
• Characterization of the Giardia intestinalis secretome during interaction with human intestinal epithelial cells: The impact on host cells
  Ma'ayeh, PLoS neglected tropical diseases 2017
  • “...Ribosomal protein L34 GL50803_8942 Hypothetical protein GL50581_3236 CXC-rich protein GL50803_8407 Aminoacyl-histidine dipeptidase GL50581_1034 Protein 21.1 GL50803_8245 Glucosamine-6-phosphate deaminase GL50581_3117 Kinase, NEK GL50803_8064 * PDI5Protein disulfide isomerase GL50581_2562 Ribosomal protein S2 GL50803_7195 Glutamate synthase GL50581_2221 Kinesin like protein GL50803_7082 * Ribosomal protein S21 GL50581_2131 Phosphoenolpyruvate carboxykinase GL50803_6535...”
• The proteome landscape of Giardia lamblia encystation
  Faso, PloS one 2013
  • “...: glucose-6-phosphate isomerase (GL50803_9115), phosphoacetylglucosamine mutase (GL50803_16069), UDP-glucose-4-epimerase (GL50803_7982), UDP-N-acetylglucosamine pyrophosphorylase (GL50803_16217) and glucosamine-6-phosphate deaminase (GL50803_8245), consistent with their induction by encystation [30] . Furthermore, transcript levels for open reading frames (ORF) GL50803_ 5435, 9115, 16069 and 8245 were previously shown to be significantly up-regulated by...”
  • “...GL50803_8172 Dynein heavy chain - 2 3 2 3 3 2 3 - - y GL50803_8245 Glucosamine-6-phosphate deaminase - - - 7 7 13 39 35 - - y GL50803_16069 Phosphoacetylglucosamine mutase - - - - 3 5 5 4 - y y GL50803_40376 High cysteine...”

PADG_00401 glucosamine-6-phosphate deaminase from Paracoccidioides brasiliensis Pb18
51% identity, 50% coverage

• Prediction of Conserved Peptides of Paracoccidioides for Interferon-γ Release Assay: The First Step in the Development of a Lab-Based Approach for Immunological Assessment during Antifungal Therapy
  Rosa, Journal of fungi (Basel, Switzerland) 2020
  • “...100% Glutamate dehydrogenase PADG_04516 0.0 100% 98% Glucan synthase PADG_07373 0.0 97% 100% Glycosamine-6-phosphate deaminase PADG_00401 0.0 100% 97% Hydratase mitochondrial acetones PAAG_00845 0.0 100% 99% Hydroacylgluthatione hydrolase PAAG_02548 0.0 98% 100% 4-Hydroxyfenylpyruvate dioxygenase PAAG_08468 0.0 99% 100% Hexose-6-phosphato epimerase PADG_03243 0.0 98% 100% Hydratase PADG_11845...”
• Differential Metabolism of a Two-Carbon Substrate by Members of the Paracoccidioides Genus
  Baeza, Frontiers in microbiology 2017
  • “...al., 1987 ). In our analysis, only Pb EPM83 showed up-regulation of the enzymes glucosamine-6-phosphate-deaminase (PADG_00401), phosphoacetylglucosamine mutase (PADG_00604), and UDP- N -acetylglucosamine pyrophosphorylase (PADG_04312). These enzymes participate in amino sugar metabolism and cell wall biosynthesis. Phosphoacetylglucosamine mutase reversibly converts N -acetyl-alpha-D-glucosamine-1-phosphate to N -acetyl-D-glucosamine-6-phosphate. The...”

GPI1 / O97439 glucosamine 6-phosphate isomerase 1 (EC 3.5.99.6) from Giardia intestinalis (see 2 papers)
48% identity, 65% coverage

CH_124073 putative glucosamine-6-phosphate deaminase from Magnaporthe grisea 70-15 (see 2 papers)
47% identity, 47% coverage

CNAG_06098 glucosamine-6-phosphate deaminase from Cryptococcus neoformans var. grubii H99
J9VVN4 Glucosamine-6-phosphate isomerase from Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487)
48% identity, 62% coverage

• Quantitative analysis of septin Cdc10 & Cdc3-associated proteome during stress response in the fungal pathogen Cryptococcus neoformans
  Martinez, PloS one 2024
  • “...J9VIY8 CNAG_05122 Homoserine O-acetyltransferase 2.14121765 8.49E-06 5.23E-05 J9VKQ6 CNAG_01314 Vacuolar protein 3.49479807 9.36E-06 5.73E-05 J9VVN4 CNAG_06098 Glucosamine-6-phosphate isomerase 2.3028627 1.09E-05 6.56E-05 J9VMK3 CNAG_00760 Methylenetetrahydrofolate reductase 2.50695428 1.24E-05 7.31E-05 J9VRK0 CNAG_05703 Rho GTPase activator 2.70878731 1.32E-05 7.70E-05 J9VQ08 CNAG_01444 DNA-directed RNA polymerase II subunit RPB4 2.03682439 1.55E-05...”
• Functional Clustering of Metabolically Related Genes Is Conserved across Dikarya
  Cittadino, Journal of fungi (Basel, Switzerland) 2023
  • “...C. neoformans , and the four putative genes necessary for this process have been identified: CNAG_06098 (Nag1), CNAG_06186 (Ngt1), CNAG_06190 (Dac1), and CNAG_06191 (Hxk3) [ 117 ]. These four genes are co-expressed and have been found to cluster together along the genome, with DAC1 and HXK3...”
• Functional Characterization of the GlcNAc Catabolic Pathway in Cryptococcus deneoformans
  Ye, Applied and environmental microbiology 2022 (secret)
• Cryptococcus neoformans can form titan-like cells in vitro in response to multiple signals
  Trevijano-Contador, PLoS pathogens 2018
  • “...0.9 2.2 1.6E-02 CNAG_01239 chitin deacetylase 1.5 3.3 1.9E-02 CNAG_02445 phosphoacetylglucosamine mutase 0.8 2.5 2.5E-02 CNAG_06098 glucosamine-6-phosphate deaminase 0.9 2.1E-02 2.4 6.4E-03 CNAG_06659 hexosaminidase 0.7 6.2 2.4E-06 Intracellular protein transport (p-value: 1.2E-05) COPI and COPII vesicles CNAG_03554 coatomer, subunit ( COP1 , SEC33 , RET1) 0.9...”
  • “...amino sugar metabolism were also induced, including glutamine-fructose-6-phosphate transaminase (CNAG_01164), phosphoacetylglucosamine mutase (CNAG_02445), glucosamine-6-phosphate deaminase (CNAG_06098), and N-acetylglucosamine-6-phosphate deacetylase (CNAG_06098), plus CNAG_02355, coding for a UDP-xylose/UDP-N-acetylglucosamine transporter. The expression of two additional genes related to chitin degradation (CNAG_01239, encoding chitin deacetylase, and CNAG_06659, hexosaminidase), was also...”
• Glucosamine stimulates pheromone-independent dimorphic transition in Cryptococcus neoformans by promoting Crz1 nuclear translocation
  Xu, PLoS genetics 2017
  • “...Among the deletion mutants tested, two genes encoding the glucosamine-6-phosphate deaminase Gnd1 (gene locus # CNAG_06098) and the glucosamine 6-phosphate N-acetyltransferase Gnat1 (gene locus # CNAG_05695) are involved in the hexamine metabolism pathway ( S3A Fig ). The gnd1 mutant was unable to grow in the...”
• A major role for capsule-independent phagocytosis-inhibitory mechanisms in mammalian infection by Cryptococcus neoformans
  Chun, Cell host & microbe 2011
  • “...20.43 CNG0410 putative fatty acid synthase CNAG_04768 CDS_5907 4.14 6.35 CNBJ1500-A Gal4-like DNA binding domain CNAG_06098 CDS_1286 4.09 5.40 CNM0910 glucosamine-6-phosphate CNAG_03122 ND 3.82 772.37 unknown CNAG_06200 CDS_1088 3.70 3.92 CNM1860 PAS domain-containing protein CNAG_06242 CDS_1107 3.56 8.20 CFT1 high-affinity iron permease CNAG_06108 ND 3.40 2.83...”
• Quantitative analysis of septin Cdc10 & Cdc3-associated proteome during stress response in the fungal pathogen Cryptococcus neoformans
  Martinez, PloS one 2024
  • “...5.23E-05 J9VIY8 CNAG_05122 Homoserine O-acetyltransferase 2.14121765 8.49E-06 5.23E-05 J9VKQ6 CNAG_01314 Vacuolar protein 3.49479807 9.36E-06 5.73E-05 J9VVN4 CNAG_06098 Glucosamine-6-phosphate isomerase 2.3028627 1.09E-05 6.56E-05 J9VMK3 CNAG_00760 Methylenetetrahydrofolate reductase 2.50695428 1.24E-05 7.31E-05 J9VRK0 CNAG_05703 Rho GTPase activator 2.70878731 1.32E-05 7.70E-05 J9VQ08 CNAG_01444 DNA-directed RNA polymerase II subunit RPB4 2.03682439...”

D0UPW5 Glucosamine-6-phosphate isomerase (Fragment) from Periplaneta americana
47% identity, 94% coverage

• In Silico Identification of Potential American Cockroach (Periplaneta americana) Allergens
  Ahmed, Iranian journal of public health 2010
  • “...heavy chain (Fragment) D0UQ69 51. Clathrin heavy chain (Fragment) D0UQ18 52. Glucosamine phosphate isomerase (Fragment) D0UPW5 53. GTP-binding protein (Fragment) D0UPR4 54. Syntaxin (Fragment) D0UPE9 55. Spliceosome-associated protein (Fragment) D0UPA1 56. Signal recognition particle (Fragment) D0UP45 57. Pre-mRNA splicing factor (Fragment) D0UNV4 58. Alpha-spectrin (Fragment) D0UND9...”

CNM01050 Glucosamine-6-phosphate isomerase from Cryptococcus neoformans var. neoformans JEC21
48% identity, 52% coverage

• Functional Characterization of the GlcNAc Catabolic Pathway in Cryptococcus deneoformans
  Ye, Applied and environmental microbiology 2022 (secret)

GNPI1_BOVIN / A4FV08 Glucosamine-6-phosphate deaminase 1; GlcN6P deaminase 1; Glucosamine-6-phosphate isomerase 1; Protein oscillin; EC 3.5.99.6 from Bos taurus (Bovine) (see paper)
G1TCQ4 Glucosamine-6-phosphate isomerase from Oryctolagus cuniculus
48% identity, 61% coverage

• function: Catalyzes the reversible conversion of alpha-D-glucosamine 6- phosphate (GlcN-6P) into beta-D-fructose 6-phosphate (Fru-6P) and ammonium ion, a regulatory reaction step in de novo uridine diphosphate-N-acetyl-alpha-D-glucosamine (UDP-GlcNAc) biosynthesis via hexosamine pathway. Deamination is coupled to aldo-keto isomerization mediating the metabolic flux from UDP-GlcNAc toward Fru-6P. At high ammonium level can drive amination and isomerization of Fru-6P toward hexosamines and UDP-GlcNAc synthesis (PubMed:9774701). Has a role in fine tuning the metabolic fluctuations of cytosolic UDP-GlcNAc and their effects on hyaluronan synthesis that occur during tissue remodeling (By similarity). Seems to trigger calcium oscillations in mammalian eggs. These oscillations serve as the essential trigger for egg activation and early development of the embryo (By similarity).
  catalytic activity: alpha-D-glucosamine 6-phosphate + H2O = beta-D-fructose 6- phosphate + NH4(+) (RHEA:12172)
  subunit: Homohexamer.
• Platelet-rich plasma promotes peripheral nerve regeneration after sciatic nerve injury
  Wang, Neural regeneration research 2023
  • “...1 0.691693251 0.003030462 4741433.667 3279617.667 G1SK22 RPS27A 40S ribosomal protein S27a 0.643182234 0.001162964 359093.6667 230962.6667 G1TCQ4 GNPDA1 Glucosamine-6-phosphate isomerase 0.66348163 0.024337241 2147821.333 1425040 G1TED6 ANXA5 Annexin A1 0.695565524 0.026854872 307531498.7 213908308 G1U6B2 ALAD Delta-aminolevulinic acid dehydratase 0.578448676 0.004303236 5921313 3425175.667 P29678 MAP2K1 Dual specificity mitogen-activated protein...”

W5NUG3 Glucosamine-6-phosphate isomerase from Ovis aries
48% identity, 61% coverage

• Comparative Proteomic Identification of Ram Sperm before and after In Vitro Capacitation
  Chen, Animals : an open access journal from MDPI 2024
  • “...43.7 1.792 2.11 10 5 W5Q8X9 PGP 9 25.01 129.770 41.8 1.542 1.98 10 4 W5NUG3 GNPDA1 8 32.56 40.061 33.2 1.513 5.18 10 4 W5Q0A8 GNPDA2 10 31.16 109.880 43.5 1.770 1.34 10 3 W5QFN9 UGP2 15 56.90 158.290 33.9 2.015 8.29 10 5 W5NSS1...”

FPSE_09015 hypothetical protein from Fusarium pseudograminearum CS3096
49% identity, 42% coverage

• Transcriptomic Profiling of Fusarium pseudograminearum in Response to Carbendazim, Pyraclostrobin, Tebuconazole, and Phenamacril
  Zhang, Journal of fungi (Basel, Switzerland) 2023
  • “...( Figure 3 B). Notably, two genes that are related to carbohydrate transport and metabolism, FPSE_09015 (glucosamine-6-phosphate isomerase 1, GNPDA1) and FPSE_09013 (N-acetylglucosamine-6-phosphate deacetylase, AMDHD2 ), were found to have a strong correlation with one another; they had a combined score that was close to 1....”
  • “...PDH1 ), FPSE_05668 (3,4-dihydroxy-2-butanone 4-phosphate synthase, RIB3 ), FPSE_06011 (ZEB2-regulated ABC transporter 1, ZRA1 ), FPSE_09015 (glucosamine-6-phosphate isomerase 1, GNPDA1 ), FPSE_01836 (cystathionine gamma-lyase, CYS3 ), and FPSE_11895 (ABC multidrug transporter, MDR1 ). The bars represent the standard deviations (SD) of the mean. jof-09-00334-t001_Table 1 Table...”

GNPI1_MESAU / Q64422 Glucosamine-6-phosphate deaminase 1; GlcN6P deaminase 1; Glucosamine-6-phosphate isomerase 1; Proetin oscillin; EC 3.5.99.6 from Mesocricetus auratus (Golden hamster) (see paper)
48% identity, 61% coverage

• function: Catalyzes the reversible conversion of alpha-D-glucosamine 6- phosphate (GlcN-6P) into beta-D-fructose 6-phosphate (Fru-6P) and ammonium ion, a regulatory reaction step in de novo uridine diphosphate-N-acetyl-alpha-D-glucosamine (UDP-GlcNAc) biosynthesis via hexosamine pathway. Deamination is coupled to aldo-keto isomerization mediating the metabolic flux from UDP-GlcNAc toward Fru-6P. At high ammonium level can drive amination and isomerization of Fru-6P toward hexosamines and UDP-GlcNAc synthesis (By similarity). Has a role in fine tuning the metabolic fluctuations of cytosolic UDP-GlcNAc and their effects on hyaluronan synthesis that occur during tissue remodeling (By similarity). Seems to trigger calcium oscillations in mammalian eggs. These oscillations serve as the essential trigger for egg activation and early development of the embryo (PubMed:8552195).
  catalytic activity: alpha-D-glucosamine 6-phosphate + H2O = beta-D-fructose 6- phosphate + NH4(+) (RHEA:12172)
  subunit: Homohexamer.
• A salmonid EST genomic study: genes, duplications, phylogeny and microarrays.
  Koop, BMC genomics 2008
  • “...Om/Sf - yes P40926 1.0E-157 Malate dehydrogenase, mito. prec. 70 9 589 - - yes Q64422 1.0E-138 Glucosamine-6-phosphate isomerase 71 13 577 Ss/Sf S/C yes Q58DU5 1.0E-127 Proteasome subunit alpha type-3 72 14 210 - C/T yes Q15008 0.0E+00 26S proteasome non-ATPase reg. sub. 73 12...”

GNPI1_MOUSE / O88958 Glucosamine-6-phosphate deaminase 1; GlcN6P deaminase 1; Glucosamine-6-phosphate isomerase 1; Protein oscillin; EC 3.5.99.6 from Mus musculus (Mouse) (see paper)
48% identity, 61% coverage

• function: Catalyzes the reversible conversion of alpha-D-glucosamine 6- phosphate (GlcN-6P) into beta-D-fructose 6-phosphate (Fru-6P) and ammonium ion, a regulatory reaction step in de novo uridine diphosphate-N-acetyl-alpha-D-glucosamine (UDP-GlcNAc) biosynthesis via hexosamine pathway. Deamination is coupled to aldo-keto isomerization mediating the metabolic flux from UDP-GlcNAc toward Fru-6P. At high ammonium level can drive amination and isomerization of Fru-6P toward hexosamines and UDP-GlcNAc synthesis (By similarity). Has a role in fine tuning the metabolic fluctuations of cytosolic UDP-GlcNAc and their effects on hyaluronan synthesis that occur during tissue remodeling (By similarity). Seems to trigger calcium oscillations in mammalian eggs. These oscillations serve as the essential trigger for egg activation and early development of the embryo (By similarity).
  catalytic activity: alpha-D-glucosamine 6-phosphate + H2O = beta-D-fructose 6- phosphate + NH4(+) (RHEA:12172)
  subunit: Homohexamer.
• Proteotyping of knockout mouse strains reveals sex- and strain-specific signatures in blood plasma
  Mohammed, NPJ systems biology and applications 2021
  • “...catabolic process; myelination Ig heavy chain V region MOPC 47A Gnpda1 tm1b(KOMP)Mbp Gnpda1 (26384) HET O88958 P46926 Glucosamine-6-phosphate isomerase 1 May trigger calcium oscillations in mammalian eggs Acrosome reaction; fructose 6-phosphate metabolic process; fructose biosynthetic process; generation of precursor metabolites and energy; glucosamine catabolic process; glucosamine...”
• Proteomic changes during experimental de- and remyelination in the corpus callosum
  Szilagyi, PloS one 2020
  • “...Arp 2/3 complex subunit 1B 0.691 0.046 0.344 0.409 O08677 Kininogen-1 0.818 0.042 0.302 -0.039 O88958 Glucosamine-6-phosphate isomerase 1 0.614 0.040 0.314 0.374 P11352 Glutathione peroxidase 1 0.500 0.019 0.260 -0.022 P17047 Lysosome-associated glycoprotein 2 0.612 0.006 0.346 0.218 P26039 Talin-1 0.646 0.012 0.396 0.244 Q05816...”
• Novel Insights into the Adipokinome of Obese and Obese/Diabetic Mouse Models.
  Knebel, International journal of molecular sciences 2017
  • “...1,2--mannosidase IA P45700 Man1a1 + Band 4.1-like protein 2 O70318 Epb41l2 + Glucosamine-6-phosphate isomerase 1 O88958 Gnpda1 + -Galactosidase P23780 Glb1 + Semaphorin-7A Q9QUR8 Sema7a + Very long-chain acyl-CoA dehydrogenase, mitochondrial P50544 Acadvl + Inter--trypsin inhibitor heavy chain H1 Q61702 Itih1 + Glutathione S -transferase -1...”
• Sub-Chronic Neuropathological and Biochemical Changes in Mouse Visual System after Repetitive Mild Traumatic Brain Injury.
  Tzekov, PloS one 2016
  • “...0.293 34.00% histone cluster 1, H2bk HIST1H2BK Q8CGP1 22 0.324 38.30% glucosamine-6-phosphate deaminase 1 GNPDA1 O88958 23 0.342 40.80% apolipoprotein E APOE P08226 24 0.372 45.10% Protein inferred from homology A8DUK4 25 0.378 45.90% albumin ALB P07724 26 0.393 48.10% predicted gene , 17669; Protein predicted...”
• Quantitative phosphoproteomics reveals crosstalk between phosphorylation and O-GlcNAc in the DNA damage response pathway.
  Zhong, Proteomics 2015
  • “...Q61543 0.5 Gng12 Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12 Q9DAS9 3.9 Gnpda1 Glucosamine-6-phosphate isomerase 1 O88958 1.8 Ifit1 Interferon-induced protein with tetratricopeptide repeats 1 Q64282 3.7 Igtp Protein Igtp Q9DCE9 8.8 Mt1 Metallothionein-1 P02802 1.8 Parp12 Poly [ADP-ribose] polymerase 12 Q8BZ20 2.6 Serpinc1 Antithrombin-III P32261 0.2...”

GNPI1_HUMAN / P46926 Glucosamine-6-phosphate deaminase 1; GlcN6P deaminase 1; Glucosamine-6-phosphate isomerase 1; Protein oscillin; EC 3.5.99.6 from Homo sapiens (Human) (see 3 papers)
NP_005462 glucosamine-6-phosphate isomerase 1 from Homo sapiens
47% identity, 61% coverage

• function: Catalyzes the reversible conversion of alpha-D-glucosamine 6- phosphate (GlcN-6P) into beta-D-fructose 6-phosphate (Fru-6P) and ammonium ion, a regulatory reaction step in de novo uridine diphosphate-N-acetyl-alpha-D-glucosamine (UDP-GlcNAc) biosynthesis via hexosamine pathway. Deamination is coupled to aldo-keto isomerization mediating the metabolic flux from UDP-GlcNAc toward Fru-6P. At high ammonium level can drive amination and isomerization of Fru-6P toward hexosamines and UDP-GlcNAc synthesis (PubMed:21807125, PubMed:26887390). Has a role in fine tuning the metabolic fluctuations of cytosolic UDP-GlcNAc and their effects on hyaluronan synthesis that occur during tissue remodeling (PubMed:26887390). Seems to trigger calcium oscillations in mammalian eggs. These oscillations serve as the essential trigger for egg activation and early development of the embryo (By similarity).
  catalytic activity: alpha-D-glucosamine 6-phosphate + H2O = beta-D-fructose 6- phosphate + NH4(+) (RHEA:12172)
  subunit: Homohexamer.
• Blood Proteome Profiling Reveals Biomarkers and Pathway Alterations in Fragile X PM at Risk for Developing FXTAS.
  Zafarullah, International journal of molecular sciences 2023
  • “...13.15 0.002466 0.035476 Adenosine deaminase 2 151 P01042 KNG1 0.74 13.86 0.002473 0.035476 Kininogen-1 152 P46926 GNPDA1 0.31 12.92 0.002496 0.035565 Glucosamine-6-phosphate isomerase 1 153 Q9BUQ8 DDX23 0.39 12.96 0.00253 0.03569 Probable ATP-dependent RNA helicase DDX23 154 Q92506 HSD17B8 0.56 13.61 0.002538 0.03569 Estradiol 17-beta-dehydrogenase 8...”
• Haptoglobin Induces a Specific Proteomic Profile and a Mature-Associated Phenotype on Primary Human Monocyte-Derived Dendritic Cells.
  Torres, International journal of molecular sciences 2022
  • “...receptor binding RNF17 Q9BXT8-4 RING finger protein 17 MA Metal ion and protein binding GNPDA1 P46926 Glucosamine-6-phosphate isomerase 1 MA Hydrolase and deaminase activity HLA-B Q04826 HLA class I histocompatibility antigen, B-40 alpha chain MA Peptide antigen and signaling receptor binding DEFA3 P59666 Neutrophil defensin 3...”
• Proteomic Analysis of Estrogen-Mediated Enhancement of Mesenchymal Stem Cell-Induced Angiogenesis In Vivo
  Mihai, Cells 2021
  • “...P08133 annexin A6 1.6495 0.70015 0.00075 P38646 Stress-70 protein, mitochondrial 2.3358 0.81957 3.49 10 12 P46926 glucosaminx10-6-phosphate isomerase 1 2.8277 1.1221 6.49 10 7 O43497 Voltagx10-dependent T-type calcium channel subunit alpha-1G 3.1222 0.95104 1.76 10 7 Q9ULV0 unconventional myosin-Vb 3.1632 1.334 1.91 10 6 Q9NZM1 Myoferlin...”
• Proteotyping of knockout mouse strains reveals sex- and strain-specific signatures in blood plasma.
  Mohammed, NPJ systems biology and applications 2021
  • “...process; myelination Ig heavy chain V region MOPC 47A Gnpda1 tm1b(KOMP)Mbp Gnpda1 (26384) HET O88958 P46926 Glucosamine-6-phosphate isomerase 1 May trigger calcium oscillations in mammalian eggs Acrosome reaction; fructose 6-phosphate metabolic process; fructose biosynthetic process; generation of precursor metabolites and energy; glucosamine catabolic process; glucosamine metabolic...”
• Melanoma Cell Resistance to Vemurafenib Modifies Inter-Cellular Communication Signals.
  Tabolacci, Biomedicines 2021
  • “...TAGLN2 Transgelin-2 SK-MEL-28-VR2 P40967 PMEL Melanocyte protein PMEL SK-MEL-28-VR2 P42785 PRCP Lysosomal Pro-X carboxypeptidase SK-MEL-28-VR2 P46926 GNPDA1 Glucosamine-6-phosphate isomerase 1 SK-MEL-28-VR2 P48637 GSS Glutathione synthetase SK-MEL-28-VR2 P48745 NOV Protein NOV homolog SK-MEL-28-VR2 P49641 MAN2A2 Alpha-mannosidase 2x SK-MEL-28-VR2 P52209 PGD 6-phosphogluconate dehydrogenase, decarboxylating SK-MEL-28-VR2 P54819 AK2 Adenylate...”
• Differential motility parameters and identification of proteomic profiles of human sperm cryopreserved with cryostraw and cryovial.
  Li, Clinical proteomics 2019
  • “...(P0DKB6), MRPS36 (P82909), NDUFA4 (O00483), PHB2 (J3KPX7), VAT1 (Q99536), VDAC3 (Q9Y277) Other CCDC108 (Q6ZU64), GNPDA1 (P46926), MRPS36 (P82909), NAMPT (P43490), PATE1 (Q8WXA2), PATE4 (P0C8F1), PGK1 (P00558), PMFBP1 (Q8TBY8-2), SEPHS1 (P49903), STOM (P27105), TSGA10 (Q9BZW7) Table3 106 differential proteins associated with sperm function Protein ID Protein name...”
• SuperQuant-assisted comparative proteome analysis of glioblastoma subpopulations allows for identification of potential novel therapeutic targets and cell markers
  Verano-Braga, Oncotarget 2018
  • “...Type(s) miR-122 * microRNA 122 Cytoplasm microRNA ALDOA P04075 aldolase, fructose-bisphosphate A Cytoplasm Enzyme GNPDA1 P46926 glucosamine-6-phosphate deaminase 1 Cytoplasm Enzyme GYS1 P13807 glycogen synthase 1 Cytoplasm Enzyme KHDRBS1 Q07666 KH RNA binding domain containing, signal transduction associated 1 Nucleus transcription regulator LAMC1 P11047 laminin subunit...”
• Identification of prostate cancer biomarkers in urinary exosomes
  Øverbye, Oncotarget 2015
  • “...9 1.75 170 21 O60547 GDP-mannose 4.6 dehydratase 2 12 56% 9 2.45 16 22 P46926 Glucosamine-6-phosphate isomerase 1 4 13 56% 9 15.51 44 23 Q14108 Lysosome membrane protein 2 15 16 56% 9 3.94 824 24 Q6NUT3 Major facilitator superfamily domain-containing protein 12 5...”
• More
• Hexosamine biosynthesis in keratinocytes: roles of GFAT and GNPDA enzymes in the maintenance of UDP-GlcNAc content and hyaluronan synthesis.
  Oikari, Glycobiology 2016 (PubMed)
  • GeneRIF: GNPDA1 siRNA induced GFAT2 which was hardly measurable in these cells under standard culture conditions, GNPDA2 siRNA increased GFAT1, and GFAT1 siRNA increased the expression of hyaluronan synthase 2 (HAS2). Silencing of GFAT1 stimulated GNPDA1 and GDPDA2, and inhibited cell migration.
• Allosteric kinetics of the isoform 1 of human glucosamine-6-phosphate deaminase.
  Alvarez-Añorve, Biochimica et biophysica acta 2011 (PubMed)
  • GeneRIF: Allosteric kinetics of the isoform 1 of human glucosamine-6-phosphate deaminase.
• Cloning and functional characterization of GNPI2, a novel human homolog of glucosamine-6-phosphate isomerase/oscillin.
  Zhang, Journal of cellular biochemistry 2003 (PubMed)
  • GeneRIF: identification, chromosomal localization and functional analysis of cDNA encoding GNPI/Oscillin homolog named GNPI2.
• Two mammalian glucosamine-6-phosphate deaminases: a structural and genetic study.
  Arreola, FEBS letters 2003 (PubMed)
  • GeneRIF: Sequence analysis and crystallographic structure of GNP1.

1ne7A / P46926 Human glucosamine-6-phosphate deaminase isomerase at 1.75 a resolution complexed with n-acetyl-glucosamine-6-phosphate and 2-deoxy-2-amino- glucitol-6-phosphate (see paper)
47% identity, 64% coverage

• Ligands: alpha-d-glucopyranose; 2-acetamido-2-deoxy-6-o-phosphono-alpha-d-glucopyranose; 2-deoxy-2-amino glucitol-6-phosphate (1ne7A)

NP_001257810 glucosamine-6-phosphate isomerase 2 isoform 3 from Homo sapiens
47% identity, 85% coverage

• Hexosamine biosynthesis in keratinocytes: roles of GFAT and GNPDA enzymes in the maintenance of UDP-GlcNAc content and hyaluronan synthesis.
  Oikari, Glycobiology 2016 (PubMed)
  • GeneRIF: GNPDA1 siRNA induced GFAT2 which was hardly measurable in these cells under standard culture conditions, GNPDA2 siRNA increased GFAT1, and GFAT1 siRNA increased the expression of hyaluronan synthase 2 (HAS2). Silencing of GFAT1 stimulated GNPDA1 and GDPDA2, and inhibited cell migration.
• MC4R variant is associated with BMI but not response to resistance training in young females.
  Orkunoglu-Suer, Obesity (Silver Spring, Md.) 2011
  • GeneRIF: Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
• Are recently identified genetic variants regulating BMI in the general population associated with anorexia nervosa?
  Brandys, American journal of medical genetics. Part B, Neuropsychiatric genetics : the official publication of the International Society of Psychiatric Genetics 2010 (PubMed)
  • GeneRIF: Observational study of gene-disease association. (HuGE Navigator)
• Cumulative effects and predictive value of common obesity-susceptibility variants identified by genome-wide association studies.
  Li, The American journal of clinical nutrition 2010 (PubMed)
  • GeneRIF: Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
• Obesity genotype score and cardiovascular risk in women with type 2 diabetes mellitus.
  He, Arteriosclerosis, thrombosis, and vascular biology 2010
  • GeneRIF: Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
• Novel obesity risk loci do not determine distribution of body fat depots: a whole-body MRI/MRS study.
  Haupt, Obesity (Silver Spring, Md.) 2010 (PubMed)
  • GeneRIF: Observational study of gene-disease association. (HuGE Navigator)
• Implication of genetic variants near NEGR1, SEC16B, TMEM18, ETV5/DGKG, GNPDA2, LIN7C/BDNF, MTCH2, BCDIN3D/FAIM2, SH2B1, FTO, MC4R, and KCTD15 with obesity and type 2 diabetes in 7705 Chinese.
  Ng, The Journal of clinical endocrinology and metabolism 2010 (PubMed)
  • GeneRIF: Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
• Genetic markers of adult obesity risk are associated with greater early infancy weight gain and growth.
  Elks, PLoS medicine 2010
  • GeneRIF: Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
• More

W5Q0A8 Glucosamine-6-phosphate isomerase from Ovis aries
Q17QL1 Glucosamine-6-phosphate deaminase 2 from Bos taurus
47% identity, 64% coverage

• Comparative Proteomic Identification of Ram Sperm before and after In Vitro Capacitation
  Chen, Animals : an open access journal from MDPI 2024
  • “...41.8 1.542 1.98 10 4 W5NUG3 GNPDA1 8 32.56 40.061 33.2 1.513 5.18 10 4 W5Q0A8 GNPDA2 10 31.16 109.880 43.5 1.770 1.34 10 3 W5QFN9 UGP2 15 56.90 158.290 33.9 2.015 8.29 10 5 W5NSS1 PPP4R1 12 105.74 111.110 17.5 1.805 1.86 10 5 W5NZ60...”
• Changes in serum proteins after endotoxin administration in healthy and choline-treated calves
  Yilmaz, BMC veterinary research 2016
  • “...P80012; von Willebrand factor Fragment/2.98 Q9TTE1; Serpin A3 1/2.09 Q80E01; Glutaredoxin 1/2.21 Q3SZJ0; Argininosuccinate lyase/1.81 Q17QL1; Glucosamine 6 phosphate isomerase 2/2.96 Q3T0Z5; Leukocyte receptor cluster m-1-h/2.22 Q9TTE1; Serpin A3 1/1.74 Q9TTK6; Membrane primary amine oxidase/64.58 A2I7N0; Serpin A3 4/1.47 P41361; Antithrombin III/2.67 P00735; Prothrombin/2.287 P12799; Fibrinogen...”
  • “...Primary amine oxidase lung isozyme/1.74 Q28901; 6-p-2-k-f-2-6-b-f/Infinity Q2M2T2; Uncharacterized protein C19orf71/1.78 A2I7N3; Serpin A3 7/1.56 Q17QL1; Glucosamine 6 phosphate isomerase 2/1.48 A5PJC4; Ubiquitin ISG15 c. e. E2 L6/1.45 Q80E01; Glutaredoxin 1/1.40 Q0VCI2; Syntaxin 19/3.81 Q0V898; Negative elongation factor E/2.4 Q05204; Lysosome associated membrane glycoprotein 1/4.03 Q56K14;...”

NP_001099475 glucosamine-6-phosphate isomerase 2 from Rattus norvegicus
47% identity, 64% coverage

• Expression of new loci associated with obesity in diet-induced obese rats: from genetics to physiology.
  Gutierrez-Aguilar, Obesity (Silver Spring, Md.) 2012 (PubMed)
  • GeneRIF: Long-Evans rats maintained on chow or a high-fat diet (HFD) for 6 weeks. From a total of 19 genes analyzed, seven genes (ETV5, FTO, GNPDA2, KCTD15, TMEM18, MC4R, and SH2B1) were down-regulated in the hypothalamus of HFD compared to chow-fed rats

GNPI2_HUMAN / Q8TDQ7 Glucosamine-6-phosphate deaminase 2; GlcN6P deaminase 2; Glucosamine-6-phosphate isomerase 2; Glucosamine-6-phosphate isomerase SB52; EC 3.5.99.6 from Homo sapiens (Human) (see 2 papers)
Q8TDQ7 glucosamine-6-phosphate deaminase (EC 3.5.99.6) from Homo sapiens (see 2 papers)
47% identity, 64% coverage

• function: Catalyzes the reversible conversion of alpha-D-glucosamine 6- phosphate (GlcN-6P) into beta-D-fructose 6-phosphate (Fru-6P) and ammonium ion, a regulatory reaction step in de novo uridine diphosphate-N-acetyl-alpha-D-glucosamine (UDP-GlcNAc) biosynthesis via hexosamine pathway. Deamination is coupled to aldo-keto isomerization mediating the metabolic flux from UDP-GlcNAc toward Fru-6P. At high ammonium level can drive amination and isomerization of Fru-6P toward hexosamines and UDP-GlcNAc synthesis. Has a role in fine tuning the metabolic fluctuations of cytosolic UDP-GlcNAc and their effects on hyaluronan synthesis that occur during tissue remodeling.
  catalytic activity: alpha-D-glucosamine 6-phosphate + H2O = beta-D-fructose 6- phosphate + NH4(+) (RHEA:12172)
  subunit: Homohexamer.
• Phospholipase A2 regulates autophagy in gouty arthritis: proteomic and metabolomic studies.
  Fu, Journal of translational medicine 2023
  • “...Signal peptide, CUB and EGF-like domain-containing protein 1 SCUBE1 Q8NBS9 Thioredoxin domain-containing protein 5 TXNDC5 Q8TDQ7 Glucosamine-6-phosphate isomerase 2 GNPDA2 Q96MU8 Kremen protein 1 KREMEN1 Q96QR1 Secretoglobin family 3A member 1 SCGB3A1 Q96S96 Phosphatidylethanolamine-binding protein 4 PEBP4 Q99972 Myocilin MYOC Q9BRK3 Matrix remodeling-associated protein 8 MXRA8...”
• Quantitative proteomics reveals protein dysregulation during T cell activation in multiple sclerosis patients compared to healthy controls.
  Cappelletti, Clinical proteomics 2022
  • “...Q7L8W6 Diphthineammonia ligase DPH6 2.61E13 1.49E09 3.301 24.018 1.032 21.159 0.819 7 2 0.253 0.067 Q8TDQ7 Glucosamine-6-phosphate isomerase 2 GNPDA2 2.21E09 6.31E06 1.851 25.017 0.660 26.798 0.817 64 12 0.156 0.384 Q9UKU7 Isobutyryl-CoA dehydrogenase, mitochondrial ACAD8 6.47E09 1.23E05 1.028 26.741 0.283 25.805 0.501 37 11 0.174...”
• The benefit of combining curcumin, bromelain and harpagophytum to reduce inflammation in osteoarthritic synovial cells
  Brochard, BMC complementary medicine and therapies 2021
  • “...0 1 2 false Q5JRX3 0.55 PITRM1 Presequence protease mitochondrial false 2 3 2 false Q8TDQ7 0.55 GNPDA2 Glucamine-6-phphate isomerase 2 false 0 1 1 false P34932 0.56 HSPA4 Heat shock 70kDa protein 4 false 0 2 39 false Q15691 0.56 MAPRE1 Microtubule-associated protein RP/EB family...”
• Quantitative proteomic analyses of CD4+ and CD8+ T cells reveal differentially expressed proteins in multiple sclerosis patients and healthy controls.
  Berge, Clinical proteomics 2019
  • “...Glycogen debranching enzyme; 4-alpha-glucanotransferase; amylo-alpha-1,6-glucosidase AGL 0.010066 0.4633 21.956 0.26486 21.7305 0.29541 20.9 22 0.8 Q8TDQ7 Glucosamine-6-phosphate isomerase 2 GNPDA2 0.010164 0.2255 23.3542 0.28146 23.8593 0.21281 59.8 10 0.84 P16615 Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 ATP2A2 0.010248 0.5051 24.5083 0.30171 24.3585 0.32708 28.7 21 0.81 Q13555;...”
• Multiplexed, Quantitative Workflow for Sensitive Biomarker Discovery in Plasma Yields Novel Candidates for Early Myocardial Injury.
  Keshishian, Molecular & cellular proteomics : MCP 2015
• A framework for application of metabolic modeling in yeast to predict the effects of nsSNV in human orthologs.
  Dingerdissen, Biology direct 2014
  • “...CID: 10663 Malonyl-[acyl-carrier-protein] SID: 4431 Q8N5D6 y x 121 Globoside SID: 124490726 IV3GalNAca-Gb4Cer SID: 124490727 Q8TDQ7 p s 182 D-glucosamine phosphate CID: 440997 Beta-D-fructose 6-phosphate CID: 440641 Q96C23 r x 82 Alpha-D-glucose CID: 79025 Beta-D-glucose CID: 64689 Q96GX9 g r 47 S-methyl-5-thio-D-ribulose 1-phosphate CID: 174549 5-(methylthio)-2,3-dioxopenyl...”

U5LXR4 glucosamine-6-phosphate deaminase (EC 3.5.99.6) from Gallus gallus (see paper)
47% identity, 86% coverage

E1C878 glucosamine-6-phosphate deaminase (EC 3.5.99.6) from Gallus gallus (see paper)
47% identity, 64% coverage

LINJ_32_3460 putative glucosamine-6-phosphate isomerase from Leishmania infantum JPCM5
A4I8F1 Glucosamine-6-phosphate isomerase from Leishmania infantum
47% identity, 65% coverage

• Unravelling the proteomic signature of extracellular vesicles released by drug-resistant Leishmania infantum parasites
  Douanne, PLoS neglected tropical diseases 2020
  • “...5.3 no no (0.436) no 52 LINJ_34_0010 Uncharacterized protein 5.3 no yes (0.738) no 53 LINJ_32_3460 Glucosamine-6-phosphate isomerase 5.0 no yes (0.835) no 54 LINJ_36_6080 Nitroreductase family putative 5.0 no no (0.511) no 55 LINJ_36_7280 Protein disulfide-isomerase 5.0 no 0.649, but prediction of a peptide signal...”
• Comparative proteomic analysis of Leishmania parasites isolated from visceral and cutaneous leishmaniasis patients
  Dinç, Parasitology 2022
  • “...Q25299 Hypothetical protein conserved (ORF2) 27 A4I8F1 Glucosamine-6-phosphate isomerase 28 A4HYZ8 Putative soluble n-ethylmaleimide sensitive factor (SNAP...”

BB0152 glucosamine-6-phosphate isomerase (nagB) from Borrelia burgdorferi B31
53% identity, 67% coverage

• Analysis of the BadR regulon in Borrelia burgdorferi
  George, BMC microbiology 2025 (no snippet)
• Borrelia host adaptation Regulator (BadR) regulates rpoS to modulate host adaptation and virulence factors in Borrelia burgdorferi
  Miller, Molecular microbiology 2013
  • “...displayed opposing trends to the levels of NagC-regulated, GlcNAc catabolic enzymes, NagA (BB0151) and NagB (BB0152), which showed elevated levels under fed-tick growth conditions. Chitobiose transporter subunit, ChbA (BBB05), regulated by both NagC and Mlc in other bacteria, was not preferentially expressed in either host condition....”
  • “...pCLM65 BB0693N253A/P255A cloned into pMALc2x This study pMP2 BB0151 cloned into pET23a This study pMP3 BB0152 cloned into pET23a This study pCLM22 BB0645 cloned into pET23a This study pTS2 BBB05 cloned into pET23a This study pBVSR2713 BB0831 cloned into pET23a This study pMP4 BB0545 cloned into...”
• The diguanylate cyclase, Rrp1, regulates critical steps in the enzootic cycle of the Lyme disease spirochetes
  Kostick, Molecular microbiology 2011
  • “...0.2941 0.0536 0.4964 0.0996 BB0151 N-acetylglucosamine-6-phosphate deaminase ( nagA ) IM 0.4611 0.0029 0.8787 0.2872 BB0152 glucosamine-6-phosphate isomerase ( nagB ) IM 0.3320 0.0176 0.4331 0.0319 BB0645 PTS system, glucose- specific IIBC component ( ptsG ) TP 0.4444 0.0921 0.5196 0.1137 a As published in TIGR...”
• Borrelia burgdorferi requires glycerol for maximum fitness during the tick phase of the enzootic cycle
  Pappas, PLoS pathogens 2011
  • “...of a chitobiose transporter (BBB04-BBB06), a putative chitobiase (BB0002) and NagA and NagB (BB0151 and BB0152). In combination, the actions of these gene products would result in production of glucose 6-phosphate that could enter the glycolytic pathway ( Figure 1 ). Both chitobiose and chitin can...”
• Rrp1, a cyclic-di-GMP-producing response regulator, is an important regulator of Borrelia burgdorferi core cellular functions
  Rogers, Molecular microbiology 2009
  • “.... These include N -acetylglucosamine-6-phosphate deacetylase ( nagA ; BB0151), glucosamine-6-phosphate isomerase ( nagB ; BB0152), glycerol kinase ( glpK ; BB0241), glycerol-3-phosphate dehydrogenase ( glpA ; BB0243), mannose-6-phosphate isomerase ( manA ; BB0407), phosphate acetyltransferase ( pta ; BB0589), beta-glucosidase (BB0620), 1-phosphofructokinase ( fruK ;...”
  • “...BB0151 N -acetylglucosamine-6-phosphate deacetylase ( nagA ) IM 12.3 0.0163 Narasimhan et al . (2002) BB0152 glucosamine-6-phosphate isomerase ( nagB ) IM 66.7 0.0260 Brooks et al . (2003) BB0153 superoxide dismutase ( sodA ) X 129 0.0484 Hyde et al . (2006) BB0156 hypothetical protein...”
• BosR (BB0647) governs virulence expression in Borrelia burgdorferi
  Ouyang, Molecular microbiology 2009
  • “...dfp , encodes a pantothenate metabolism flavoprotein), bb0730 ( pgi , encodes a glucose-6-phosphate isomerase), bb0152 ( nagB , encodes a glucosamine-6-phosphate isomerase), and oligopeptide ABC transporter encoding genes bb0333 (oppC-1 ) and bb0335 ( oppF ). BosR controls the expression of OspC and DbpA in...”
• Global analysis of Borrelia burgdorferi genes regulated by mammalian host-specific signals
  Brooks, Infection and immunity 2003
  • “...2017 by University of California, Berkeley BB0147 (flaB) BB0152 BB0232 BB0237 BB0240 BB0242 BB0248 BB0362 BB0469 BB0565 BB0690 BB0757 BBA15 (ospA) BBA16 (ospB)...”
  • “...garinii]) BBA59 (lipoprotein [B. burgdorferi]) BB0152 (glucosamine-6-phosphate isomerase [nagB] [Haemophilus influenzae]) BBA40 (hypothetical protein) BBA39...”
• Comparative genome analysis of the pathogenic spirochetes Borrelia burgdorferi and Treponema pallidum
  Subramanian, Infection and immunity 2000
  • “...and/or as an energy source (glucosamine deaminase, NagB; BB0152) could represent an adaptation of B. burgdorferi for survival in its specific niche, in this...”

3hn6A / O30564 Crystal structure of glucosamine-6-phosphate deaminase from borrelia burgdorferi
53% identity, 66% coverage

• Ligand: pyrophosphate 2- (3hn6A)

D0AAS0 Glucosamine-6-phosphate isomerase from Trypanosoma brucei gambiense (strain MHOM/CI/86/DAL972)
46% identity, 65% coverage

• Evidence that intracellular stages of Leishmania major utilize amino sugars as a major carbon source.
  Naderer, PLoS pathogens 2010
  • “...of GND. GND protein sequences of L. major (UniProt: Q4Q4U6), T. cruzi (Q4D0F2), T. brucei (D0AAS0), E. coli (B7LKT5), Y. pestis (A4TNY0), H. sapiens (P46926) and C. albicans (Q04802) were aligned with ClustalW and edited with Boxshade, whereby identical or similar residues are boxed in black...”

Q4Q4U6 Glucosamine-6-phosphate isomerase from Leishmania major
45% identity, 65% coverage

• Evidence that intracellular stages of Leishmania major utilize amino sugars as a major carbon source
  Naderer, PLoS pathogens 2010
  • “...Supporting Information Figure S1 Sequence alignment of GND. GND protein sequences of L. major (UniProt: Q4Q4U6), T. cruzi (Q4D0F2), T. brucei (D0AAS0), E. coli (B7LKT5), Y. pestis (A4TNY0), H. sapiens (P46926) and C. albicans (Q04802) were aligned with ClustalW and edited with Boxshade, whereby identical or...”

GAMA_BACSU / O31458 Glucosamine-6-phosphate deaminase 2; GlcN6P deaminase 2; GNPDA 2; Glucosamine-6-phosphate isomerase 2; EC 3.5.99.6 from Bacillus subtilis (strain 168) (see 3 papers)
BSU02360 glucosamine-6-phosphate isomerase from Bacillus subtilis subsp. subtilis str. 168
44% identity, 72% coverage

• function: Catalyzes the reversible isomerization-deamination of glucosamine 6-phosphate (GlcN6P) to form fructose 6-phosphate (Fru6P) and ammonium ion (By similarity). Required for growth on glucosamine and also provides the majority of GlcN6P deaminase activity during growth on N-acetylglucosamine (GlcNAc) (PubMed:23667565).
  catalytic activity: alpha-D-glucosamine 6-phosphate + H2O = beta-D-fructose 6- phosphate + NH4(+) (RHEA:12172)
  disruption phenotype: Deletion of the gene prevents nearly all growth on glucosamine and severely reduces growth on N-acetylglucosamine (PubMed:23667565). The gamA-nagB double mutant cannot grow on glucosamine or N-acetylglucosamine (PubMed:23667565).
• rocF affects the production of tetramethylpyrazine in fermented soybeans with Bacillus subtilis BJ3-2
  Liu, BMC biotechnology 2022
  • “...Up BSU00840 153.025 433.769 1.5 4.94E-04 1.98E-02 Up BSU37460 22.934 64.67 1.49 7.93E-04 2.86E-02 Up BSU02360 243.519 638.924 1.39 7.36E-04 2.77E-02 Up BSU40950 51.79 134.426 1.37 1.30E-03 4.18E-02 Up BSU02350 68.903 174.218 1.34 9.74E-04 3.42E-02 Up BSU31050 64.173 161.213 1.33 1.13E-03 3.79E-02 Up BSU11220 71.588 176.107...”

Q4D0F2 Glucosamine-6-phosphate isomerase from Trypanosoma cruzi (strain CL Brener)
XP_807857 glucosamine-6-phosphate isomerase, putative from Trypanosoma cruzi
44% identity, 65% coverage

• Evidence that intracellular stages of Leishmania major utilize amino sugars as a major carbon source.
  Naderer, PLoS pathogens 2010
  • “...S1 Sequence alignment of GND. GND protein sequences of L. major (UniProt: Q4Q4U6), T. cruzi (Q4D0F2), T. brucei (D0AAS0), E. coli (B7LKT5), Y. pestis (A4TNY0), H. sapiens (P46926) and C. albicans (Q04802) were aligned with ClustalW and edited with Boxshade, whereby identical or similar residues are...”
• Subcellular proteomics of Trypanosoma cruzi reservosomes
  Sant'Anna, Proteomics 2009
  • “...Lectin XP_807732 Mannose binding N 74 Glucokinase 1 XP_821474 Glucokinase activity N 75 Glucosamine-6-phosphate isomerase XP_807857 N-acetylglucosamine catabolic process N (8) Cell signaling 76 Protein kinase XP_807538 Protein amino acid phosphorilation N 77 Protein tyrosine phosphatase XP_816679 Protein tyrosine phosphatase activator factor N 78 Serine/threonine protein...”

VDAG_05573 glucosamine-6-phosphate isomerase from Verticillium dahliae VdLs.17
46% identity, 48% coverage

• <i>VdPAT1</i> encoding a pantothenate transporter protein is required for fungal growth, mycelial penetration and pathogenicity of <i>Verticillium dahliae</i>
  Kamau, Frontiers in microbiology 2024
  • “...synthesis, including VIB-1 protein (VDAG_01460), glucokinase (VDAG_01913), NRS/ER (VDAG_06010), -xylosidase (VDAG_09302), N-acetylglucosamine-6-phosphate-deacetylase (VDAG_05575), glucosamine-6-phosphate deaminase (VDAG_05573) and -L-arabinofuranosidase (VDAG_04336) genes ( Figures 7C , D ). Figure 7 Heatmaps of DEGs related to chitin synthesis and degradation and UDP glucose synthesis. (A) A simple diagram showing...”

BH0420 N-acetylglucosamine-6-phosphate isomerase from Bacillus halodurans C-125
44% identity, 71% coverage

• Periplasmic flagellar export apparatus protein, FliH, is involved in post-transcriptional regulation of FlaB, motility and virulence of the relapsing fever spirochete Borrelia hermsii
  Guyard, PloS one 2013
  • “...polymorphisms (SNP) were also detected in the mutant. One (A to G) was found in BH0420 (sensory transduction protein kinase) in position 437073 bp of the reference chromosome with a predicted amino acid change of L to S. The second SNP (A to C) was identified...”

GJQ69_02440 glucosamine-6-phosphate deaminase from Caproicibacterium lactatifermentans
42% identity, 70% coverage

• Revealing the Characteristics of Glucose- and Lactate-Based Chain Elongation for Caproate Production by Caproicibacterium lactatifermentans through Transcriptomic, Bioenergetic, and Regulatory Analyses
  Wang, mSystems 2022
  • “...respectively ( Data set S1 ). In addition, nagA (GJQ69_02445) encoding GlcNAc-6-P deacetylase and nagB (GJQ69_02440) encoding GlcN-6-P deaminase, showed slightly increased expression ( Data set S1 ). GlcNAc-6-P deacetylase is required for catabolism of N -acetylglucosamine (GlcNAc) into acetate, and GlcN-6-P deaminase is required for...”

CD630_10110, CDIF630erm_01147 glucosamine-6-phosphate deaminase from Clostridioides difficile
44% identity, 71% coverage

• Proteomic Adaptation of Clostridioides difficile to Treatment with the Antimicrobial Peptide Nisin
  Maaß, Cells 2021
  • “...lipid II-targeting antimicrobials. On the other hand, it was found recently, that glucosamine-6-phosphate deaminase NagB (CDIF630erm_01147), glucose-6-phosphate isomerase Pgi (CDIF630erm_03585), both providing precursors for cell wall biosynthesis, and the peptidyl-prolyl cis-trans isomerase B PpiB (CDIF630erm_00459) involved in protein homeostasis of the cell envelope, exhibit a higher...”
• Iron Regulation in Clostridioides difficile
  Berges, Frontiers in microbiology 2018
  • “...family transcriptional regulator -3.62 -2.36 CD630_10100 CDIF630erm_01146 nagA N -acetylglucosamine-6-phosphate deacetylase -2.69 -2.60 -2.02 -0.22 CD630_10110 CDIF630erm_01147 nagB Glucosamine-6-phosphate deaminase -2.74 1.69 -1.74 0.19 Energy metabolism CD630_32370 CDIF630erm_03533 prdF Proline racemase 3.03 -1.48 4.04 -1.14 CD630_32380 CDIF630erm_03534 Proline reductase PrdE-like protein 4.31 4.34 CD630_32390 CDIF630erm_03535 prdE...”
  • “...transcriptional regulator -3.62 -2.36 CD630_10100 CDIF630erm_01146 nagA N -acetylglucosamine-6-phosphate deacetylase -2.69 -2.60 -2.02 -0.22 CD630_10110 CDIF630erm_01147 nagB Glucosamine-6-phosphate deaminase -2.74 1.69 -1.74 0.19 Energy metabolism CD630_32370 CDIF630erm_03533 prdF Proline racemase 3.03 -1.48 4.04 -1.14 CD630_32380 CDIF630erm_03534 Proline reductase PrdE-like protein 4.31 4.34 CD630_32390 CDIF630erm_03535 prdE Proline...”

CPF_2744 glucosamine-6-phosphate isomerase from Clostridium perfringens ATCC 13124
40% identity, 74% coverage

• Molecular identification of hyaluronate lyase, not hyaluronidase, as an intrinsic hyaluronan-degrading enzyme in Clostridium perfringens strain ATCC 13124
  Kumon, Scientific reports 2024
  • “...amino sugars was also investigated (Fig. 3 c). The expression level (fold change) of nagB (CPF_2744) for glucosamine-6-phosphate deaminase and CPF_1718 for phosphofructokinase family protein responsible for metabolism of amino sugar into glycolysis, were up-regulated in the presence of hyaluronan, whereas glmS (CPF_2636) for fructose-6-phosphate aminotransferase...”

NAGB_BACSU / O35000 Glucosamine-6-phosphate deaminase 1; GlcN6P deaminase 1; GNPDA 1; Glucosamine-6-phosphate isomerase 1; EC 3.5.99.6 from Bacillus subtilis (strain 168) (see 3 papers)
O35000 glucosamine-6-phosphate deaminase (EC 3.5.99.6) from Bacillus subtilis (see paper)
2bkvB / O35000 Structure and kinetics of a monomeric glucosamine-6-phosphate deaminase: missing link of the nagb superfamily (see paper)
NP_391382 glucosamine-6-phosphate isomerase from Bacillus subtilis subsp. subtilis str. 168
42% identity, 74% coverage

• function: Catalyzes the reversible isomerization-deamination of glucosamine 6-phosphate (GlcN6P) to form fructose 6-phosphate (Fru6P) and ammonium ion.
  catalytic activity: alpha-D-glucosamine 6-phosphate + H2O = beta-D-fructose 6- phosphate + NH4(+) (RHEA:12172)
  subunit: Monomer.
  disruption phenotype: Deletion of the gene has essentially no effect on growth on either glucosamine or N-acetylglucosamine (PubMed:23667565). The gamA-nagB double mutant cannot grow on glucosamine or N- acetylglucosamine (PubMed:23667565).
• Ligand: 2-phosphoglycolic acid (2bkvB)
• Structure and kinetics of a monomeric glucosamine 6-phosphate deaminase: missing link of the NagB superfamily?
  Vincent, The Journal of biological chemistry 2005 (PubMed)
  • GeneRIF: three-dimensional structure and kinetics

LSA0417 Glucosamine-6-phosphate deaminase from Lactobacillus sakei subsp. sakei 23K
44% identity, 77% coverage

• Catabolism of N-acetylneuraminic acid, a fitness function of the food-borne lactic acid bacterium Lactobacillus sakei, involves two newly characterized proteins
  Anba-Mondoloni, Applied and environmental microbiology 2013
  • “...and two loci comprising nagA (lsa1588) and nagB (lsa0417) genes, located elsewhere on the chromosome. Neither the genes putatively involved in NANA...”

LGG_02913 glucosamine-6-phosphate deaminase / glucosamine-6-phosphate isomerase (GNPDA), GlcN6P deaminase from Lactobacillus rhamnosus GG
43% identity, 75% coverage

• Proteomics and transcriptomics characterization of bile stress response in probiotic Lactobacillus rhamnosus GG
  Koskenniemi, Molecular & cellular proteomics : MCP 2011
  • “...No. of peptides matchedd LGG_00031 LGG_00238 LGG_02913 LGG_00534 LGG_00914 LGG_01820 LGG_00984 LGG_02239 LGG_01295 LGG_01367 LGG_01478 LGG_01652 LGG_01820...”
  • “...10.1074/mcp.M110.002741-12 Carbohydrate Metabolism--Gene nagB (LGG_02913) encoding glucosamine-6-phosphate deaminase/isomerase, which is involved in glucosamine...”

RBAM_RS16295 glucosamine-6-phosphate deaminase from Bacillus velezensis FZB42
41% identity, 73% coverage

• Key Impact of an Uncommon Plasmid on Bacillus amyloliquefaciens subsp. plantarum S499 Developmental Traits and Lipopeptide Production
  Molinatto, Frontiers in microbiology 2017
  • “...Elongation factor P 98 epsA-O AS588_RS15840-AS588_RS15910 RBAM_RS15740-RBAM_RS15810 Operon for capsular polysaccharides biosynthesis 9698 degU AS588_RS16430 RBAM_RS16295 Two-component response regulator 99 fla-che AS588_RS07105-AS588_RS07250 RBAM_RS07995-RBAM_RS08140 Operon for flagellar synthesis and chemotaxis 9899 lytS AS588_RS02230 RBAM_RS12940 Sensor histidine kinase 98 motA AS588_RS08495 RBAM_RS06710 Flagellar motor rotation protein 98 motB...”

lp_0226 glucosamine-6-phosphate isomerase from Lactobacillus plantarum WCFS1
41% identity, 76% coverage

• Response of Lactobacillus plantarum WCFS1 to the Gram-Negative Pathogen-Associated Quorum Sensing Molecule N-3-Oxododecanoyl Homoserine Lactone
  Spangler, Frontiers in microbiology 2019
  • “...lp_2384, ldhL1 or lp_0537, and pta or lp_0807), 2 at 4 h ( nagB or lp_0226, and ldhL2 or lp_1101), and 1 at 7 h ( acdH or lp_0329). The genes upregulated at 1 h and 4 h are involved in carbohydrate metabolism, while acdH encodes...”

LSEI_2889 glucosamine-6-phosphate deaminase from Lacticaseibacillus paracasei ATCC 334
LSEI_2889 Glucosamine-6-phosphate isomerase from Lactobacillus casei ATCC 334
43% identity, 77% coverage

• Regulatory Mechanisms of L-Lactic Acid and Taste Substances in Chinese Acid Rice Soup (Rice-Acid) Fermented With a Lacticaseibacillus paracasei and Kluyveromyces marxianus
  Liu, Frontiers in microbiology 2021
  • “...components (LSEI_0401 and LSEI_0561), phosphoglucomutase (LSEI_0949), glutamine-fructose-6-phosphate transaminase (LSEI_1019), UTPglucose-1-phosphate uridylyltransferase (LSEI_1093), and glucosamine-6-phosphate deaminase (LSEI_2889). We further confirmed 17 key DEGs at corresponding positions of starch and sucrose metabolism. The comparison results of different fermentation times (3 and 1 days) confirmed 11 up-regulated genes and...”

HR078_10525 glucosamine-6-phosphate deaminase from Lactobacillus delbrueckii subsp. lactis
42% identity, 76% coverage

• Probiogenomics of Lactobacillus delbrueckii subsp. lactis CIDCA 133: In Silico, In Vitro, and In Vivo Approaches
  de, Microorganisms 2021
  • “...ATP-dependent ClpX protease Acid HR078_00335 ark Aldo/keto reductase Osmotic HR078_09455 glpF Aquaporin family protein Osmotic HR078_10525 nagB Glucosamine-6-phosphate deaminase Biliar HR078_01470 pyrG CTP synthase Biliar HR078_09705 pepF Oligoendopeptidase F Biliar HR078_04350 cbh Choloylglycine hydrolase family protein Biliar HR078_07785 groel chaperonin GroEL Heat HR078_06405 hcrA Heat-inducible transcription...”

A4X018 Glucosamine-6-phosphate deaminase from Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
42% identity, 68% coverage

• HIV/SIV DNA vaccine combined with protein in a co-immunization protocol elicits highest humoral responses to envelope in mice and macaques.
  Li, Vaccine 2013
  • “...<20 29 <20 <20 2 DNA&BaLgp120 (100g) A6X013 31 <20 22 20 61 <20 <20 A4X018 <20 <20 <20 <20 36 <20 <20 A4X010 64 <20 35 48 160 26 30 3 DNA&BaLgp120 (100g) in EM-005 A4E056 398 98 83 147 498 49 35 A4E055 65...”

LBCZ_2712 glucosamine-6-phosphate deaminase from Lacticaseibacillus casei DSM 20011 = JCM 1134 = ATCC 393
41% identity, 77% coverage

• Function and Structure of Lacticaseibacillus casei GH35 β-Galactosidase LBCZ_0230 with High Hydrolytic Activity to Lacto-N-biose I and Galacto-N-biose
  Saburi, Journal of applied glycoscience 2023
  • “...6-phosphate is presumably converted to D-fructose 6-phosphate by glucosamine 6-phosphate isomerase (EC 3.5.99.6), encoded by LBCZ_2712 , for the metabolism through the glycolysis. D-Galactose is predicted to be metabolized to -D-glucose 1-phosphate through the Leloir pathway, involving galactokinase (EC 2.7.1.6; LBCZ_0451), UDP-glucose-hexose-1-phosphate uridylyltransferase (EC 2.7.7.12; LBCZ_0453),...”

LMRG_02056 glucosamine-6-phosphate isomerase from Listeria monocytogenes 10403S
OCPFDLNE_01017 glucosamine-6-phosphate deaminase from Listeria monocytogenes
42% identity, 76% coverage

• Home Alone: Elimination of All but One Alternative Sigma Factor in Listeria monocytogenes Allows Prediction of New Roles for σ^B
  Liu, Frontiers in microbiology 2017
  • “...No 18 LMRG_02028 A , B srtA , DE fragments identified in 5'UTR 19 LMRG_02055, LMRG_02056 LMRG_02057 B , A frag 38333 nagA and nagB operon. Two NagR attenuatormotives were identified suggesting co-regulation with NagR 20 LMRG_02215, LMRG_02216 LMRG_02217 A , B LMRG_02217 21 LMRG_02219 LMRG_02218...”
• High-pressure processing-induced transcriptome response during recovery of Listeria monocytogenes
  Duru, BMC genomics 2021
  • “...(Fig. 3 f and 4 f). Upregulation of nagA (OCPFDLNE_01016) and two separate nagB genes (OCPFDLNE_01017 and OCPFDLNE_02454) was observed in RO15 at all time points. Similarly, ScottA showed upregulation of the nagA (LMOSA_18460) and nagB (LMOSA_18470) homologues at early time points. However, the second nagB...”

BTF1_18585 glucosamine-6-phosphate deaminase from Bacillus thuringiensis HD-789
38% identity, 69% coverage

• NagR_Bt Is a Pleiotropic and Dual Transcriptional Regulator in Bacillus thuringiensis
  Cao, Frontiers in microbiology 2018
  • “.../ / 6.284 NT BTF1_18560 ptsH Phosphocarrier protein HPr 52 agttgtatagacgtga 9.82 6.395 4.716 0.299 BTF1_18585 nagB Glucosamine-6-phosphate deaminase / / / 11.365 NT BTF1_18590 nagA N-acetylglucosamine-6-phosphate deacetylase 90 gcacgagtagttgtct 8.05 21.012 36.413 1.955 BTF1_19070 Hypothetical protein 78 acatgtcaagacaact 9.82 ND NT BTF1_19250 Hypothetical protein /...”
  • “...outer surface protein; BTF1_11665, lpmo ; BTF1_16665, chiA ; BTF1_18555, ptsI ; BTF1_18560, ptsH ; BTF1_18585, nagB ; BTF1_18590, nagA ; BTF1_19070, hypothetical protein; BTF1_24980, crr ; BTF1_28050, chiB ; BTF1_19025, hypothetical protein; BTF1_23020, pgi ; BTF1_00745, lytR family protein; BTF1_01335, peptidase; BTF1_02575, major facilitator superfamily...”

Q8Y8E7 Glucosamine-6-phosphate deaminase from Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
lmo0957 similar to glucosamine-6-Phoasphate isomerase (EC 5.3.1.10) from Listeria monocytogenes EGD-e
42% identity, 76% coverage

• Proteomic dataset of Listeria monocytogenes exposed to sublethal concentrations of free and nanoencapsulated nisin
  Pinilla, Data in brief 2022
  • “...UPF0356 family Q8YAR2 lmo0053 rplI LNis 50S ribosomal protein L9; binds to the 23S rRNA Q8Y8E7 lmo0957 nagB LNis Glucosamine-6-phosphate isomerase; catalyzes the reversible isomerization-deamination of glucosamine 6-phosphate to form fructose 6-phosphate and ammonium ion Q8Y6S4 lmo1609 lmo1609 LNis Annotation not available P0A4L3 lmo1233 trxA LNis...”
• Integrative analysis of transcriptomic and immunoproteomic data reveals stress response mechanisms in <i>Listeria monocytogenes</i>
  D'Onofrio, Heliyon 2024
  • “...cell wall integrity, and sensitivity to antibiotics. Lmo0956 is part of operon 150, along with lmo0957 and lmo0958 , which are involved in amino-sugar metabolism. Mutational analysis of lmo0956 revealed its significance in bacterial physiology and virulence, suggesting it as a potential target for anti-listerial drug...”
• Proteomic dataset of Listeria monocytogenes exposed to sublethal concentrations of free and nanoencapsulated nisin
  Pinilla, Data in brief 2022
  • “...family Q8YAR2 lmo0053 rplI LNis 50S ribosomal protein L9; binds to the 23S rRNA Q8Y8E7 lmo0957 nagB LNis Glucosamine-6-phosphate isomerase; catalyzes the reversible isomerization-deamination of glucosamine 6-phosphate to form fructose 6-phosphate and ammonium ion Q8Y6S4 lmo1609 lmo1609 LNis Annotation not available P0A4L3 lmo1233 trxA LNis Component...”
• Colonisation dynamics of Listeria monocytogenes strains isolated from food production environments
  Gray, Scientific reports 2021
  • “...A118] fig|1639.4014.peg.468 5.43 V Type VII secretion protein EsaA Amino sugar and nucleotide sugar metabolism lmo0957 fig|1639.4014.peg.2911 3.89 nagB G Glucosamine-6-phosphate deaminase 3.5.99.6 7453 48h lmo0956 fig|1639.4014.peg.2912 3.55 nagA G N-acetylglucosamine-6-phosphate deacetylase 3.5.1.25 lmo0096 fig|1639.4014.peg.505 3.03 G PTS system mannost-specific transporter subunits IIAB 2.7.1.191 lmo0097 fig|1639.4014.peg.506...”
• N-acetylglucosamine-6-phosphate deacetylase (NagA) of Listeria monocytogenes EGD, an essential enzyme for the metabolism and recycling of amino sugars
  Popowska, Archives of microbiology 2012
  • “...peptide antibiotic, colistin. The gene products of operon 150, consisting of three genes: lmo0956 , lmo0957, and lmo0958 , are necessary for the cytosolic steps of the amino-sugar-recycling pathway. The cytoplasmic de- N -acetylase Lmo0956 of L. monocytogenes is required for cell wall peptidoglycan and teichoic...”
  • “...for the synthesis of UDP-GlcNAc. Alternatively, GlcN-6-P can be converted to fructose-6-P by NagB ( lmo0957 ). In gram-negative bacteria like E. coli this step is also important in lipopolysaccharide synthesis and cell wall amino-sugar recycling: (GlcN-6-P and 1,6-anhydro- N -acetyl-muramic acid-anhMurNAc). The enzyme responsible for...”
• Listeria monocytogenes {sigma}B has a small core regulon and a conserved role in virulence but makes differential contributions to stress tolerance across a diverse collection of strains
  Oliver, Applied and environmental microbiology 2010
  • “...lmo0880 lmo0896 lmo0911 lmo0913 lmo0937 lmo0953 lmo0956 lmo0957 lmo0994 lmo1140 lmo1241 lmo1295 lmo1375 lmo1425 lmo1428 lmo1433 lmo1602 lmo1605 lmo1606 lmo1694...”
• Temporal transcriptomic analysis of the Listeria monocytogenes EGD-e sigmaB regulon
  Hain, BMC microbiology 2008
  • “...mutase ( lmo2205 ). Furthermore, genes coding for NagA ( lmo0956 ) and NagB ( lmo0957 ) are involved in the cell wall metabolism leading to the generation of glucosamine-6-phosphate via acetylglucosamine-6-P-deacetylase (NagA) and further on to fructose-6-phosphate using NagB, a glucosamine-6-phosphate isomerase [ 33 ]....”
• Glycerol metabolism and PrfA activity in Listeria monocytogenes
  Joseph, Journal of bacteriology 2008
  • “...lmo0880 lmo0913b lmo0914 lmo0915b lmo0916 lmo0917 lmo0956 lmo0957 lmo0979 lmo1034 lmo1057 lmo1097 lmo1099 cadA lmo1103 lmo1142 lmo1143 lmo1151 lmo1152 lmo1154...”

Fjoh_4557 glucosamine-6-phosphate deaminase-like protein from Flavobacterium johnsoniae UW101
40% identity, 26% coverage

• A polysaccharide utilization locus from Flavobacterium johnsoniae enables conversion of recalcitrant chitin
  Larsbrink, Biotechnology for biofuels 2016
  • “...essentially as previously described [ 30 ]. Strains with deletions in Fjoh_4556 (GH20 chitobiase), nagB (Fjoh_4557), cusC I (Fjoh_4559), chiB (Fjoh_4560), cusD II (Fjoh_4561), cusC II (Fjoh_4562), Fjoh_4565, and strains with deletions spanning the adjacent genes ( cusC I cusD I ), ( cusC II cusD...”
• Novel features of the polysaccharide-digesting gliding bacterium Flavobacterium johnsoniae as revealed by genome sequence analysis
  McBride, Applied and environmental microbiology 2009
  • “...and four glucosamine-6-phosphate isomerases/deaminases (Fjoh_2029, Fjoh_2381, Fjoh_4812, Fjoh_4557) related to E. coli NagB (79). NagK, NagA, and NagB are...”
  • “...(Fjoh_4556), a glucosamine-6-phosphate isomerase/deaminase (Fjoh_4557), two SusC-like proteins (Fjoh_4559, Fjoh_4562), and two SusD-like...”

B1745_07135 glucosamine-6-phosphate deaminase from Lactobacillus amylolyticus
41% identity, 74% coverage

• Adaptive mechanism of Lactobacillus amylolyticus L6 in soymilk environment based on metabolism of nutrients and related gene-expression profiles
  Fei, Food science & nutrition 2022
  • “...subunit IIC 1.04 B1745_05735 manX PTS mannose transporter subunit IIAB 1.15 B1745_05130 glvA 6phosphoalphaglucosidase 1.33 B1745_07135 nagB glucosamine6phosphate deaminase 2.70 Amino acid transport and metabolism B1745_04680 amino acid permease 1.01 B1745_05320 livB branchedchain amino acid transport system II carrier protein 1.02 B1745_05735 manX PTS mannose transporter...”

Amuc_1822 glucosamine-6-phosphate isomerase from Akkermansia muciniphila ATCC BAA-835
41% identity, 59% coverage

• Model-driven design of a minimal medium for Akkermansia muciniphila confirms mucus adaptation
  van, Microbial biotechnology 2018
  • “...peptidoglycan formation. The only annotated enzyme that could mediate this conversion is AmucNagB on locus Amuc_1822. We found that AmucNagB was unable to form GlcN6P from Fru6P at physiological conditions, while it efficiently catalyzed the reverse reaction. To overcome this inability, N acetylglucosamine needs to be...”
  • “...code for GlmS. The gene that encodes for glucosamine6phosphate deaminase ( CDB55261.1 ) on locus amuc_1822 (AMUC_RS09725) is the only candidate gene that expresses an enzyme which could mediate the reaction between GlcN6P and Fru6P (Table S4 ). No homologues were found in the A.muciniphila genome....”
• Genome-Scale Model and Omics Analysis of Metabolic Capacities of Akkermansia muciniphila Reveal a Preferential Mucin-Degrading Lifestyle
  Ottman, Applied and environmental microbiology 2017
  • “...prominent role of the upregulated glucosamine-6-phosphate deaminase (Amuc_1822) in GlcNAc degradation. We conclude that GlcNAc entry into glycolysis proceeds...”

MED152_08485 glucosamine-6-phosphate deaminase from Polaribacter sp. MED152
40% identity, 27% coverage

• Bacterial transcriptional response to labile exometabolites from photosynthetic picoeukaryote Micromonas commoda
  Ferrer-González, ISME communications 2023
  • “...to 1,6) transglucosidase (GH13_8) MED152_05080 WP_041383396.1 5.7 sugar kinase MED152_05110 WP_015480788.1 4.7 trehalase (GH37) PUL5 MED152_08485 WP_015481446.1 2.6 glucosamine-6-phosphate deaminase MED152_08490 WP_015481447.1 3.2 beta-N-acetylhexosaminidase (GH20, PUL5) MED152_08495 WP_015481448.1 4.5 N-acetylglucosamine kinase All genes have an adjusted p value0.01. GH glycoside hydrolase, AA auxiliary activity, CE carbohydrate...”
• Growth-stage-related shifts in diatom endometabolome composition set the stage for bacterial heterotrophy
  Olofsson, ISME communications 2022
  • “...Glyceraldehyde-3-P dehydrogenase MED152_13444 SusD/RagB family nutrient binding outer membrane lipoprotein PUL5 MED152_08480 Glucosamine-6-phosphate deaminase PUL5 MED152_08485 CAZyme; beta-N-acetylhexosaminidase (GH20) PUL5 MED152_08490 N-acetylglucosaminase kinase (GlcNac) PUL5 MED152_08495 Glycosyl hydrolase 81 (GH81) MED152_00755 Glycogen synthase (GT4) MED152_05855 Glycine cleavage MED152_06700 1,4--glucan branching enzyme MED152_05875 Glyceraldehyde-3-P dehydrogenase MED152_03295 PUL2...”

LMOSA_18470 glucosamine-6-phosphate deaminase from Listeria monocytogenes str. Scott A
40% identity, 76% coverage

• High-pressure processing-induced transcriptome response during recovery of Listeria monocytogenes
  Duru, BMC genomics 2021
  • “...RO15 at all time points. Similarly, ScottA showed upregulation of the nagA (LMOSA_18460) and nagB (LMOSA_18470) homologues at early time points. However, the second nagB homologue of ScottA (LMOSA_3160) was not upregulated (Fig. 3 a, 4 a). We also focused on mechanosensitive channel genes. The gene...”

NH13_09645 glucosamine-6-phosphate deaminase from Lactobacillus acidophilus
LBA1948 glucosamine-6-phosphate isomerase from Lactobacillus acidophilus NCFM
39% identity, 74% coverage

• Draft Genome Sequence of the Probiotic Strain Lactobacillus acidophilus ATCC 4356
  Palomino, Genome announcements 2015
  • “...Mechanisms of the enzymes degrading N -acetylglucosamine ( 15 ) are predicted: NagB, GlcN6P deaminase (NH13_09645) and NagA, GlcNAc6P deacetylase (NH13_00815). A transcriptional regulator of N -acetylglucosamine utilization (NH13_02010) from the GntR family was also found. We confirm their functionality: cells were able to grow in...”
• Transcriptional and functional analysis of oxalyl-coenzyme A (CoA) decarboxylase and formyl-CoA transferase genes from Lactobacillus acidophilus
  Azcarate-Peril, Applied and environmental microbiology 2006
  • “...LBA1462 LBA1690 LBA1869 LBA1870 LBA1877 LBA1948 Hypothetical protein Hypothetical protein Hypothetical protein N-Acetylglucosamine-6-phosphate deacetylase...”

Shew_0815 Glucosamine-6-phosphate deaminase (EC 3.5.99.6) from Shewanella loihica PV-4
40% identity, 66% coverage

• mutant phenotype: Specifically important for utilizing N-Acetyl-D-Glucosamine. Automated validation from mutant phenotype: the predicted function (GLUCOSAMINE-6-P-DEAMIN-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.

AMUC_RS09725 glucosamine-6-phosphate deaminase from Akkermansia muciniphila ATCC BAA-835
41% identity, 72% coverage

• Model-driven design of a minimal medium for Akkermansia muciniphila confirms mucus adaptation
  van, Microbial biotechnology 2018
  • “...for GlmS. The gene that encodes for glucosamine6phosphate deaminase ( CDB55261.1 ) on locus amuc_1822 (AMUC_RS09725) is the only candidate gene that expresses an enzyme which could mediate the reaction between GlcN6P and Fru6P (Table S4 ). No homologues were found in the A.muciniphila genome. The...”
  • “...vice versa, we overproduced the only possible candidate enzyme, termed AmucNagB, encoded by gene amuc_1822 (AMUC_RS09725) in E.coli BL21 (DE3) with a Cterminal Histag and purified it to apparent homogeneity as a 33kDa protein (Fig. S2 ). The purified AmucNagB was assayed for conversions in both...”

SPSF3K_01753 glucosamine-6-phosphate deaminase from Streptococcus parauberis
40% identity, 76% coverage

• Transcriptome analysis unveils survival strategies of Streptococcus parauberis against fish serum
  Lee, PloS one 2021
  • “...-4.2 -3.5 K lrgB SPSF3K_00605 Antiholin-like protein LrgB -7.5 -2.6 -2.8 M Cluster C nagB SPSF3K_01753 Glucosamine-6-phosphate deaminase 4.6 2.3 1.7 G / SPSF3K_02218 Fic family protein 4.3 1.6 0.7 D srlA SPSF3K_00182 Glucitol/sorbitol permease IIC component - -4.1 -3.5 G srlE SPSF3K_00183 Protein-N(pi)-phosphohistidinesugar phosphotransferase -...”

A8YZR7 glucosamine-6-phosphate deaminase (EC 3.5.99.6) from Staphylococcus aureus (see paper)
SA0527 probable glucosamine-6-phosphate isomerase from Staphylococcus aureus subsp. aureus N315
USA300HOU_0563 glucosamine-6-phosphate deaminase from Staphylococcus aureus subsp. aureus USA300_TCH1516
40% identity, 69% coverage

• Coordinated phenotype switching with large-scale chromosome flip-flop inversion observed in bacteria
  Cui, Proceedings of the National Academy of Sciences of the United States of America 2012
  • “...gcaD UDP-N-acetylglucosamine pyrophosphorylase homolog SA0527 nagB Probable glucosamine-6-phosphate isomerase SA0656 nagA Probable...”
• Protein S-Bacillithiolation Functions in Thiol Protection and Redox Regulation of the Glyceraldehyde-3-Phosphate Dehydrogenase Gap in Staphylococcus aureus Under Hypochlorite Stress
  Imber, Antioxidants & redox signaling 2018
  • “...energy metabolism USA300HOU_0964 nadK NAD(+) kinase Cys208 a B 1.8 11.00 18.36 0.17 29.35 0.15 USA300HOU_0563 nagB Glucosamine-6-phosphate deaminase Cys239 B 3.9 16.40 9.49 0.07 25.89 0.11 USA300HOU_0902 ndh NADH dehydrogenase Cys199 B 2.6 10.23 15.39 0.19 25.62 0.08 Amino acid biosynthesis USA300HOU_1536 gcvPB Glycine DH...”

L14408 glucosamine-6-P isomerase (EC 5.3.1.10) from Lactococcus lactis subsp. lactis Il1403
40% identity, 77% coverage

• Strain-Dependent Transcriptome Signatures for Robustness in Lactococcus lactis
  Dijkstra, PloS one 2016
  • “...zitS zinc ABC transporter substrate binding protein negative 1.9 L94973 ycjG hypothetical protein negative 3.4 L14408 nagB glucosamine-6-P isomerase negative 3.9 L72115 yohD hypothetical protein negative 2.9 L154225 ylfD hypothetical protein negative 2.4 L0163 ribG riboflavin-specific deaminase positive 0.1 L145739 floL flotillin-like protein negative 5.2 L39365...”

NCDO2118_1594 glucosamine-6-phosphate deaminase from Lactococcus lactis subsp. lactis NCDO 2118
40% identity, 77% coverage

• Analyses of the probiotic property and stress resistance-related genes of Lactococcus lactis subsp. lactis NCDO 2118 through comparative genomics and in vitro assays
  Oliveira, PloS one 2017
  • “...NCDO2118_0637 4.2.1.11 eno Enolase Acid stress/bile resistance NCDO2118_1019 - dnaK Chaperone protein Acid stress/bile resistance NCDO2118_1594 3.5.99.6 nagB Glucosamine-6-phosphate deaminase/isomerase Bile resistance NCDO2118_1909 3.4.24.- pepO Endopeptidase O Bile resistance NCDO2118_0941 5.4.99.9 glf UDP-galactopyranose mutase Bile resistance NCDO2118_0500 6.3.4.2 pyrG CTP synthase Bile resistance NCDO2118_0035 1.8.1.4 pdhd...”

LEGAS_1624 glucosamine-6-phosphate deaminase from Leuconostoc gasicomitatum LMG 18811
41% identity, 76% coverage

• Transcriptomic time-series analysis of cold- and heat-shock response in psychrotrophic lactic acid bacteria
  Duru, BMC genomics 2021
  • “..., and P. oligofermentans , respectively). Genes of Le. gelidum ; mapA (LEGAS_1151) and nagB (LEGAS_1624) and genes of Lc. piscium ; pfl (LACPI_1736) and fruK (LACPI_2020) were normalized using concentration of the housekeeping gene infB . The genes of P. oligofermentans ; infC (LACOL_0746), ftsQ...”
• Significance of heme-based respiration in meat spoilage caused by Leuconostoc gasicomitatum
  Jääskeläinen, Applied and environmental microbiology 2013 (secret)

Q5HRH8 Glucosamine-6-phosphate deaminase from Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
38% identity, 72% coverage

• Phenotypic Modulation of Biofilm Formation in a Staphylococcus epidermidis Orthopedic Clinical Isolate Grown Under Different Mechanical Stimuli: Contribution From a Combined Proteomic Study
  Bottagisio, Frontiers in microbiology 2020
  • “...Q5HM69 Glutaminefructose-6-phosphate aminotransferase (0.00898) GLMS_STAEQ Q5HM69 Glutaminefructose-6-phosphate aminotransferase (0.0000149) GLMS_STAEQ Q5HM69 Glutaminefructose-6-phosphate aminotransferase (0.00177) NAGB_STAEQ Q5HRH8 Glucosamine-6-phosphate deaminase (0.00333) ALD1_STAEQ Q5HMA0 Aldehyde dehydrogenase SERP1729 (0.00172) A0A2G7HXB3_STAEP A0A2G7HXB3 NADP-dependent oxidoreductase (0.0000188) Q5HL33_STAEQ Q5HL33 Alpha-acetolactate decarboxylase (0.000513) BUTA_STAEQ Q5HKG6 Diacetyl reductase [(S)-acetoin forming] (0.00847) Q5HP34_STAEQ Q5HP34 Dihydrolipoyl dehydrogenase...”

M5005_Spy_1139 glucosamine-6-phosphate isomerase from Streptococcus pyogenes MGAS5005
SPy1399, SPy_1399 putative N-acetylglucosamine-6-phosphate isomerase from Streptococcus pyogenes M1 GAS
40% identity, 75% coverage

• TrxR, a new CovR-repressed response regulator that activates the Mga virulence regulon in group A Streptococcus
  Leday, Infection and immunity 2008
  • “...M5005_Spy_1534 M5005_Spy_1417 M5005_Spy_0722 M5005_Spy_1139 M5005_Spy_1413 M5005_Spy_0552 M5005_Spy_0621 M5005_Spy_0159 M5005_Spy_1633 M5005_Spy_0913...”
• Novel Tyrosine Kinase-Mediated Phosphorylation With Dual Specificity Plays a Key Role in the Modulation of Streptococcus pyogenes Physiology and Virulence
  Kant, Frontiers in microbiology 2021
  • “...3.51421 0.04485 0.162 Spy1746 - PTS system cellobiose-specific transporter subunit IIA 1.7089 3.26911 0.00201 0.019124 Spy1399 - PTS system galactose-specific transporter subunit IIC 3.5653 11.8376 0.00233 0.021278 Spy1400 - PTS system galactose-specific transporter subunit IIB 3.4328 10.7988 0.00331 0.027264 Spy1401 - PTS system galactose-specific transporter subunit...”
  • “...LacB 4.0835 16.9534 0.00257 0.022735 Spy1398 lacA.1 Galactose-6-phosphate isomerase subunit LacA 3.8108 14.0335 0.00194 0.01875 Spy1399 PTS-IIC PTS system galactose-specific transporter subunit IIC 3.5653 11.8376 0.00233 0.021278 Spy1400 PTS-IIC PTS system galactose-specific transporter subunit IIB 3.4328 10.7988 0.00331 0.027264 Spy1401 PTS-IIA PTS system galactose-specific transporter subunit...”
• Glucose Levels Alter the Mga Virulence Regulon in the Group A Streptococcus
  Valdes, Scientific reports 2018
  • “...genes such as those for 3-keto-L-gulonate ( ptxABC ), mannitol ( spy_1664 ), galactose ( spy_1399 ), both cellobiose operons ( spy_10791083 and celB ), and trehalose ( treCB ). The ABC transporters for sialic acid (spy_02130215 ) and cyclomaltodextrin ( malADC ) were also upregulated....”
• Global Analysis and Comparison of the Transcriptomes and Proteomes of Group A Streptococcus Biofilms
  Freiberg, mSystems 2016
  • “...3.56 3.84 4.16 2.32 2.04 1.72 2.14 1.86 1.54 Galactose-6-phosphate isomerase subunit LacA G G Spy1399 4.39 4.46 4.47 2.95 2.89 2.88 2.51 2.44 2.43 PTS, galactose-specific IIC component G H Spy1400 4.61 5.81 5.78 3.16 1.97 2 2.61 1.44 PTS, galactose-specific IIB component G H...”
• Contribution of exogenous genetic elements to the group A Streptococcus metagenome
  Beres, PloS one 2007
  • “...predicted secretion signal sequences. Included among these proteins are cognates of Spy1325 and R28 (MGAS10270: Spy1399 and Spy1410, respectively). Spy1325 and R28 are cell surface anchored adhesins that are expressed during the course of human infection, and are immunoprotective in mouse models of infection [74] ,...”
• Central role of a bacterial two-component gene regulatory system of previously unknown function in pathogen persistence in human saliva
  Shelburne, Proceedings of the National Academy of Sciences of the United States of America 2005
  • “...(spy0629) and MalE (spy1059), and carbohydrate metabolism enzymes (spy1399). Similarly, 7 of the top 10 genes with the greatest decrease in transcripts between...”
• Group A Streptococcus transcriptome dynamics during growth in human blood reveals bacterial adaptive and survival strategies
  Graham, The American journal of pathology 2005
  • “...putatively involved in aminosugar metabolism (spy0716 ; spy1399 ; spy1694 ). These strain-dependent transcript differences indicate that CovR-CovS is involved...”

Spy49_1115c Glucosamine-6-phosphate deaminase from Streptococcus pyogenes NZ131
40% identity, 75% coverage

• Effects of the ERES pathogenicity region regulator Ralp3 on Streptococcus pyogenes serotype M49 virulence factor expression
  Siemens, Journal of bacteriology 2012
  • “...spy49_0565c spy49_0863 spy49_0864 spy49_1114c spy49_1115c spy49_1239 spy49_1332c spy49_1334c spy49_1374c spy49_1375c spy49_1376c spy49_1416 spy49_1417...”

Ssal_01624 glucosamine-6-phosphate deaminase from Streptococcus salivarius 57.I
38% identity, 76% coverage

• Impact of growth pH and glucose concentrations on the CodY regulatory network in Streptococcus salivarius
  Geng, BMC genomics 2018
  • “...2.6 3.9 3.4 1.9 Ssal_01401 endA 3.7 7.4 5.0 7.1 Ssal_01479 5.2 2.9 19.1 5.3 Ssal_01624 nagB 2.2 1.9 3.8 1.3 Ssal_01876 covR 8.8 6.5 3.6 5.7 Ssal_02041 tig 1.6 7.3 2.6 1.6 Ssal_02096 3.7 2.8 6.0 3.1 Others Ssal_00088 rpsS 0.04 0.48 0.16 0.22 Ssal_00221...”

SSU05_0634 6-phosphogluconolactonase/Glucosamine-6- phosphate isomerase/deaminase from Streptococcus suis 05ZYH33
SSU10_RS03040 glucosamine-6-phosphate deaminase from Streptococcus suis
39% identity, 75% coverage

• sRNA23, a novel small RNA, regulates to the pathogenesis of Streptococcus suis serotype 2
  Xu, Virulence 2021
  • “..., Table S2). sRNA23 is located in an intergenic region between two open reading frames: SSU05_0634 (Glucosamine-6-phosphate deaminase) and SSU05_0635 (Hypothetical protein) ( Figure 3(a)) . Next, Northern blot was performed to confirm the abundance and size of sRNA23 expression. The size (302 nt) of sRNA23...”
• d-Alanylation of Lipoteichoic Acids in Streptococcus suis Reduces Association With Leukocytes in Porcine Blood
  Öhlmann, Frontiers in microbiology 2022
  • “...of dltA , dltCdltD , SSU10_RS03090 (low temperature requirement protein A, downstream of dltD ), SSU10_RS03040 (glucosamin-6-phosphate deaminase, upstream of dltA ), and the housekeeping gene gyrB . The respective primers are listed in Supplementary Table S1 . qRT-PCR was conducted with the AriaMX real-time PCR...”
  • “...levels of the genes dltC and dltD , as well as those of the genes SSU10_RS03040 and SSU10_RS03090 up- and downstream of the dlt locus, were not different between S. suis 10 wt and 10 dltA , confirming that in-frame deletion did not result in polar...”

SmuNN2025_1351 putative N-acetylglucosamine-6-phosphate isomerase from Streptococcus mutans NN2025
39% identity, 76% coverage

• Effects of mushroom and chicory extracts on the shape, physiology and proteome of the cariogenic bacterium Streptococcus mutans
  Signoretto, BMC complementary and alternative medicine 2013
  • “...lacD1 36468 4.96 11 462 31 Lyase activity Putative N-acetylglucosamine-6-phosphate isomerase 6205 + 2.43 gi|24379109 SmuNN2025_1351 25457 5.33 7 330 37 Deaminase activity Fructose bi-phosphate aldolase 8001 + 5.24 gi|4322370 fba 7447 8.85 3 115 30 Lyase activity PROTEIN BIOSYNTHESIS AND FOLDING Elongation factor Tu 1603...”

2ri1A / Q8DV70 Crystal structure of glucosamine 6-phosphate deaminase (nagb) with glcn6p from s. Mutans (see paper)
39% identity, 76% coverage

• Ligand: 2-amino-2-deoxy-6-o-phosphono-alpha-d-glucopyranose (2ri1A)

EF0466 glucosamine-6-phosphate isomerase from Enterococcus faecalis V583
39% identity, 76% coverage

• Metabolism of Poly-β1,4-N-Acetylglucosamine Substrates and Importation of N-Acetylglucosamine and Glucosamine by Enterococcus faecalis
  Keffeler, Journal of bacteriology 2021
  • “...required for entry into glycolysis, and we show that growth on glucosamine is dependent on EF0466 (a glucosamine-6-phosphate deaminase; NagB homolog). Collectively, our data highlight the chitinolytic machinery required for breaking down exogenous chitinous substrates, as well as the uptake and cytosolic enzymes needed for metabolizing...”
• Chlorhexidine Induces VanA-Type Vancomycin Resistance Genes in Enterococci
  Bhardwaj, Antimicrobial agents and chemotherapy 2016
  • “...Predicted protein htrA; serine protease Conserved hypothetical protein EF0466 11.0 58.2 14.7 10.6 18.9 30.8 45.1 15.1 13.4 12.5 spx; arsenate reductase...”
• Enterococcus faecalis Glycolipids Modulate Lipoprotein-Content of the Bacterial Cell Membrane and Host Immune Response
  Theilacker, PloS one 2015
  • “...family protein cytoplasmic EF2633 -2.306 60 kDa chaperonin cytoplasmic EF1308 -2.341 Chaperone protein DnaK cytoplasmic EF0466 -2.345 Glucosamine-6-phosphate deaminase cytoplasmic a Transmembrane domains were predicted with the TMHMM 2.0 algorithm [ 53 ]. Lipoproteins were classified according to Reffuveille et al. [ 36 ]. For prediction...”
• Comparative genomic analysis of pathogenic and probiotic Enterococcus faecalis isolates, and their transcriptional responses to growth in human urine
  Vebø, PloS one 2010
  • “...and amino acids present in urine as growth substrates [44] . The transcription of nagB (EF0466) and nagA-1 (EF1317) involved in N-acetyl glucosamine metabolism was elevated, implying that these substrates were utilized by E. faecalis during growth in urine. A massive down-regulation of glmS (EF2151), which...”
• Survey of genomic diversity among Enterococcus faecalis strains by microarray-based comparative genomic hybridization
  Aakra, Applied and environmental microbiology 2007
  • “...EF0411-EF0413 EF0020 EF0021 EF0022 EF2589 (manA) EF0451 EF0466 (nagB) EF3044 (nagA2) EF0433 EF0434 (rhaA) EF0435 (rhaD) EF1243 EF0197 (rpiA) EF1922 EF2959...”

SXYL_00254 glucosamine-6-phosphate deaminase from Staphylococcus xylosus
39% identity, 71% coverage

• Investigating Extracellular DNA Release in Staphylococcus xylosus Biofilm In Vitro
  Leroy, Microorganisms 2021
  • “...regulator 2.1 SXYL_00405 nanK N -acetylmannosamine kinase 2.5 SXYL_00406 nanA N -acetylneuraminate lyase 3.9 2.7 SXYL_00254 Glucosamine-6-phosphate deaminase 3.4 Glycolysis SXYL_00773-76 mtlDFA PTS system mannitol 4.1 * 5.4 * SXYL_00253 PTS system, glucose-specific IIBC component 4.7 2.7 SXYL_01179 gapA2 Glyceraldehyde-3-phosphate dehydrogenase 2 2.7 SXYL_00207 ppsA Pyruvate...”

nagB / A3CLX4 glucosamine-6-phosphate deaminase subunit (EC 3.5.99.6) from Streptococcus sanguinis (strain SK36) (see 2 papers)
39% identity, 76% coverage

EHI_174640 glucosamine-6-phosphate isomerase, putative from Entamoeba histolytica HM-1:IMSS
37% identity, 26% coverage

• Screening and Structural Characterization of Heat Shock Response Elements (HSEs) in <i>Entamoeba histolytica</i> Promoters
  Dorantes-Palma, International journal of molecular sciences 2024
  • “...HSE in this category. Among these, 63 genes had a single HSE, including Glucosamine-6-Phosphate Isomerase (EHI_174640) and Adenylate Kinase (EHI_135470). Twelve genes featured two HSEs, with the EhrabB4-Ehhsp100 combination occurring most frequently, as seen in genes like actin (EHI_182900) and Enhancer Binding Protein-2 (EHI_182670). Two genes...”
• Attenuation of In Vitro and In Vivo Virulence Is Associated with Repression of Gene Expression of AIG1 Gene in Entamoeba histolytica
  Lozano-Mendoza, Pathogens (Basel, Switzerland) 2023
  • “...exchange of GTPs. EhRabX23 EHI_107140 2.9 Intracellular trafficking and signal transduction mechanisms. Glucosamine-6-phosphate isomerase, putative EHI_174640 2.9 Carbohydrate transport and metabolism. EhRabC6 EHI_194280 2.8 Intracellular trafficking, secretion, and vesicular transport. Protein kinase putative EHI_185230 2.7 Protein phosphorylation, inorganic ion transport, energy production, and conversion. Choline/Ethanolamine kinase,...”

CA265_RS21925 Glucosamine-6-phosphate deaminase (EC 3.5.99.6) from Pedobacter sp. GW460-11-11-14-LB5
39% identity, 27% coverage

• mutant phenotype: Specifically important for utilizing N-Acetyl-D-Glucosamine. Automated validation from mutant phenotype: the predicted function (GLUCOSAMINE-6-P-DEAMIN-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.

SPCG_RS07255 glucosamine-6-phosphate deaminase from Streptococcus pneumoniae CGSP14
39% identity, 77% coverage

• The transcriptomic response of Streptococcus pneumoniae following exposure to cigarette smoke extract
  Manna, Scientific reports 2018
  • “...DltX 1.40 0.011 SPCG_RS11335 D-alanine-poly(phosphoribitol) ligase subunit 1 DltA 1.24 0.046 Carbohydrate transport and metabolism SPCG_RS07255 Glucosamine-6-phosphate deaminase NagB 1.99 0.049 SPCG_RS10975 Glycogen/starch/alpha-glucan family phosphorylase MalP 1.77 0.046 SPCG_RS00515 Glycosyltransferase 1.64 0.042 SPCG_RS00520 Polysaccharide biosynthesis protein 1.48 0.037 SPCG_RS04895 Endo-beta-N-acetylglucosaminidase LytB 1.40 0.004 SPCG_RS08595 Carbohydrate ABC...”

SPD_1246 glucosamine-6-phosphate isomerase from Streptococcus pneumoniae D39
39% identity, 77% coverage

• N-acetylglucosamine-Mediated Expression of nagA and nagB in Streptococcus pneumoniae
  Afzal, Frontiers in cellular and infection microbiology 2016
  • “...transporter, permease protein 2.4 spd_1866 N-acetylglucosamine-6-phosphate deacetylase, NagA 2.4 spd_1846 PTS system, IIB component 2.3 spd_1246 glucosamine-6-phosphate isomerase, NagB 2.3 spd_0264 PTS system, mannose-specific IIAB components, ManL 2.1 spd_1492 Hypothetical protein 2.0 spd_1491 Hypothetical protein 2.0 spd_1100 Glucose-6-phosphate 1-dehydrogenase, Zwf 2.2 spd_0448 Glutamine synthetase, GlnA 3.3...”
• Transcriptional and metabolic effects of glucose on Streptococcus pneumoniae sugar metabolism
  Paixão, Frontiers in microbiology 2015
  • “...kinase 2.87 SPD_1052 lacB Galactose-6-phosphate isomerase subunit LacB 3.05 SPD_1163 N-acetylneuraminate lyase, putative 1.39 0.75 SPD_1246 nagB Glucosamine-6-phosphate isomerase 0.46 SPD_1432 galE-1 UDP-glucose 4-epimerase 0.77 SPD_1488 ROK family protein 1.58 0.83 SPD_1612 galE-2 UDP-glucose 4-epimerase 0.57 SPD_1633 galT-2 Galactose-1-phosphate uridylyltransferase 3.11 SPD_1634 galK Galactokinase 0.64 3.30...”

spr1272 N-acetylglucosamine-6-phosphate isomerase from Streptococcus pneumoniae R6
39% identity, 75% coverage

• Whole genome sequencing of penicillin-resistant Streptococcus pneumoniae reveals mutations in penicillin-binding proteins and in a putative iron permease
  Fani, Genome biology 2011
  • “...transporter ATP-binding protein-phosphate transport (PstB) G499A G167S C614T T205I spr1260 Conserved hypothetical protein T597C SYN spr1272 N-Acetylglucosamine-6-phosphate isomerase G385A G129R spr1384 UDP-N-acetylmuramoyl-L-alanyl-D-glutamyl-L-lysine ligase G996A M332I spr1423 Conserved hypothetical protein A673G M225V spr1453 Major facilitator superfamily transporter T91C F31L spr1465 Conserved hypothetical protein G419A G140E spr1517 Penicillin-binding...”

SP_1415 glucosamine-6-phosphate isomerase from Streptococcus pneumoniae TIGR4
39% identity, 76% coverage

• Anatomical Site-Specific Carbohydrate Availability Impacts Streptococcus pneumoniae Virulence and Fitness during Colonization and Disease
  Im, Infection and immunity 2022 (secret)
• The Effect of Impaired Polyamine Transport on Pneumococcal Transcriptome
  Nakamya, Pathogens (Basel, Switzerland) 2021
  • “...pyrR 2.7 <0.0001 Bifunctional pyrimidine operon transcriptional regulator SP_1724 scrB 10.5 <0.0001 Sucrose 6-phosphate hydrolase SP_1415 nagB 3.2 <0.0001 Glucosamine 6-phosphate deaminase SP_2056 nagA 2.3 <0.0001 N-acetylglucosamine 6-phosphate deacetylase SP_0321 SP_0321 2.3 <0.0001 PTS N-acetylgalactosamine transporter subunit IIA SP_0323 SP_0323 2.6 <0.0001 PTS N-acetylgalactosamine PTS system...”
• Polyamine Synthesis Effects Capsule Expression by Reduction of Precursors in Streptococcus pneumoniae
  Ayoola, Frontiers in microbiology 2019
  • “...sucrose-6-phosphate hydrolase 3.0 glmS SP_0266 Glutamine-fructose-6-phosphate aminotransferase 1.6 nagA SP_2056 N -acetylglucosamine-6-phosphate deacetylase 2.9 nagB SP_1415 Glucosamine-6-phosphate deaminase 3.9 pyrR SP_1278 Bifunctional protein PyrR 1.9 SP_1163 SP_1163 Putative acetoin dehydrogenase, beta subunit 1.5 SP_1164 SP_1164 Putative acetoin dehydrogenase, alpha subunit 1.4 TABLE 2 Differentially expressed genes...”
• ManLMN is a glucose transporter and central metabolic regulator in Streptococcus pneumoniae
  Fleming, Molecular microbiology 2016
  • “...induction, we used the glucosamine-6-phosphate deaminase (nagB; SP_1415) promoter (PnagB). Although NagB is 470 E. Fleming and A. Camilli Fig. 3....”
• Biofilm and planktonic pneumococci demonstrate disparate immunoreactivity to human convalescent sera
  Sanchez, BMC microbiology 2011
  • “...Dihydrodipicolinate reductase dapB (SP_1555) 0 4 Dihydrodipicolinate synthase dapA (SP_1014) 0 3 Glucosamine-6-phosphate deaminase nagB (SP_1415) 0 2 Carbamoyl-phosphate synthase large chain carB (SP_1275) 5 5 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase dapH (SP_2097) 0 8 Aspartate--ammonia ligase asnA (SP_1970) 3 0 Dihydroxy-acid dehydratase ilvD (SP_2126) 0 7 ATP synthase...”

SGO_1586 glucosamine-6-phosphate isomerase from Streptococcus gordonii str. Challis substr. CH1
39% identity, 76% coverage

• Amino Sugars Enhance the Competitiveness of Beneficial Commensals with Streptococcus mutans through Multiple Mechanisms
  Zeng, Applied and environmental microbiology 2016
  • “...genome includes open reading frames (ORFs) SGO_0549 and SGO_1586, which encode proteins that are highly conserved with known NagA and NagB enzymes,...”

MSMEG_2118 glucosamine-6-phosphate isomerase from Mycobacterium smegmatis str. MC2 155
36% identity, 67% coverage

• A VapBC toxin-antitoxin module is a posttranscriptional regulator of metabolic flux in mycobacteria
  McKenzie, Journal of bacteriology 2012
  • “...trehalose, N-acetylglucosamine MSMEG_2114 MSMEG_2115 MSMEG_2116 MSMEG_2117 MSMEG_2118 MSMEG_2119 MSMEG_2120 ptsG crr nagB2 nagA pstR 1.25 (1.11) 1.33 1.32...”

LMOh7858_1020 glucosamine-6-phosphate isomerase from Listeria monocytogenes str. 4b H7858
41% identity, 77% coverage

• Contributions of σ(B) and PrfA to Listeria monocytogenes salt stress under food relevant conditions
  Ribeiro, International journal of food microbiology 2014
  • “...0.001 Lmo0530 d Putative cellulose synthase; this enzyme is activated by cyclic di-GMP 3.51 0.017 LMOh7858_1020 Glucosamine-6-phosphate isomerase 3.49 0.001 Lmo0197 Similar to B. subtilis SpoVG protein 3.25 <0.001 Lmo1364 (cspL) Cold shock protein 2.63 0.002 Lmo0527 d Putative membrane protein 2.54 0.001 Lmo0903 OsmC/Ohr family...”

NAGB_STRCO / Q9K487 Glucosamine-6-phosphate deaminase; GlcN6P deaminase; GNPDA; Glucosamine-6-phosphate isomerase; EC 3.5.99.6 from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) (see paper)
SCO5236 glucosamine-6-phosphate deaminase from Streptomyces coelicolor A3(2)
34% identity, 67% coverage

• function: Catalyzes the reversible isomerization-deamination of glucosamine 6-phosphate (GlcN6P) to form fructose 6-phosphate (Fru6P) and ammonium ion.
  catalytic activity: alpha-D-glucosamine 6-phosphate + H2O = beta-D-fructose 6- phosphate + NH4(+) (RHEA:12172)
• Genome-wide analysis of in vivo binding of the master regulator DasR in Streptomyces coelicolor identifies novel non-canonical targets
  Świątek-Połatyńska, PloS one 2015
  • “...- + - - - 5 + [ 27 , 30 ] cttggtctagtccata -322 9.05 SCO5236 nagB + - - - - - + - - + 3 + [ 27 , 30 ] tgtggtttagaccaat -68 17.51 SCO5376 chiC + - - - - - -...”
• Deciphering the regulon of Streptomyces coelicolor AbrC3, a positive response regulator of antibiotic production
  Rico, Applied and environmental microbiology 2014
  • “...SCO3590 SCO3992 SCO4075 SCO4123 SCO4596 SCO4630 SCO5085 SCO5236 SCO5330 SCO5332 SCO5632 SCO5638 SCO5691 SCO5729 SCO5912 SCO5966 SCO6273 SCO6732 SCO6820 SCO6941...”
• Functional analysis of the N-acetylglucosamine metabolic genes of Streptomyces coelicolor and role in control of development and antibiotic production
  Świątek, Journal of bacteriology 2012
  • “...regions around the amino sugar utilization genes. nagB (SCO5236) is a single transcription unit, while nagK (SCO4285) and nagA (SCO4284) together form the nagKA...”
  • “...SCO3122 hexA SCO2758 SCO2786 SCO2943 SCO4860 SCO4284 SCO5236 SCO2907 SCO2905 SCO4285 SCO2949 SCO5998 SCO4643 SCO4307 SCO5841 SCO1391 nagA nagB nagE2 nagF...”
• Engineering of N-acetylglucosamine metabolism for improved antibiotic production in Streptomyces coelicolor A3(2) and an unsuspected role of NagA in glucosamine metabolism
  Świątek, Bioengineered 2012
  • “...GlcNAc-6P deacetylase (NagA; SCO4284), GlcN-6P deaminase (NagB; SCO5236) and GlcNAc kinase (NagK; SCO4285).21 Similarly to the GlcNAc utilization pathway of...”
• A genomic view of sugar transport in Mycobacterium smegmatis and Mycobacterium tuberculosis
  Titgemeyer, Journal of bacteriology 2007
  • “...the closest homologs were the S. coelicolor proteins SCO5236 (NagB homolog with 50% identity) and SCO6670 (BglA homolog with 54% identity). (ii) -Galactosides...”
  • “...smoKGFER xylG1F1E1A1R1 rbsR5P5K5G5F5E5 Reference(s) and/or source(s)c nagB (SCO5236), bgl (SCO0670), deoR, rbsK E. coli; abcEFG genes are distantly related to...”
• Bioinformatic identification of novel regulatory DNA sequence motifs in Streptomyces coelicolor
  Studholme, BMC microbiology 2004
  • “...genes involved in carbohydrate metabolism, including acetyl-coenzyme A synthetase (SCO3563), a putative glucosamine phosphate isomerase (SCO5236) and several putative sugar binding proteins (SCO0531, SCO2946 and SCO5232). It seems plausible that these might also share a common regulatory system with the PTS and chitinases. Conserved DNA sequence...”
• Extending the classification of bacterial transcription factors beyond the helix-turn-helix motif as an alternative approach to discover new cis/trans relationships
  Rigali, Nucleic acids research 2004
  • “...the putative NagB enzyme, a glucosamine phosphate isomerase (SCO5236). Identification of the best HutC-like TF of the PTSNag regulon in S.coelicolor According...”

cg2928 N-acetylglucosamine-6-phosphate isomerase from Corynebacterium glutamicum ATCC 13032
38% identity, 70% coverage

• Metabolic Engineering of Corynebacterium glutamicum for Production of UDP-N-Acetylglucosamine
  Gauttam, Frontiers in bioengineering and biotechnology 2021
  • “...a genome-reduction project ( Unthan et al., 2015 ) and lacks the nagB gene ( cg2928 ) encoding glucosamine-6-phosphate deaminase (NagB) and thus, the enzyme for the backward reaction of GlmS ( Uhde et al., 2013 ) ( Figure 1 ). To test the newly constructed...”
• Transcription of Sialic Acid Catabolism Genes in Corynebacterium glutamicum Is Subject to Catabolite Repression and Control by the Transcriptional Repressor NanR
  Uhde, Journal of bacteriology 2016
  • “...and the glucosamine-6-phosphate deaminase NagB (encoded by cg2928 [nagB]) to pyruvate, acetate, ammonia, and fructose-6-phosphate (fructose-6P) (22). The enzyme...”
• ScrB (Cg2927) is a sucrose-6-phosphate hydrolase essential for sucrose utilization by Corynebacterium glutamicum
  Engels, FEMS microbiology letters 2008 (PubMed)
  • “...orientation (cg2929-cg2928- cg2927-ptsS). While cg2928 has been annotated as putative 6-phosphogluconolactonase/glucosamine-6-phosphate For enzyme...”
  • “...All rights reserved c V. Engels et al. cg2928, scrB and ptsS (http://www.coryneregnet.de). Primer extension analysis did not reveal transcriptional start sites...”

CPA40_RS06275 glucosamine-6-phosphate deaminase from Bifidobacterium callitrichos
35% identity, 65% coverage

• The comparative genomics of Bifidobacterium callitrichos reflects dietary carbohydrate utilization within the common marmoset gut
  Albert, Microbial genomics 2018
  • “...CPA40_RS10465 BCAL_RS06425 UDP- N -acetylglucosamine diphosphorylase 2.7.7.23 COO72_RS04345 CPA40_RS08380 BCAL_RS00645 N -Acetylglucosamine-6-phosphate deacetylase 3.5.1.25 COO72_RS10300 CPA40_RS06275 BCAL_RS02715 Glucosamine-1-phosphate N -acetyltransferase 2.3.1.157 COO72_RS04345 CPA40_RS08380 BCAL_RS00645 Phosphoglucosamine mutase 5.4.2.10 COO72_RS05530 CPA40_RS04580 BCAL_RS02085 Glucosamine-6-phosphate deaminase 3.5.99.6 COO72_RS08105 CPA40_RS05730 BCAL_RS02710 Glutaminefructose-6-phosphate transaminase (isomerizing) 2.6.1.16 COO72_RS05020 CPA40_RS04675 BCAL_RS02180 Non-reducing end -...”

BL1343 glucosamine-6-phosphate deaminase from Bifidobacterium longum NCC2705
33% identity, 65% coverage

• Differential transcriptional response of Bifidobacterium longum to human milk, formula milk, and galactooligosaccharide
  González, Applied and environmental microbiology 2008
  • “...BL1639 BL1642 BL1673-BL1674 BL0978 EF2229 BL1344 BL0919-BL0920 BL1343 BL1673 BL0454-BL0455 Solute binding protein of ABC transporter for sugars Type II DNA...”
  • “...ammonia may be liberated by glucosamine-6-P isomerase (BL1343), and the predicted gene for this enzyme (see below) was significantly upregulated in...”

Bbr_1248 glucosamine-6-phosphate deaminase from Bifidobacterium breve UCC2003
33% identity, 65% coverage

• Bifidobacterial biofilm formation is a multifactorial adaptive phenomenon in response to bile exposure
  Kelly, Scientific reports 2020
  • “...12.16 0.004471376 Bbr_0849 NagC/XylR-type transciptional regulator 11.58 2.80E08 Bbr_0008 Transcriptional regulator LacI family 11.01 0.002749448 Bbr_1248 Glucosamine-6-phosphate isomerase 9.41 0.000796378 Bbr_1860 Solute binding protein of ABC transporter system for sugars 9.15 0.004306336 Bbr_0083 (Filamentation induced by cAMP) Fic family protein 9.04 0.00351993 Bbr_1791 Phosphoglycerol transferase 7.13...”
  • “...These included an ATP-binding protein of an ABC-type transporter system (Bbr_0808), a glucosamine 6-phosphate isomerase (Bbr_1248), a cellodextrin binding protein (Bbr_0106), 14 glucan branching enzyme and others summarised in Table 1 . Therefore, it seems that a specific response of increased carbohydrate metabolism is induced following...”
• Bifidobacterium breve UCC2003 Employs Multiple Transcriptional Regulators To Control Metabolism of Particular Human Milk Oligosaccharides
  James, Applied and environmental microbiology 2018
  • “...Bbr_0526 Bbr_0527 Bbr_0528 Bbr_0529 Bbr_0530 Bbr_1247 Bbr_1248 Bbr_1249 Bbr_1250 Bbr_1251 Bbr_1252 Bbr_1554 Bbr_1555 Bbr_1556 Bbr_1558 Bbr_1559 Bbr_1560...”
  • “...GCCATCTCAGGACCGAACG GGTCGTCAAGGTGATGAATCC Amplification of Bbr_1248 promoter fragments with IRD700-labeled oligonucleotides 1248IRDfa 1248IRDra 1248IRDfb...”
• Glycosulfatase-Encoding Gene Cluster in Bifidobacterium breve UCC2003
  Egan, Applied and environmental microbiology 2016
  • “...Bbr_0852 (atsA2) Bbr_0853 (atsB2) Bbr_0854 Bbr_1247 (nagA2) Bbr_1248 (nagB3) Bbr_1249 Bbr_1585 (galE) Bbr_1586 (nahK) Bbr_1587 (lnbP) Bbr_1588 Bbr_1589 Bbr_1590...”
• Bifidobacterium breve UCC2003 metabolises the human milk oligosaccharides lacto-N-tetraose and lacto-N-neo-tetraose through overlapping, yet distinct pathways
  James, Scientific reports 2016
  • “...Conserved hypothetical membrane spanning protein 3.82 Bbr_1247 nagA2 CE9 nagA2 N-acetylglucosamine-6-phosphate deacetylase 2.67 5.06 3.92 Bbr_1248 nagB3 nagB3 Glucosamine-6-phosphate isomerase 4.11 5.95 8.51 Bbr_1249 Bbr_1249 Transcriptional regulator, ROK family 3.84 Bbr_1250 Bbr_1250 Sugar kinase, ROK family 2.44 7.70 8.75 Bbr_1251 Bbr_1251 N-acetylglucosamine repressor 7.71 Bbr_1252 pfkB...”
• Metabolism of sialic acid by Bifidobacterium breve UCC2003
  Egan, Applied and environmental microbiology 2014
  • “...two adjacent genes, corresponding to Bbr_1247 (nagA2) and Bbr_1248 (nagB3), were also upregulated (see below; Table 2). 4418 aem.asm.org TABLE 2 Effect of...”
  • “...(nanA) Bbr_0169 (nagB1) Bbr_0171 (nanH) Bbr_0172 Bbr_1247 (nagA2) Bbr_1248 (nagB3) a 37.32 59.01 49.91 51.55 367.68 451.08 453.7 435.43 435.04 275.38 204.69 6.7...”

Bbr_0847 glucosamine-6-phosphate deaminase from Bifidobacterium breve UCC2003
34% identity, 65% coverage

• Carbohydrate Syntrophy enhances the establishment of Bifidobacterium breve UCC2003 in the neonatal gut
  O'Connell, Scientific reports 2018
  • “...4.49 Bbr_0172 ATPase nag genes and metabolism of sulphated sugars Bbr_0846 nagA1 N-acetylglucosamine-6-phosphate deacetylase 2.0 Bbr_0847 nagB2 Glucosamine-6-phosphate isomerase 3.78 Bbr_0851 Glucose/fructose transport protein 5.55 2.95 Bbr_0852 Sulfatase family protein 2.04 Bbr_0853 atsB Arylsulfatase regulator (Fe-S oxidoreductase) Bbr_0854 Conserved hypothetical 2.12 Bbr_0855 Hypothetical protein 5.14 Lactose...”
• Glycosulfatase-Encoding Gene Cluster in Bifidobacterium breve UCC2003
  Egan, Applied and environmental microbiology 2016
  • “...single gene (Fig. 3), Bbr_0846 (nagA1) and Bbr_0847 (nagB2) are predicted to encode an N-acetylglucosamine-6-phosphate (GlcNAc-6-P) deacetylase and a...”
  • “...Solute-binding protein of the ABC transporter system Bbr_0847 (nagB2) Bbr_0848 (nagK) Bbr_0849 (atsR2) Bbr_0851 (atsT) Bbr_0852 (atsA2) Bbr_0853 (atsB2)...”
• Bifidobacterium breve UCC2003 metabolises the human milk oligosaccharides lacto-N-tetraose and lacto-N-neo-tetraose through overlapping, yet distinct pathways
  James, Scientific reports 2016
  • “...2.97 17.17 3.31 Bbr_0845 glgP2 glgP2 Glycogen phosphorylase 2.73 Bbr_0846 nagA1 nagA1 N-acetylglucosamine-6-phosphate deacetylase 4.76 Bbr_0847 nagB2 nagB2 Glucosamine-6-phosphate isomerase 5.82 Bbr_0848 Bbr_0848 Sugar kinase, ROK family 3.30 5.12 10.69 Bbr_0849 Bbr_0849 NagC/XylR-type transciptional regulator 2.90 14.40 Bbr_0850 Bbr_0850 Aldose 1-epimerase family protein 7.39 Bbr_0851 Bbr_0851...”
• Metabolism of sialic acid by Bifidobacterium breve UCC2003
  Egan, Applied and environmental microbiology 2014
  • “...genes, corresponding to locus tags Bbr_0846 and Bbr_0847, designated nagA1 and nagB2 here, which are predicted to encode additional...”

Blon_0881 glucosamine-6-phosphate isomerase from Bifidobacterium longum subsp. infantis ATCC 15697
33% identity, 65% coverage

• Genome-scale metabolic modeling of the human milk oligosaccharide utilization by Bifidobacterium longum subsp. infantis
  Román, mSystems 2024
  • “...pathway ( Fig. 2C ; Blon_0644, N-acetyl-D-mannosamine kinase; Blon_0645, N-acetylmannosamine 6-phosphate epimerase; Blon_0882, N-acetylglucosamine-6-phosphate deacetylase; Blon_0881, glucosamine-6-phosphate deaminase). However, certain enzymes in the sialic acid metabolism showed a low or null gene expression, which could indicate that other genes participate in this process, or B. infantis...”
  • “...( Fig. 2 ; Blon_0459, Blon_0732, Blon_2355). Later, GlcNAc is metabolized by Blon_0879 (N-Acetylglucosamine Kinase), Blon_0881, and Blon_0882 as above. Gene expression in the context-specific metabolic models showed several reactions with unexpected or crossed expressions. Some examples are the expression of LNnT transport and GlcNAc metabolism...”
• Bifidobacterium infantis utilizes N-acetylglucosamine-containing human milk oligosaccharides as a nitrogen source
  Li, Gut microbes 2023
  • “...oligosaccharides or the complex control. NAG catabolism is upregulated during HMO and NAG nitrogen utilization Blon_0881 ( nagB ) and Blon_0882 ( nagA ) are essential for metabolizing NAG, and thus essential during HMO nitrogen utilization. Accordingly, Blon_0881 and Blon_0882 were significantly upregulated in the B....”
  • “...Table S1). This was verified by qRT-PCR targeting these two genes (Figure S10). In addition, Blon_0881 and Blon_0882 were significantly upregulated in UMA 272 when NAG was supplied as the primary nitrogen compared to L-cysteine (Log2FC=1.13, p <0.001) ( Figure 2B , Figure S9, Table S1)....”
• Structure of co-expression networks of Bifidobacterium species in response to human milk oligosaccharides
  González-Morelo, Frontiers in molecular biosciences 2023
  • “...cluster, the module also contained a -N-acetylhexosaminidase (Blon_0732), TFs and enzymes for GlcNAc metabolism (Blon_0879, Blon_0881), and a -galactosidase (Blon_2016). Blon_0732 showed high co-expression with two ribosomal proteins and an MFS porter. Other single HMO-utilization genes were scattered in several modules ( Supplementary Table S3 )....”
• Human Milk Oligosaccharide Utilization in Intestinal Bifidobacteria Is Governed by Global Transcriptional Regulator NagR
  Arzamasov, mSystems 2022
  • “...EC 2.7.1.59 Blon_0880 nagR Transcriptional regulator of LNB/GNB and HMO utilization ROK family This study Blon_0881 nagB Glucosamine-6-phosphate deaminase EC 3.5.99.6 Blon_0882 nagA N -Acetylglucosamine-6-phosphate deacetylase EC 3.5.1.25 Blon_0883 gltF LNB/GNB ABC transporter substrate-binding protein TC 3.A.1.1 39 Blon_0884 gltG LNB/GNB ABC transporter permease protein 1...”
• Inefficient Metabolism of the Human Milk Oligosaccharides Lacto-N-tetraose and Lacto-N-neotetraose Shifts Bifidobacterium longum subsp. infantis Physiology
  Özcan, Frontiers in nutrition 2018
  • “...by GlcNAc-6-phosphate deacetylase ( nagA ; Blon_0882, EC 3.5.1.25) and glucosamine-6-phosphate isomerase/deaminase ( nagB ; Blon_0881, EC 3.5.99.6). Both Blon_0881 and Blon_0882 exhibited significant upregulation while growing on LNT and LNnT relative to lactose ( p < 0.05). Specifically, LNT induced fold changes of 19.34 3.21...”
  • “...Gene annotations and predicted functions are reported in Table S2 . The GlcNAc utilization genes Blon_0881 ( nagB ) and Blon_0882 ( nagA ) were significantly upregulated while B. infantis utilizes both LNT and LNnT relative to lactose ( p < 0.05, Figure 5 ). However,...”
• Comparative transcriptomics reveals key differences in the response to milk oligosaccharides of infant gut-associated bifidobacteria
  Garrido, Scientific reports 2015
  • “...These genes are located mostly in the HMO cluster I 22 (Blon_2335 to Blon_2346), and Blon_0881 and Blon_0882, encoding enzymes responsible for GlcNAc derivation to the bifid shunt. These results suggest that the HMO cluster I acts as an HMO-inducible unit, and that it is co-regulated...”
• Proteomic analysis of Bifidobacterium longum subsp. infantis reveals the metabolic insight on consumption of prebiotics and host glycans
  Kim, PloS one 2013
  • “...be removed by GlcNAc-6-P deacetylase ( nagA : Blon_0882) and glucosamine-6-P isomerase ( nagB : Blon_0881), respectively. These three enzymes are expressed significantly only when B. infantis was cultivated on HMO, suggesting the specific induction of catabolic pathway for HexNAc ( Figure 2B ). While the...”
• Release and utilization of N-acetyl-D-glucosamine from human milk oligosaccharides by Bifidobacterium longum subsp. infantis
  Garrido, Anaerobe 2012
  • “...32 , 33 ]. Blon_0882, a gene encoding a GlcNAc-6-phosphate deacetylase ( nagA ), and Blon_0881, which gene product is a glucosamine-6-phosphate isomerase ( nagB ), were induced during exponential growth on HMO, LNT and LNnT ( Fig. 3B ). These genes are located next to...”
  • “...of their isomers also led to the up-regulation of GlcNAc-6-P deacetylase (Blon_0882; nagB ) and Blon_0881 (glucosamine-6-P isomerase). Considering that metabolism of sialic acid includes the formation of GlcNAc-6-P ( Figure S4C ), it is possible that the induction of these genes leads to utilization of...”
• More

BCAL_RS02710 glucosamine-6-phosphate deaminase from Bifidobacterium callitrichos DSM 23973
34% identity, 65% coverage

• The comparative genomics of Bifidobacterium callitrichos reflects dietary carbohydrate utilization within the common marmoset gut
  Albert, Microbial genomics 2018
  • “...2.3.1.157 COO72_RS04345 CPA40_RS08380 BCAL_RS00645 Phosphoglucosamine mutase 5.4.2.10 COO72_RS05530 CPA40_RS04580 BCAL_RS02085 Glucosamine-6-phosphate deaminase 3.5.99.6 COO72_RS08105 CPA40_RS05730 BCAL_RS02710 Glutaminefructose-6-phosphate transaminase (isomerizing) 2.6.1.16 COO72_RS05020 CPA40_RS04675 BCAL_RS02180 Non-reducing end - l -arabinofuranosidase 3.2.1.55 COO72_RS05470 CPA40_RS04135 BCAL_RS02145 Glucose-6-phosphate isomerase 5.3.1.9 COO72_RS12210 CPA40_RS08670 BCAL_RS05265 UDP-glucose 6-dehydrogenase 1.1.1.22 COO72_RS07800 CPA40_RS09840 BCAL_RS07900 Phosphoglucomutase (-...”

BF3116 glucosamine-6-phosphate isomerase from Bacteroides fragilis YCH46
34% identity, 27% coverage

• Solution structure of 4'-phosphopantetheine - GmACP3 from Geobacter metallireducens: a specialized acyl carrier protein with atypical structural features and a putative role in lipopolysaccharide biosynthesis
  Ramelot, Biochemistry 2011
  • “...(GAU_0573), Pseudomonas stutzeri (PST_2875), Psychromonas ingrahamii (Ping_1634), Rhodobacter sphaeroides (RSP_1534), Solibacter usitatus (Acid_6044), Bacteroides fragilis (BF3116), and Sinorhizobium meliloti (SMc01553). Alignments were created with ClustalW2 ( 71 ). The consensus sequence WDSLxH/N is indicated by asterisks (*). FIGURE 2 4-PP chemical shifts. NMR assigned resonances in...”

Q8AB53 Putative glucosamine-6-phosphate deaminase-like protein BT_0258 from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
BT0258, BT_0258 glucosamine-6-phosphate isomerase from Bacteroides thetaiotaomicron VPI-5482
33% identity, 27% coverage

• Pre-existing antibodies targeting a linear epitope on SARS-CoV-2 S2 cross-reacted with commensal gut bacteria and shaped vaccine induced immunity
  Jia, 2021
• Discovery of β-1,4-D-mannosyl-N-acetyl-D-glucosamine phosphorylase involved in the metabolism of N-glycans
  Nihira, The Journal of biological chemistry 2013
  • “...reaction of hexokinase (BT2430) and D-glucosamine 6-phosphate deaminase (BT0258, BT3587, or BT4127) to enter the glycolysis. SEPTEMBER 20, 2013 * VOLUME 288 *...”

MSMEG_0501 glucosamine-6-phosphate deaminase 1 from Mycobacterium smegmatis str. MC2 155
36% identity, 72% coverage

• A genomic view of sugar transport in Mycobacterium smegmatis and Mycobacterium tuberculosis
  Titgemeyer, Journal of bacteriology 2007
  • “...ribonucleosides, ribitol, or xylitol (Table 1). (i) -Glucosides (msmeg_0501 to msmeg_0508). The first sugar transport cluster in the genome contains genes for a...”
  • “...specificities of the transporters encoded within the loci msmeg_0501 to msmeg_0508 and msmeg_0509 to msmeg_0518 are not known. Growth of bacteria on...”

Bbr_0169 glucosamine-6-phosphate deaminase from Bifidobacterium breve UCC2003
33% identity, 65% coverage

• Carbohydrate Syntrophy enhances the establishment of Bifidobacterium breve UCC2003 in the neonatal gut
  O'Connell, Scientific reports 2018
  • “...7.60 3.11 Bbr_0167 ABC transport system ATP-binding protein 7.57 Bbr_0168 nanA N-acetylneuraminate lyase 20.35 4.7 Bbr_0169 Glucosamine-6-phosphate isomerase 9.00 Bbr_0171 Sialidase A 4.49 Bbr_0172 ATPase nag genes and metabolism of sulphated sugars Bbr_0846 nagA1 N-acetylglucosamine-6-phosphate deacetylase 2.0 Bbr_0847 nagB2 Glucosamine-6-phosphate isomerase 3.78 Bbr_0851 Glucose/fructose transport protein...”
• Metabolism of sialic acid by Bifidobacterium breve UCC2003
  Egan, Applied and environmental microbiology 2014
  • “...glucosamine-6-phosphate deaminase-encoding gene nagB1 (Bbr_0169), and N-acetylglucosamine-6-phosphate deacetylase-encoding gene nagA2 (Bbr_1247) were generated...”
  • “...(nanC) Bbr_0166 (nanD) Bbr_0167 (nanF) Bbr_0168 (nanA) Bbr_0169 (nagB1) Bbr_0171 (nanH) Bbr_0172 Bbr_1247 (nagA2) Bbr_1248 (nagB3) a 37.32 59.01 49.91 51.55...”

LMOSA_3160 glucosamine-6-phosphate deaminase from Listeria monocytogenes str. Scott A
31% identity, 73% coverage

• High-pressure processing-induced transcriptome response during recovery of Listeria monocytogenes
  Duru, BMC genomics 2021
  • “...and nagB (LMOSA_18470) homologues at early time points. However, the second nagB homologue of ScottA (LMOSA_3160) was not upregulated (Fig. 3 a, 4 a). We also focused on mechanosensitive channel genes. The gene encoding a putative mechanosensitive channel gene of large conductance ( mscL ) was...”

OCPFDLNE_02454 glucosamine-6-phosphate deaminase from Listeria monocytogenes
31% identity, 73% coverage

• High-pressure processing-induced transcriptome response during recovery of Listeria monocytogenes
  Duru, BMC genomics 2021
  • “...f and 4 f). Upregulation of nagA (OCPFDLNE_01016) and two separate nagB genes (OCPFDLNE_01017 and OCPFDLNE_02454) was observed in RO15 at all time points. Similarly, ScottA showed upregulation of the nagA (LMOSA_18460) and nagB (LMOSA_18470) homologues at early time points. However, the second nagB homologue of...”
  • “...nagA was not differentially expressed in either strains. Interestingly, the second copy of nagB gene (OCPFDLNE_02454) was only upregulated in RO15. This difference might partly explain the barotolerance difference between strains. Increasing protein levels of the NagB are associated with increased growth rate in E. coli...”

lmo0877 similar to B. subtilis NagB protein (glucosamine-6-phosphate isomerase) from Listeria monocytogenes EGD-e
29% identity, 74% coverage

• Prebiotic Oligosaccharides Potentiate Host Protective Responses against L. Monocytogenes Infection
  Chen, Pathogens (Basel, Switzerland) 2017
  • “...biosynthesis 0.039 Energy metabolism Degradation/Utilization/Assimilation 0.026 gltD, aspB , lmo0347, lmo2696, lmo1057, lmo2648, lmo2836, lmo1463, lmo0877, lmo1182, lmo0383, lmo2101, lmo2749, lmo0372, lmo0917, lmo2771, lmo2840, lmo1915, lmo2362, lmo2095, lmo2835 Secondary metabolite degradation Taxiphyllin bioactivation 0.028 lmo0372, lmo0917, lmo2771 Nitrogen Containing Glucosides Degradation 0.028 Cyanogenic Glucosides Degradation 0.028...”
• Genome-wide analyses reveal lineage specific contributions of positive selection and recombination to the evolution of Listeria monocytogenes
  Orsi, BMC evolutionary biology 2008
  • “..., lmo1790 , lmo2262 , pepC , lmo2391 , trxB , lmo0190 , lmo0860 , lmo0877 , lmo1087 , proA , lmo0992 , smbA , lmo1401 , lmo1420 , opuCC , trpD , lmo1693 , purK , lmo1825 , panB , lmo0028 , lmo2175 , lmo2348...”
  • “..., pepC ( lmo2338 ), lmo2391 , trxB ( lmo2478 ), lmo0190 , lmo0860 , lmo0877 , lmo1087 , proA ( lmo1259 ), lmo0992 , smbA ( lmo1313 ), lmo1401 , lmo1420 , opuCC ( lmo1426 ), trpD ( lmo1631 ), lmo1693 , purK ( lmo1774...”
• Glycerol metabolism and PrfA activity in Listeria monocytogenes
  Joseph, Journal of bacteriology 2008
  • “...lmo0859 lmo0860 lmo0861 lmo0862 lmo0865 lmo0875 lmo0876 lmo0877 lmo0878 lmo0880 lmo0913b lmo0914 lmo0915b lmo0916 lmo0917 lmo0956 lmo0957 lmo0979 lmo1034...”

PGN_0606 glucosamine-6-phosphate isomerase from Porphyromonas gingivalis ATCC 33277
31% identity, 24% coverage

• A two-component system regulates hemin acquisition in Porphyromonas gingivalis
  Scott, PloS one 2013
  • “...Methylmalonyl-CoA mutase small subunit xx xx x PGN_0556 Putative cobalamin biosynthesis-related protein x xx x PGN_0606 Glucosamine-6-phosphate deaminase-like protein xxx xx x PGN_1530 2-oxoglutarate ferredoxin oxidoreductase subunit xx x x Signaling PGN_0753 Response regulator x xx PGN_0904 Probable sensor kinase x x Phage integrase/recombinase PGN_0385 Putative...”

I7C3V5 glucosamine-6-phosphate deaminase (EC 3.5.99.6) from Gallus gallus (see paper)
52% identity, 37% coverage

BT3587 glucosamine-6-phosphate isomerase from Bacteroides thetaiotaomicron VPI-5482
30% identity, 67% coverage

• Discovery of β-1,4-D-mannosyl-N-acetyl-D-glucosamine phosphorylase involved in the metabolism of N-glycans
  Nihira, The Journal of biological chemistry 2013
  • “...of hexokinase (BT2430) and D-glucosamine 6-phosphate deaminase (BT0258, BT3587, or BT4127) to enter the glycolysis. SEPTEMBER 20, 2013 * VOLUME 288 * NUMBER 38...”

U5LV87 glucosamine-6-phosphate deaminase (EC 3.5.99.6) from Gallus gallus (see paper)
51% identity, 37% coverage

KPN_04126 hypothetical protein from Klebsiella pneumoniae subsp. pneumoniae MGH 78578
30% identity, 65% coverage

• Fate of the H-NS-repressed bgl operon in evolution of Escherichia coli
  Sankar, PLoS genetics 2009
  • “...outer membrane porin in cryptic operon (KPN_04128), yieL putative xylanase (KPN_04127), yieK putative uncharacterized protein (KPN_04126). For Enterobacter : Ent638_2738 RND efflux system, outer membrane lipoprotein, Ent638_2739 glycoside hydrolase, family 1, Ent638_2740 PTS system, -glucoside-specific IIABC, Ent638_2741 transcriptional antiterminator, BglG, and Ent638_2742 dihydrouridine synthase, DuS. For...”

VK055_3349 glucosamine-6-phosphate deaminase from Klebsiella pneumoniae subsp. pneumoniae
30% identity, 65% coverage

• A novel esterase regulates Klebsiella pneumoniae hypermucoviscosity and virulence
  Wang, PLoS pathogens 2024
  • “...investigating the VK055_3347 locus. Genomic analysis suggested that the VK055_3347, VK055_3348 ( kpACE ), and VK055_3349 constitute a gene locus ( Fig 1A ), so we investigated their individual and collective effects on mucoviscosity. qRT-PCR data demonstrated that the transcriptional levels of VK055_3347, kpACE , VK055_3349,...”
  • “...derivative carrying plasmid expressing VK055_4943 (p4943), VK055_3347 locus (p3347 locus), VK055_3347 (p3347), kpACE (pkpACE), and VK055_3349 (p3349), respectively. (D-G) Effects of kpACE overexpression on virulence in a pneumonia model using both female and male mice. (D) Survival rates of mice infected by K . pneumoniae variants....”

SSU0206 glucosamine-6-phosphate isomerase from Streptococcus suis P1/7
34% identity, 46% coverage

• Rapid evolution of virulence and drug resistance in the emerging zoonotic pathogen Streptococcus suis
  Holden, PloS one 2009
  • “...and include: a transporter cluster (SSU0039 to SSU0044), a putative endopeptidase (SSU0152), a glucosamine-6-phosphate isomerase (SSU0206), a putative lipase (SSU0304), a putative deoxyguanosinetriphosphate triphosphohydrolase (SSU0327), capsule associated CDSs (SSU0520 to SSU0529), a UDP-galactopyranose mutase (SSU0563), a MATE family transporter (SSU0573), EPS associated CDSs (SSU1115, SSU1125 and...”

CTN_RS07115 6-phosphogluconolactonase from Thermotoga neapolitana DSM 4359
28% identity, 59% coverage

• CO₂-Induced Transcriptional Reorganization: Molecular Basis of Capnophillic Lactic Fermentation in Thermotoga neapolitana
  d'Ippolito, Frontiers in microbiology 2020
  • “...central carbon metabolism revealed a significant transcription of glucose-6-phosphate dehydrogenase (G6PDH CTN_RS07110) and 6-phosphogluconolactonase (6PGL CTN_RS07115). These enzymes preside over the synthesis of 6-phospho gluconate that is the first metabolite of the main alternative pathways of glucose catabolism, namely ED and oxidative pentose phosphate (OPP) pathway....”
  • “...aka Enolase CTN_RS02350 1.80 Pyruvate kinase OPP and EntnerDoudoroff common enzymes CTN_RS07110 4.84 Glucose-6-phosphate 1-dehydrogenase CTN_RS07115 5.50 6-Phosphogluconolactonase EntnerDoudoroff CTN_RS00550 5.83 6-Phosphogluconate dehydratase a CTN_RS03140 1.26 2-Dehydro-3-deoxyphosphogluconate aldolase OPP CTN_RS01150 1.40 6-Phosphogluconate dehydrogenase. Decarboxylating CTN_RS04470 1.64 Ribulose-phosphate-epimerase CTN_RS07445 NDE Ribose-5-phosphate isomerase CTN_RS04700 1.81 Transketolase CTN_RS08090 1.60...”

EF0451 glucosamine-6-phosphate isomerase, putative from Enterococcus faecalis V583
25% identity, 72% coverage

• Survey of genomic diversity among Enterococcus faecalis strains by microarray-based comparative genomic hybridization
  Aakra, Applied and environmental microbiology 2007
  • “...EF0954-EF0958 EF0411-EF0413 EF0020 EF0021 EF0022 EF2589 (manA) EF0451 EF0466 (nagB) EF3044 (nagA2) EF0433 EF0434 (rhaA) EF0435 (rhaD) EF1243 EF0197 (rpiA)...”

sll1479 glucose-6-P-dehydrogenase from Synechocystis sp. PCC 6803
23% identity, 60% coverage

• Towards the rate limit of heterologous biotechnological reactions in recombinant cyanobacteria
  Barone, Biotechnology for biofuels and bioproducts 2023
  • “...coding for OPPp enzymes have been observed as upregulated: tktA ( sll1070 ), devB ( sll1479 ), and cfxE ( sll0807 ). In the later light period, the upregulation of rpiA was noted [ slr0194 , encoding the ribose 5-phosphate isomerase (RPI)] [ 34 ]. Nevertheless,...”
• Diurnal Regulation of Cellular Processes in the Cyanobacterium Synechocystis sp. Strain PCC 6803: Insights from Transcriptomic, Fluxomic, and Physiological Analyses
  Saha, mBio 2016
  • “...cycle under autotrophic conditions. Genes such as tktA ( sll1070 ), encoding transketolase, devB ( sll1479 ), encoding 6-phosphogluconolactonase, and cfxE ( sll0807 ), encoding pentose-5-phosphate-3-epimerase, were upregulated in the earlier light period (with peaks at L1), while rpiA ( slr0194 ), encoding ribose 5-phosphate isomerase,...”
• Time-course analysis of cyanobacterium transcriptome: detecting oscillatory genes
  Layana, PloS one 2011
  • “...strongly synchronized between replicates. In group F (top panels) the genes sll0329 (30), sll1196 (31), sll1479 (33), slr0884 (36), slr1734 (38), slr1793 (39) and slr1843 (40) are synchronized between experiments. Furthermore, genes sll0329, sll1196 and slr1793 are almost co-expressed in both experiments. In group H (medium...”
  • “...sll1196 * Phosphofructokinase Glycolysis 32 F sll1234 # Adenosylhomocysteinase Amino acids and amines 33 F sll1479 * 6-phosphogluconolactonase Pentose phosphate pathway 34 F slr0301 Phosphoenolpyruvate synthase Pyruvate metabolism 35 F slr0394 # Phosphoglycerate kinase Glycolysis 36 F slr0884 * , # GAPDH 1 Glycolysis 37 F...”
• Global analysis of circadian expression in the cyanobacterium Synechocystis sp. strain PCC 6803
  Kucho, Journal of bacteriology 2005
  • “...slr0646 sll1898 2.8 3.2 6 9 2.5 2.8 9 9 2.6 3.0 8 9 sll1479 sll0242 sll1899 sll1461 slr0884 1.4 1.4 2.6 1.6 2.6 9 9 9 11 9 1.9 1.6 2.5 1.7 3.0 10 11 11 10 12...”
  • “...circadian expression patterns: 6-phosphogluconolactonase (Glc, sll1479), transaldolase (TalB, slr1793), and the rate-limiting NADPH-producing enzymes...”

YraG / b3141 putative deaminase AgaI from Escherichia coli K-12 substr. MG1655 (see 6 papers)
AGAI_ECOLI / P42912 Putative deaminase AgaI; EC 3.5.99.- from Escherichia coli (strain K12) (see paper)
NP_417610 putative deaminase AgaI from Escherichia coli str. K-12 substr. MG1655
b3141 galactosamine-6-phosphate isomerase from Escherichia coli str. K-12 substr. MG1655
24% identity, 69% coverage

• disruption phenotype: Deletion of the gene does not affect growth on N- acetyl-D-galactosamine, D-galactosamine or N-acetyl-D-glucosamine.
• Genetic analysis of the roles of agaA, agaI, and agaS genes in the N-acetyl-D-galactosamine and D-galactosamine catabolic pathways in Escherichia coli strains O157:H7 and C.
  Hu, BMC microbiology 2013
  • GeneRIF: The agaI, nagB, and agaI nagB mutants were not affected in Aga and D-galactosamine utilization indicating that neither agaI nor nagB is involved in the deamination and isomerization of D-galactosamine-6-P.
• luxS-dependent gene regulation in Escherichia coli K-12 revealed by genomic expression profiling
  Wang, Journal of bacteriology 2005
  • “...b2060 b0790 b1720 b1010 b2797 b2993 b0042 b1001 b2549 b1311 b3141 b1012 b1571 lsrG lsrD lsrA lsrB metE lsrF lsrK yneE yfaE tam yjhR lsrR lsrC gpmB argX ileT...”
• An expanded genome-scale model of Escherichia coli K-12 (iJR904 GSM/GPR)
  Reed, Genome biology 2003
  • “...3.1.1.31 b0678 nagB Glucosamine-6-phosphate deaminase 6-Phosphogluconolactonase (Pgl) 3.1.1.31 b3718 yieK Putative isomerase 6-Phosphogluconolactonase (Pgl) 3.1.1.31 b3141 agaI Putative galactosamine-6-phosphate isomerase 6-Phosphogluconolactonase (Pgl) 3.2.1.68 b3431 glgX Glycosyl hydrolase Isoamylase 3.5.1.2 b1524 yneH Putative glutaminase Glutaminase A or B 3.5.1.2 b0485 ybaS Putative glutaminase Glutaminase A or B...”

alr1602 glucose-6-P-dehydrogenase from Nostoc sp. PCC 7120
23% identity, 65% coverage

• FraH is required for reorganization of intracellular membranes during heterocyst differentiation in Anabaena sp. strain PCC 7120
  Merino-Puerto, Journal of bacteriology 2011
  • “...cyanobacteria. In Anabaena sp. strain PCC 7120, both genes, alr1602 and alr1603 (fraH), can be expressed as independent transcripts as well as in a common...”

SF3739 orf, conserved hypothetical protein from Shigella flexneri 2a str. 301
29% identity, 62% coverage

• Emergence of a new multidrug-resistant serotype X variant in an epidemic clone of Shigella flexneri
  Ye, Journal of clinical microbiology 2010
  • “...SF2067 SF2133 SF2135 SF2136 SF2137 SF2463 SF2611 SF2718 SF3737 SF3738 SF3739 SF3744 SF3745 SF4175 a b c ycgY yegE yehC tatE csgC celF ydjC katE ydjO yeeX alkA...”

YieK / b3718 putative glucosamine-6-phosphate deaminase YieK from Escherichia coli K-12 substr. MG1655 (see 2 papers)
b3718 hypothetical protein from Escherichia coli str. K-12 substr. MG1655
29% identity, 62% coverage

• An expanded genome-scale model of Escherichia coli K-12 (iJR904 GSM/GPR)
  Reed, Genome biology 2003
  • “...Putative acetyl-CoA:acetoacetyl-CoA transferase alpha subunit Acetate CoA-transferase 3.1.1.31 b0678 nagB Glucosamine-6-phosphate deaminase 6-Phosphogluconolactonase (Pgl) 3.1.1.31 b3718 yieK Putative isomerase 6-Phosphogluconolactonase (Pgl) 3.1.1.31 b3141 agaI Putative galactosamine-6-phosphate isomerase 6-Phosphogluconolactonase (Pgl) 3.2.1.68 b3431 glgX Glycosyl hydrolase Isoamylase 3.5.1.2 b1524 yneH Putative glutaminase Glutaminase A or B 3.5.1.2 b0485...”

New Search

Statistics

How It Works

PaperBLAST builds a database of protein sequences that are linked to scientific articles. These links come from automated text searches against the articles in EuropePMC and from manually-curated information from GeneRIF, UniProtKB/Swiss-Prot, BRENDA, CAZy (as made available by dbCAN), BioLiP, CharProtDB, MetaCyc, EcoCyc, TCDB, REBASE, the Fitness Browser, and a subset of the European Nucleotide Archive with the /experiment tag. Given this database and a protein sequence query, PaperBLAST uses protein-protein BLAST to find similar sequences with E < 0.001.

To build the database, we query EuropePMC with locus tags, with RefSeq protein identifiers, and with UniProt accessions. We obtain the locus tags from RefSeq or from MicrobesOnline. We use queries of the form "locus_tag AND genus_name" to try to ensure that the paper is actually discussing that gene. Because EuropePMC indexes most recent biomedical papers, even if they are not open access, some of the links may be to papers that you cannot read or that our computers cannot read. We query each of these identifiers that appears in the open access part of EuropePMC, as well as every locus tag that appears in the 500 most-referenced genomes, so that a gene may appear in the PaperBLAST results even though none of the papers that mention it are open access. We also incorporate text-mined links from EuropePMC that link open access articles to UniProt or RefSeq identifiers. (This yields some additional links because EuropePMC uses different heuristics for their text mining than we do.)

For every article that mentions a locus tag, a RefSeq protein identifier, or a UniProt accession, we try to select one or two snippets of text that refer to the protein. If we cannot get access to the full text, we try to select a snippet from the abstract, but unfortunately, unique identifiers such as locus tags are rarely provided in abstracts.

PaperBLAST also incorporates manually-curated protein functions:

• Proteins from NCBI's RefSeq are included if a GeneRIF entry links the gene to an article in PubMed^®. GeneRIF also provides a short summary of the article's claim about the protein, which is shown instead of a snippet.
• Proteins from Swiss-Prot (the curated part of UniProt) are included if the curators identified experimental evidence for the protein's function (evidence code ECO:0000269). For these proteins, the fields of the Swiss-Prot entry that describe the protein's function are shown (with bold headings).
• Proteins from BRENDA, a curated database of enzymes, are included if they are linked to a paper in PubMed and their full sequence is known.
• Every protein from the non-redundant subset of BioLiP, a database of ligand-binding sites and catalytic residues in protein structures, is included. Since BioLiP itself does not include descriptions of the proteins, those are taken from the Protein Data Bank. Descriptions from PDB rely on the original submitter of the structure and cannot be updated by others, so they may be less reliable. (For SitesBLAST and Sites on a Tree, we use a larger subset of BioLiP so that every ligand is represented among a group of structures with similar sequences, but for PaperBLAST, we use the non-redundant set provided by BioLiP.)
• Every protein from EcoCyc, a curated database of the proteins in Escherichia coli K-12, is included, regardless of whether they are characterized or not.
• Proteins from the MetaCyc metabolic pathway database are included if they are linked to a paper in PubMed and their full sequence is known.
• Proteins from the Transport Classification Database (TCDB) are included if they have known substrate(s), have reference(s), and are not described as uncharacterized or putative. (Some of the references are not visible on the PaperBLAST web site.)
• Every protein from CharProtDB, a database of experimentally characterized protein annotations, is included.
• Proteins from the CAZy database of carbohydrate-active enzymes are included if they are associated with an Enzyme Classification number. Even though CAZy does not provide links from individual protein sequences to papers, these should all be experimentally-characterized proteins.
• Proteins from the REBASE database of restriction enzymes are included if they have known specificity.
• Every protein with an evidence-based reannotation (based on mutant phenotypes) in the Fitness Browser is included.
• Sequence-specific transcription factors (including sigma factors and DNA-binding response regulators) with experimentally-determined DNA binding sites from the PRODORIC database of gene regulation in prokaryotes.
• Putative transcription factors from RegPrecise that have manually-curated predictions for their binding sites. These predictions are based on conserved putative regulatory sites across genomes that contain similar transcription factors, so PaperBLAST clusters the TFs at 70% identity and retains just one member of each cluster.
• Coding sequence (CDS) features from the European Nucleotide Archive (ENA) are included if the /experiment tag is set (implying that there is experimental evidence for the annotation), the nucleotide entry links to paper(s) in PubMed, and the nucleotide entry is from the STD data class (implying that these are targeted annotated sequences, not from shotgun sequencing). Also, to filter out genes whose transcription or translation was detected, but whose function was not studied, nucleotide entries or papers with more than 25 such proteins are excluded. Descriptions from ENA rely on the original submitter of the sequence and cannot be updated by others, so they may be less reliable.

Except for GeneRIF and ENA, the curated entries include a short curated description of the protein's function. For entries from BioLiP, the protein's function may not be known beyond binding to the ligand. Many of these entries also link to articles in PubMed.

For more information see the PaperBLAST paper (mSystems 2017) or the code. You can download PaperBLAST's database here.

Changes to PaperBLAST since the paper was written:

• November 2023: incorporated PRODORIC and RegPrecise. Many PRODORIC entries were not linked to a protein sequence (no UniProt identifier), so we added this information.
• February 2023: BioLiP changed their download format. PaperBLAST now includes their non-redundant subset. SitesBLAST and Sites on a Tree use a larger non-redundant subset that ensures that every ligand is represented within each cluster. This should ensure that every binding site is represented.
• June 2022: incorporated some coding sequences from ENA with the /experiment tag.
• March 2022: incorporated BioLiP.
• April 2020: incorporated TCDB.
• April 2019: EuropePMC now returns table entries in their search results. This has expanded PaperBLAST's database, but most of the new entries are of low relevance, and the resulting snippets are often just lists of locus tags with annotations.
• February 2018: the alignment page reports the conservation of the hit's functional sites (if available from from Swiss-Prot or UniProt)
• January 2018: incorporated BRENDA.
• December 2017: incorporated MetaCyc, CharProtDB, CAZy, REBASE, and the reannotations from the Fitness Browser.
• September 2017: EuropePMC no longer returns some table entries in their search results. This has shrunk PaperBLAST's database, but has also reduced the number of low-relevance hits.

Many of these changes are described in Interactive tools for functional annotation of bacterial genomes.

Secrets

PaperBLAST cannot provide snippets for many of the papers that are published in non-open-access journals. This limitation applies even if the paper is marked as "free" on the publisher's web site and is available in PubmedCentral or EuropePMC. If a journal that you publish in is marked as "secret," please consider publishing elsewhere.

Omissions from the PaperBLAST Database

Many important articles are missing from PaperBLAST, either because the article's full text is not in EuropePMC (as for many older articles), or because the paper does not mention a protein identifier such as a locus tag, or because of PaperBLAST's heuristics. If you notice an article that characterizes a protein's function but is missing from PaperBLAST, please notify the curators at UniProt or add an entry to GeneRIF. Entries in either of these databases will eventually be incorporated into PaperBLAST. Note that to add an entry to UniProt, you will need to find the UniProt identifier for the protein. If the protein is not already in UniProt, you can ask them to create an entry. To add an entry to GeneRIF, you will need an NCBI Gene identifier, but unfortunately many prokaryotic proteins in RefSeq do not have corresponding Gene identifers.

References

PaperBLAST: Text-mining papers for information about homologs.
M. N. Price and A. P. Arkin (2017). mSystems, 10.1128/mSystems.00039-17.

Europe PMC in 2017.
M. Levchenko et al (2017). Nucleic Acids Research, 10.1093/nar/gkx1005.

Gene indexing: characterization and analysis of NLM's GeneRIFs.
J. A. Mitchell et al (2003). AMIA Annu Symp Proc 2003:460-464.

UniProt: the universal protein knowledgebase.
The UniProt Consortium (2016). Nucleic Acids Research, 10.1093/nar/gkw1099.

BRENDA in 2017: new perspectives and new tools in BRENDA.
S. Placzek et al (2017). Nucleic Acids Research, 10.1093/nar/gkw952.

The EcoCyc database: reflecting new knowledge about Escherichia coli K-12.
I. M. Keeseler et al (2016). Nucleic Acids Research, 10.1093/nar/gkw1003.

The MetaCyc database of metabolic pathways and enzymes.
R. Caspi et al (2018). Nucleic Acids Research, 10.1093/nar/gkx935.

CharProtDB: a database of experimentally characterized protein annotations.
R. Madupu et al (2012). Nucleic Acids Research, 10.1093/nar/gkr1133.

The carbohydrate-active enzymes database (CAZy) in 2013.
V. Lombard et al (2014). Nucleic Acids Research, 10.1093/nar/gkt1178.

The Transporter Classification Database (TCDB): recent advances
M. H. Saier, Jr. et al (2016). Nucleic Acids Research, 10.1093/nar/gkv1103.

REBASE - a database for DNA restriction and modification: enzymes, genes and genomes.
R. J. Roberts et al (2015). Nucleic Acids Research, 10.1093/nar/gku1046.

Deep annotation of protein function across diverse bacteria from mutant phenotypes.
M. N. Price et al (2016). bioRxiv, 10.1101/072470.