PaperBLAST

PaperBLAST Hits for REBASE::M.EcoAI Type I methyltransferase recognizing GAGNNNNNNNGTCA with methylation at 2(m6A),-3(m6A) (Escherichia coli 15T-) (489 a.a., MSISSVIKSL...)

Show query sequence

>REBASE::M.EcoAI Type I methyltransferase recognizing GAGNNNNNNNGTCA with methylation at 2(m6A),-3(m6A) (Escherichia coli 15T-)
MSISSVIKSLQDIMRKDAGVDGDAHGLGQLSWLLFLKIFDAQEEALELEQDNYQYPIPQR
YLWRSWAANAQGITGDSLLEFVNDDLFPALKNLTAPIDKNPRGYVVKQAFSDAYNYMKNG
TLLRQVINKLNEIDFTSASERHLFGDIYEQILKDLQSAGNAGEFYTPRAVTRFMVDRVDP
KLGESIMDPACGTGGFLACAFDHVKNKYVKSVADHQTLQQQIHGVEKKQLPHLLATTNML
LHGIEVPVQIRHDNTLNKPLSSWDEQLDVIVTNPPFGGTEEDGIEKNFPAEMQTRETADL
FLQLIVEVLAKNGRAAVVLPDGTLFGEGVKTKIKKLLTEECNLHTIVRLPNGVFNPYTGI
KTNLLFFTKGQPTKEIWFYEHPYPAGVKNYSKTKPMKFEEFQAEIDWWGNEADGFASRVE
NEQAWKVSIDDVIARNFNLDIKNPHQAETVSHDPDELLAQYAKQQAEIQTLRNQLRDILG
AALSVKEVN

Running BLASTp...

Found 251 similar proteins in the literature:

M.EcoAI Type I methyltransferase recognizing GAGNNNNNNNGTCA with methylation at 2(m6A),-3(m6A) from Escherichia coli 15T-
100% identity, 100% coverage

M.Eco9022I Type I methyltransferase recognizing GAGNNNNNNNGTCA with methylation at 2(m6A),-3(m6A) from Escherichia coli NCTC9022
M.Eco10430I Type I methyltransferase recognizing GAGNNNNNNNGTCA with methylation at 2(m6A),-3(m6A) from Escherichia coli NCTC10430
M.EcoJA17PI Type I methyltransferase recognizing GAGNNNNNNNGTCA with methylation at 2(m6A),-3(m6A) from Escherichia coli UCD_JA17_pb
M.EcoJA23PI Type I methyltransferase recognizing GAGNNNNNNNGTCA with methylation at 2(m6A),-3(m6A) from Escherichia coli UCD_JA23_pb
100% identity, 98% coverage

M.EcoCFTI Type I methyltransferase recognizing GAGNNNNNNNGTCA with methylation at 2(m6A),-3(m6A) from Escherichia coli CFT073
c5424 Putative restriction modification enzyme M subunit from Escherichia coli CFT073
100% identity, 96% coverage

• Antimicrobial activity of CHIR-090, an inhibitor of lipopolysaccharide biosynthesis, against the Burkholderia cepacia complex
  Bodewits, Antimicrobial agents and chemotherapy 2010

M.Eco9006I Type I methyltransferase recognizing GAGNNNNNNNGTCA with methylation at 2(m6A),-3(m6A) from Escherichia coli NCTC9006
M.Eco11100II Type I methyltransferase recognizing GAGNNNNNNNGTCA with methylation at 2(m6A),-3(m6A) from Escherichia coli NCTC11100
M.EcoC9110I Type I methyltransferase recognizing GAGNNNNNNNGTCA with methylation at 2(m6A),-3(m6A) from Escherichia coli NCTC9110
M.EcoOS170II Type I methyltransferase recognizing GAGNNNNNNNGTCA with methylation at 2(m6A),-3(m6A) from Escherichia coli FDAARGOS_170
100% identity, 100% coverage

M.Sbo1621I Type I methyltransferase recognizing GTANNNNNNNNGTCY with methylation at 3(m6A),-3(m6A) from Shigella boydii 54-1621
M.Sfl29903I Type I methyltransferase recognizing GTANNNNNNNNGTCY with methylation at ?(m6A),-3(m6A) from Shigella flexneri 2a
M.Sfl3008I Type I methyltransferase recognizing GTANNNNNNNNGTCY with methylation at 3(m6A),-3(m6A) from Shigella flexneri 95-3008
M.Sfl3063I Type I methyltransferase recognizing GTANNNNNNNNGTCY with methylation at 3(m6A),-3(m6A) from Shigella flexneri Y 93-3063
M.Sfl3193I Type I methyltransferase recognizing GTANNNNNNNNGTCY with methylation at 3(m6A),-3(m6A) from Shigella flexneri 98-3193
M.Sfl43145I Type I methyltransferase recognizing GTANNNNNNNNGTCY with methylation at 3(m6A),-3(m6A) from Shigella flexneri 04-3145
M.Sfl614982I Type I methyltransferase recognizing GTANNNNNNNNGTCY with methylation at 3(m6A),-3(m6A) from Shigella flexneri 61-4982
M.Sfl735612I Type I methyltransferase recognizing GTANNNNNNNNGTCY with methylation at 3(m6A),-3(m6A) from Shigella flexneri 73-5612
M.Sfl741170I Type I methyltransferase recognizing GTANNNNNNNNGTCY with methylation at ?(m6A),-3(m6A) from Shigella flexneri 74-1170
M.Sfl9728I Type I methyltransferase recognizing GTANNNNNNNNGTCY with methylation at 3(m6A),-3(m6A) from Shigella flexneri NCTC 9728
99% identity, 98% coverage

M.Sbo2708I Type I methyltransferase recognizing RTCANNNNNNNNRTRTC with methylation at 4(m6A),-4(m6A) from Shigella boydii 59-2708
M.Sbo12034II Type I methyltransferase recognizing RTCANNNNNNNNRTRTC with methylation at 4(m6A),-4(m6A) from Shigella boydii ATCC 12034
M.Sbo35964I Type I methyltransferase recognizing RTCANNNNNNNNRTRTC with methylation at 4(m6A),-4(m6A) from Shigella boydii ATCC 35964
M.Sbo35965II Type I methyltransferase recognizing RTCANNNNNNNNRTRTC with methylation at 4(m6A),-4(m6A) from Shigella boydii ATCC 35965
M.Sbo9733I Type I methyltransferase recognizing RTCANNNNNNNNRTRTC with methylation at 4(m6A),-4(m6A) from Shigella boydii NCTC 9733
M.Sbo9734I Type I methyltransferase recognizing RTCANNNNNNNNRTRTC with methylation at 4(m6A),-4(m6A) from Shigella boydii NCTC 9734
M.Sdy10954I Type I methyltransferase recognizing RTCANNNNNNNNRTRTC with methylation at 4(m6A),-4(m6A) from Shigella dysenteriae CFSAN010954
M.Sdy49345I Type I methyltransferase recognizing RTCANNNNNNNNRTRTC with methylation at 4(m6A),-4(m6A) from Shigella dysenteriae E670/74
99% identity, 98% coverage

M.Eco11022II Type I methyltransferase recognizing CAAYNNNNNNNATGC with methylation at 3(m6A),-3(m6A) from Escherichia coli NCTC11022
99% identity, 100% coverage

M.EcoAO83I Type I methyltransferase recognizing GGANNNNNNNNATGC with methylation at ?(m6A) from Escherichia coli strain A0 34/86
M.EcoP001I Type I methyltransferase recognizing GGANNNNNNNNATGC with methylation at 3(m6A),-3(m6A) from Escherichia coli ERP001
99% identity, 98% coverage

M.Sfl89141I Type I methyltransferase recognizing GTANNNNNNNNGTCY with methylation at 3(m6A),-3(m6A) from Shigella flexneri 89-141
99% identity, 98% coverage

M.Eco06I Type I methyltransferase recognizing TTCANNNNNNNNCTGG with methylation at 4(m6A),-3(m6A) from Escherichia coli 06-00048
M.Eco09I Type I methyltransferase recognizing CCANNNNNNNNNTTGG with methylation at 3(m6A) from Escherichia coli 09-00049
M.Eco10766I Type I methyltransferase recognizing CAAYNNNNNNNNTGAG with methylation at 3(m6A),-4(m6A) from Escherichia coli NCTC10766
M.Eco1093I Type I methyltransferase recognizing CAAYNNNNNNNNTGAG with methylation at 3(m6A),-4(m6A) from Escherichia coli NCTC1093
M.Eco11151I Type I methyltransferase recognizing AAGNNNNNNNRTDCC with methylation at 2(m6A),-4(m6A) from Escherichia coli NCTC11151
M.Eco119I Type I methyltransferase recognizing CCANNNNNNNNNTTGG with methylation at 3(m6A),-4(m6A) from Escherichia coli AR_0119
M.Eco13II Type I methyltransferase recognizing CAAYNNNNNNNNTGAG with methylation at 3(m6A) from Escherichia coli AR_0013
M.Eco2747AI Type I methyltransferase recognizing CACNNNNNNNGTTG with methylation at 2(m6A),-3(m6A) from Escherichia coli ST2747A
M.Eco2747ANI Type I methyltransferase recognizing CACNNNNNNNGTTG with methylation at 2(m6A),-3(m6A) from Escherichia coli ST2747AN
M.Eco2747I Type I methyltransferase recognizing CACNNNNNNNGTTG with methylation at 2(m6A),-3(m6A) from Escherichia coli ST2747
M.Eco348I Type I methyltransferase recognizing RTCANNNNNNNNGTGG with methylation at 4(m6A),-3(m6A) from Escherichia coli O104:H4 FDAARGOS_348
M.Eco349I Type I methyltransferase recognizing RTCANNNNNNNNGTGG with methylation at 4(m6A),-3(m6A) from Escherichia coli O104:H4 FDAARGOS_349
M.Eco401I Type I methyltransferase recognizing RTCANNNNNNNNGTGG with methylation at 4(m6A),-3(m6A) from Escherichia coli FDAARGOS_401
M.Eco403I Type I methyltransferase recognizing RTCANNNNNNNNGTGG with methylation at 4(m6A),-3(m6A) from Escherichia coli FDAARGOS_403
M.Eco591I Type I methyltransferase recognizing CCANNNNNNNNNTTGG with methylation at 3(m6A),-4(m6A) from Escherichia coli CREC-591
M.Eco9002I Type I methyltransferase recognizing AAGNNNNNNNRTDCC with methylation at 2(m6A),-4(m6A) from Escherichia coli NCTC9002
M.Eco9007I Type I methyltransferase recognizing CAAYNNNNNNNNTGAG with methylation at 3(m6A),-4(m6A) from Escherichia coli NCTC9007
M.Eco9104II Type I methyltransferase recognizing CAAYNNNNNNNGTRC with methylation at 3(m6A),-3(m6A) from Escherichia coli NCTC9104
M.EcoA13I Type I methyltransferase recognizing CGAYNNNNNNNNTGCC with methylation at 3(m6A),-4(m6A) from Escherichia coli A13
M.EcoA15I Type I methyltransferase recognizing CCANNNNNNNNNTTGG with methylation at 3(m6A),-4(m6A) from Escherichia coli A15
M.EcoA26I Type I methyltransferase recognizing AAGNNNNNNNRTDCC with methylation at 2(m6A),-4(m6A) from Escherichia coli A26
M.EcoA34I Type I methyltransferase recognizing ACAYNNNNNNNRTRTC with methylation at 3(m6A) from Escherichia coli A34
M.EcoA3I Type I methyltransferase recognizing AAGNNNNNNNRTDCC with methylation at 2(m6A),-4(m6A) from Escherichia coli A3
M.EcoA6I Type I methyltransferase recognizing AAGNNNNNNNRTDCC with methylation at 2(m6A),-4(m6A) from Escherichia coli A6
M.EcoC9103I Type I methyltransferase recognizing CCANNNNNNNNNTTGG with methylation at 3(m6A),-4(m6A) from Escherichia coli NCTC9103
M.EcoG089II Type I methyltransferase recognizing CCANNNNNNNNNTTGG with methylation at 3(m6A),-4(m6A) from Escherichia coli GB089
M.EcoGIV Type I methyltransferase recognizing RTCANNNNNNNNGTGG with methylation at 4(m6A),-3(m6A) from Escherichia coli O104:H4 C227-11
M.EcoHBII Type I methyltransferase recognizing CCANNNNNNNNNTTGG with methylation at 3(m6A),-4(m6A) from Escherichia coli HB-Coli0
M.EcoOS402III Type I methyltransferase recognizing RTCANNNNNNNNGTGG with methylation at 4(m6A),-3(m6A) from Escherichia coli FDAARGOS_402
M.EcoOS437II Type I methyltransferase recognizing CCANNNNNNNNNTTGG with methylation at 3(m6A),-4(m6A) from Escherichia coli FDAARGOS_437
M.EcoS472I Type I methyltransferase recognizing AAGNNNNNNNCTGG with methylation at 2(m6A),-3(m6A) from Escherichia coli MSHS 472
M.Sfl12698I Type I methyltransferase recognizing GTANNNNNNNNGTCY with methylation at 3(m6A),-3(m6A) from Shigella flexneri NCTC12698
M.Sfl1508I Type I methyltransferase recognizing GTANNNNNNNNGTCY with methylation at 3(m6A),-3(m6A) from Shigella flexneri 2a 1508
M.Sfl394I Type I methyltransferase recognizing GTANNNNNNNNGTCY with methylation at 3(m6A),-3(m6A) from Shigella flexneri 1c Y394
M.Sfl74I Type I methyltransferase recognizing GTANNNNNNNNGTCY with methylation at 3(m6A),-3(m6A) from Shigella flexneri FDAARGOS_74
M.Sfl8524I Type I methyltransferase recognizing GTANNNNNNNNGTCY with methylation at 3(m6A),-3(m6A) from Shigella flexneri NCTC8524
M.Sfl877I Type I methyltransferase recognizing GTANNNNNNNNGTCY with methylation at 3(m6A),-3(m6A) from Shigella flexneri 2016AM-0877
M.SflNCTC2I Type I methyltransferase recognizing GTANNNNNNNNGTCY with methylation at 3(m6A),-3(m6A) from Shigella flexneri NCTC2
M.SflNCTC5I Type I methyltransferase recognizing GTANNNNNNNNGTCY with methylation at 3(m6A),-3(m6A) from Shigella flexneri NCTC5
99% identity, 100% coverage

M.EcoC9705I Type I methyltransferase recognizing RTCANNNNNNNNRTRTC with methylation at 4(m6A),-4(m6A) from Escherichia coli NCTC9705
M.Sdy2966I Type I methyltransferase recognizing RTCANNNNNNNNRTRTC with methylation at 4(m6A),-4(m6A) from Shigella dysenteriae NCTC2966
99% identity, 100% coverage

M.Sfl8520I Type I methyltransferase recognizing GTANNNNNNNNGTCY with methylation at 3(m6A),-3(m6A) from Shigella flexneri NCTC8520
M.Sfl9783I Type I methyltransferase recognizing GTANNNNNNNNGTCY with methylation at 3(m6A),-3(m6A) from Shigella flexneri NCTC9783
99% identity, 100% coverage

M.Eco9083I Type I methyltransferase recognizing GGANNNNNNNNATGC with methylation at 3(m6A),-3(m6A) from Escherichia coli NCTC9083
M.EcoA22I Type I methyltransferase recognizing GGANNNNNNNNATGC with methylation at 3(m6A),-3(m6A) from Escherichia coli A22
M.EcoNIH2I Type I methyltransferase recognizing GGANNNNNNNNATGC with methylation at 3(m6A),-3(m6A) from Escherichia coli ECONIH2
M.EcosA32I Type I methyltransferase recognizing GGANNNNNNNNATGC with methylation at 3(m6A),-3(m6A) from Escherichia coli A32
99% identity, 100% coverage

M.Sfl670I Type I methyltransferase recognizing GTANNNNNNNNGTCY with methylation at 3(m6A),-3(m6A) from Shigella flexneri 1a 0670
99% identity, 100% coverage

M.Eco11111I Type I methyltransferase recognizing AAAYNNNNNNNGTCY with methylation at 3(m6A),-3(m6A) from Escherichia coli NCTC11111
99% identity, 100% coverage

M.Eco10957I Type I methyltransferase recognizing GAGNNNNNNNATGC with methylation at 2(m6A),-3(m6A) from Escherichia coli NCTC10957
99% identity, 100% coverage

M.Eco9047I Type I methyltransferase recognizing AAGNNNNNNNRTTTC with methylation at 2(m6A),-4(m6A) from Escherichia coli NCTC9047
M.EcoA39I Type I methyltransferase recognizing AAGNNNNNNNRTTTC with methylation at 2(m6A),-4(m6A) from Escherichia coli A39
99% identity, 100% coverage

M.Eco299I Type I methyltransferase recognizing CGAYNNNNNNNRTDCC with methylation at 3(m6A),-4(m6A) from Escherichia coli STEC299
99% identity, 98% coverage

M.EcoC9120I Type I methyltransferase recognizing GGANNNNNNNNGTTA with methylation at 3(m6A),-3(m6A) from Escherichia coli NCTC9120
99% identity, 100% coverage

M.Eco8003II Type I methyltransferase recognizing GAANNNNNNNNGTGG with methylation at 3(m6A),-3(m6A) from Escherichia coli NCTC8003
M.Eco10959I Type I methyltransferase recognizing GAANNNNNNNNGTGG with methylation at 3(m6A),-3(m6A) from Escherichia coli NCTC10959
M.Eco8006I Type I methyltransferase recognizing GAANNNNNNNNGTGG with methylation at 3(m6A),-3(m6A) from Escherichia coli NCTC8006
M.EcoC9706I Type I methyltransferase recognizing GAANNNNNNNNGTGG with methylation at 3(m6A),-3(m6A) from Escherichia coli NCTC9706
99% identity, 100% coverage

M.Eco10386I Type I methyltransferase recognizing TACNNNNNNNRTRTC with methylation at 2(m6A),-4(m6A) from Escherichia coli O26 RM10386
M.Eco3274I Type I methyltransferase recognizing TACNNNNNNNRTRTC with methylation at 2(m6A),-4(m6A) from Escherichia coli O26:H11 2011C-3274
M.Eco3763I Type I methyltransferase recognizing TACNNNNNNNRTRTC with methylation at 2(m6A),-4(m6A) from Escherichia coli O69:H11 07-3763
M.Eco4255II Type I methyltransferase recognizing TACNNNNNNNRTRTC with methylation at 2(m6A),-4(m6A) from Escherichia coli O118:H16 07-4255
M.Eco4638I Type I methyltransferase recognizing TACNNNNNNNRTRTC with methylation at 2(m6A),-4(m6A) from Escherichia coli 2014C-4638
M.Eco8385I Type I methyltransferase recognizing TACNNNNNNNRTRTC with methylation at 2(m6A),-4(m6A) from Escherichia coli O103 RM8385
M.Eco8426I Type I methyltransferase recognizing TACNNNNNNNRTRTC with methylation at 2(m6A),-4(m6A) from Escherichia coli O26 RM8426
ECO26_5541 type I restriction-modification enzyme M subunit from Escherichia coli O26:H11 str. 11368
99% identity, 99% coverage

• The Mobilome; A Major Contributor to Escherichia coli stx2-Positive O26:H11 Strains Intra-Serotype Diversity
  Delannoy, Frontiers in microbiology 2017
  • “...Barbagallo et al., 2011 ; Campilongo et al., 2014 ), and several restriction endonucleases (ECO26_5540, ECO26_5541, ECO26_5542) involved in defense mechanisms were absent from strains 36493, 34870, 34827, 36293, and 36348. The speG gene (ECO26_2286), also involved in oxidative stress response (Kawano et al., 2007 ;...”

M.Eco9026III Type I methyltransferase recognizing TACNNNNNNNRTRTC with methylation at 2(m6A),-4(m6A) from Escherichia coli NCTC9026
99% identity, 100% coverage

M.Eco644II Type I methyltransferase recognizing CACNNNNNNNCTGG with methylation at 2(m6A),-3(m6A) from Escherichia coli O157 644-PT8
M.EcoPT54II Type I methyltransferase recognizing CACNNNNNNNCTGG with methylation at 2(m6A),-3(m6A) from Escherichia coli O157 180-PT54
99% identity, 98% coverage

M.Eco10974I Type I methyltransferase recognizing RTCANNNNNNNNRTRTC with methylation at 4(m6A),-4(m6A) from Escherichia coli NCTC10974
99% identity, 99% coverage

M.Eco933I Type I methyltransferase recognizing CACNNNNNNNCTGG with methylation at 2(m6A),-3(m6A) from Escherichia coli O157:H7 EDL933
99% identity, 99% coverage

M.Eco293I Type I methyltransferase recognizing CACNNNNNNNCTGG with methylation at 2(m6A),-3(m6A) from Escherichia coli O157 FDAARGOS_293
M.Eco0398I Type I methyltransferase recognizing CACNNNNNNNCTGG with methylation at 2(m6A),-3(m6A) from Escherichia coli CDC#03-98
M.Eco12900I Type I methyltransferase recognizing CACNNNNNNNCTGG with methylation at 2(m6A),-3(m6A) from Escherichia coli NCTC12900
M.Eco13125I Type I methyltransferase recognizing CACNNNNNNNCTGG with methylation at 2(m6A),-3(m6A) from Escherichia coli NCTC13125
M.Eco13127I Type I methyltransferase recognizing CACNNNNNNNCTGG with methylation at 2(m6A),-3(m6A) from Escherichia coli NCTC13127
M.Eco13128I Type I methyltransferase recognizing CACNNNNNNNCTGG with methylation at 2(m6A),-3(m6A) from Escherichia coli NCTC13128
M.Eco2149I Type I methyltransferase recognizing CACNNNNNNNCTGG with methylation at 2(m6A),-3(m6A) from Escherichia coli O157:H7 2149
M.Eco2159I Type I methyltransferase recognizing CACNNNNNNNCTGG with methylation at 2(m6A),-3(m6A) from Escherichia coli O157:H7 2159
M.Eco3384I Type I methyltransferase recognizing CACNNNNNNNCTGG with methylation at 2(m6A),-3(m6A) from Escherichia coli O157:H7 3384
M.Eco4276I Type I methyltransferase recognizing CACNNNNNNNCTGG with methylation at 2(m6A),-3(m6A) from Escherichia coli O157:H7 4276
M.Eco4465I Type I methyltransferase recognizing CACNNNNNNNCTGG with methylation at 2(m6A),-3(m6A) from Escherichia coli 2013C-4465
M.Eco8368I Type I methyltransferase recognizing CACNNNNNNNCTGG with methylation at 2(m6A),-3(m6A) from Escherichia coli O157:H7 8368
M.Eco9234I Type I methyltransferase recognizing CACNNNNNNNCTGG with methylation at 2(m6A),-3(m6A) from Escherichia coli O157:H7 9234
M.EcoC9702I Type I methyltransferase recognizing CACNNNNNNNCTGG with methylation at 2(m6A),-3(m6A) from Escherichia coli NCTC9701
M.EcoOS292I Type I methyltransferase recognizing CACNNNNNNNCTGG with methylation at 2(m6A),-3(m6A) from Escherichia coli O157 FDAARGOS_292
M.EcoOS398I Type I methyltransferase recognizing CACNNNNNNNCTGG with methylation at 2(m6A),-3(m6A) from Escherichia coli FDAARGOS_398
M.EcoOS399I Type I methyltransferase recognizing CACNNNNNNNCTGG with methylation at 2(m6A),-3(m6A) from Escherichia coli FDAARGOS_399
M.EcoOS400I Type I methyltransferase recognizing CACNNNNNNNCTGG with methylation at 2(m6A),-3(m6A) from Escherichia coli FDAARGOS_400
99% identity, 100% coverage

M.Eco1130I Type I methyltransferase recognizing CACNNNNNNNCTGG with methylation at 2(m6A),-3(m6A) from Escherichia coli O157:H7 1130
99% identity, 100% coverage

M.Eco10767I Type I methyltransferase recognizing CGAYNNNNNNNRTDCC with methylation at 3(m6A),-4(m6A) from Escherichia coli NCTC10767
99% identity, 99% coverage

M.Kas9737II Type I methyltransferase recognizing CGANNNNNNNNNTTCC with methylation at 3(m6A),-4(m6A) from Kluyvera ascorbata NCTC9737
98% identity, 100% coverage

M.Sen218II Type I methyltransferase recognizing CGAYNNNNNNNATGC with methylation at 3(m6A),-3(m6A) from Salmonella enterica subsp. enterica serovar Montevideo CDC 2013K-0218
M.Sen1942III Type I methyltransferase recognizing CGAYNNNNNNNATGC with methylation at 3(m6A),-3(m6A) from Salmonella enterica subsp. enterica serovar Montevideo CDC 08-1942
97% identity, 99% coverage

M.KoxNIH5I Type I methyltransferase recognizing CCANNNNNNNNCTCC with methylation at 3(m6A),-3(m6A) from Klebsiella oxytoca KONIH5
97% identity, 100% coverage

M.Sen51958I Type I methyltransferase recognizing CTANNNNNNNNRTDCC with methylation at 3(m6A),-4(m6A) from Salmonella enterica subsp. enterica serovar Mbandaka ATCC 51958
97% identity, 100% coverage

M.Cwe364I Type I methyltransferase recognizing RAACNNNNNNNGTCY with methylation at 3(m6A),-3(m6A) from Citrobacter werkmanii FDAARGOS_364
97% identity, 100% coverage

M.CfrMH17I Type I methyltransferase recognizing RAACNNNNNNNCTGG with methylation at 3(m6A),-3(m6A) from Citrobacter pasteurii UMH17
97% identity, 100% coverage

M.StySKI Type I methyltransferase recognizing CGAYNNNNNNNGTTA with methylation at ?(m6A) from Salmonella kaduna CDC-388
97% identity, 99% coverage

M.Kox8167I Type I methyltransferase recognizing ACAYNNNNNNNCTGG with methylation at 3(m6A),-3(m6A) from Klebsiella oxytoca NCTC8167
97% identity, 100% coverage

M.Sen9936I Type I methyltransferase recognizing GGANNNNNNNNNTGAG with methylation at 3(m6A),-4(m6A) from Salmonella enterica subsp. salamae serovar Greenside NCTC9936
97% identity, 100% coverage

M.CfrMH15I Type I methyltransferase recognizing CACNNNNNNNRTANYC with methylation at 2(m6A),-5(m6A) from Citrobacter freundii UMH15
96% identity, 100% coverage

M.CfrHM38I Type I methyltransferase recognizing GAAYNNNNNNNGTTG with methylation at 3(m6A),-3(m6A) from Citrobacter freundii HM38
97% identity, 100% coverage

M.Kox11683II Type I methyltransferase recognizing CACNNNNNNNCTGC with methylation at 2(m6A),-3(m6A) from Klebsiella oxytoca NCTC11683
97% identity, 100% coverage

M.Cko10770I Type I methyltransferase recognizing CGANNNNNNNNRTGAC with methylation at 3(m6A),-4(m6A) from Citrobacter koseri NCTC10770
97% identity, 100% coverage

M.Sen5747III Type I methyltransferase recognizing CGAYNNNNNNNRTRTC with methylation at 3(m6A),-4(m6A) from Salmonella enterica subsp. enterica serovar Montevideo NCTC5747
M.Sen45764III Type I methyltransferase recognizing CGAYNNNNNNNRTRTC with methylation at ?(m6A),-4(m6A) from Salmonella enterica CFSAN045764
97% identity, 100% coverage

M.Kox9186II Type I methyltransferase recognizing CTCANNNNNNNNNTARC with methylation at 4(m6A),-4(m6A) from Klebsiella oxytoca NCTC9186
97% identity, 100% coverage

M.KoxNIH2III Type I methyltransferase recognizing AACNNNNNNNRTGAC with methylation at 2(m6A),-4(m6A) from Klebsiella oxytoca KONIH2
97% identity, 100% coverage

M.Kox28I Type I methyltransferase recognizing AACNNNNNNNRTGAC with methylation at 2(m6A),-4(m6A) from Klebsiella oxytoca AR_0028
97% identity, 100% coverage

M.Sen255III Type I methyltransferase recognizing CGAYNNNNNNNRTRTC with methylation at 3(m6A),-4(m6A) from Salmonella enterica subsp. enterica serovar Montevideo str. 507440-20
M.Sen1544I Type I methyltransferase recognizing CGAYNNNNNNNRTRTC with methylation at 3(m6A),-4(m6A) from Salmonella enterica subsp. enterica serovar Montevideo CDC 2012K-1544
M.Sen1900I Type I methyltransferase recognizing CGAYNNNNNNNRTRTC with methylation at 3(m6A),-4(m6A) from Salmonella enterica subsp. enterica serovar Montevideo USMARC-1900
M.Sen1901I Type I methyltransferase recognizing CGAYNNNNNNNRTRTC with methylation at 3(m6A),-4(m6A) from Salmonella enterica subsp. enterica serovar Montevideo USMARC-1901
M.Sen1903II Type I methyltransferase recognizing CGAYNNNNNNNRTRTC with methylation at 3(m6A),-4(m6A) from Salmonella enterica subsp. enterica serovar Montevideo USDA-ARS-USMARC-1903
M.Sen1904I Type I methyltransferase recognizing CGAYNNNNNNNRTRTC with methylation at 3(m6A),-4(m6A) from Salmonella enterica subsp. enterica serovar Montevideo USMARC-1904
M.Sen1912I Type I methyltransferase recognizing CGAYNNNNNNNRTRTC with methylation at 3(m6A),-4(m6A) from Salmonella enterica subsp. enterica serovar Montevideo USMARC-1912
M.Sen1921I Type I methyltransferase recognizing CGAYNNNNNNNRTRTC with methylation at 3(m6A),-4(m6A) from Salmonella enterica subsp. enterica serovar Montevideo USDA-ARS-USMARC-1921
M.Sen51296II Type I methyltransferase recognizing CGAYNNNNNNNRTRTC with methylation at 3(m6A),-4(m6A) from Salmonella enterica subsp. enterica serovar Montevideo CFSAN051296
M.Sen531954II Type I methyltransferase recognizing CGAYNNNNNNNRTRTC with methylation at 3(m6A),-4(m6A) from Salmonella enterica subsp. enterica serovar Montevideo 531954
M.Sen954I Type I methyltransferase recognizing CGAYNNNNNNNRTRTC with methylation at 3(m6A) from Salmonella enterica subsp. enterica serovar Montevideo CDC 07-0954
M.SenK1674I Type I methyltransferase recognizing CGAYNNNNNNNRTRTC with methylation at 3(m6A),-4(m6A) from Salmonella enterica subsp. enterica serovar Montevideo CDC 2011K-1674
97% identity, 99% coverage

M.Sen038I Type I methyltransferase recognizing RAACNNNNNNNGTGG with methylation at 3(m6A),-3(m6A) from Salmonella enterica FORC_038
M.Sen0537II Type I methyltransferase recognizing TACNNNNNNNGTTC with methylation at 2(m6A),-3(m6A) from Salmonella enterica subsp. enterica serovar Tennessee PIR00537
M.Sen10722II Type I methyltransferase recognizing TACNNNNNNNGTTC with methylation at 2(m6A),-3(m6A) from Salmonella enterica subsp. enterica serovar Tennessee ATCC 10722
M.Sen1387IV Type I methyltransferase recognizing TACNNNNNNNGTTC with methylation at 2(m6A),-3(m6A) from Salmonella enterica subsp. enterica serovar Tennessee CFSAN001387
M.Sen5742III Type I methyltransferase recognizing RAACNNNNNNNGTGG with methylation at 3(m6A),-3(m6A) from Salmonella enterica subsp. enterica serovar Virchow NCTC5742
M.Sen76210I Type I methyltransferase recognizing TACNNNNNNNGTTC with methylation at 2(m6A),-3(m6A) from Salmonella enterica subsp. enterica serovar Tennessee CFSAN076210
97% identity, 100% coverage

M.Sen10729II Type I methyltransferase recognizing CGAYNNNNNNNRTRTC with methylation at 3(m6A),-4(m6A) from Salmonella enterica subsp. enterica serovar Pomona
97% identity, 100% coverage

M.KoxNIH4I Type I methyltransferase recognizing CAGNNNNNNNGTTC with methylation at 2(m6A),-3(m6A) from Klebsiella oxytoca KONIH4
97% identity, 100% coverage

M.Cko10810I Type I methyltransferase recognizing GAYANNNNNNNNGTTG with methylation at 4(m6A),-3(m6A) from Citrobacter koseri NCTC10810
97% identity, 100% coverage

M.Cko11076I Type I methyltransferase recognizing GTAYNNNNNNNRTDCC with methylation at 3(m6A),-4(m6A) from Citrobacter koseri NCTC11076
M.Kpn5055II Type I methyltransferase recognizing GTAYNNNNNNNRTDCC with methylation at 3(m6A),-4(m6A) from Klebsiella pneumoniae NCTC5055
97% identity, 100% coverage

M.Sen9606III Type I methyltransferase recognizing CGANNNNNNNNCTGC with methylation at 3(m6A),-3(m6A) from Salmonella enterica subsp. salamae NCTC9606
M.Sen10718IV Type I methyltransferase recognizing CGANNNNNNNNCTGC with methylation at 3(m6A),-3(m6A) from Salmonella enterica NCTC10718
96% identity, 100% coverage

M.Sen7832I Type I methyltransferase recognizing GAGNNNNNNNNTGCT with methylation at 2(m6A),-4(m6A) from Salmonella enterica subsp. enterica NCTC7832
97% identity, 100% coverage

M.Sen76213I Type I methyltransferase recognizing CACNNNNNNNRTRTC with methylation at 2(m6A),-4(m6A) from Salmonella enterica subsp. enterica serovar Mbandaka CFSAN076213
96% identity, 100% coverage

M.Rpl10263I Type I methyltransferase recognizing CACNNNNNNNATGC with methylation at 2(m6A),-3(m6A) from Raoultella planticola NCTC10263
96% identity, 100% coverage

M.Ror24724II Type I methyltransferase recognizing AAGNNNNNNNNTRGG with methylation at 2(m6A),-4(m6A) from Raoultella ornithinolytica Ro24724
96% identity, 100% coverage

M.Kpn46II Type I methyltransferase recognizing GAAYNNNNNNNCTGG with methylation at 3(m6A),-3(m6A) from Klebsiella pneumoniae AR_0046
M.Kpn0138II Type I methyltransferase recognizing GAAYNNNNNNNCTGG with methylation at 3(m6A),-3(m6A) from Klebsiella pneumoniae AR_0138
M.Kpn11305I Type I methyltransferase recognizing GAAYNNNNNNNCTGG with methylation at 3(m6A),-3(m6A) from Klebsiella pneumoniae 11305
M.Kpn1215I Type I methyltransferase recognizing GAAYNNNNNNNCTGG with methylation at 3(m6A),-3(m6A) from Klebsiella pneumoniae CRKP-1215
M.Kpn13190II Type I methyltransferase recognizing GAAYNNNNNNNCTGG with methylation at 3(m6A),-3(m6A) from Klebsiella pneumoniae 13190
M.Kpn13439I Type I methyltransferase recognizing CGANNNNNNNNRTTTC with methylation at 3(m6A),-4(m6A) from Klebsiella pneumoniae NCTC13439
M.Kpn145II Type I methyltransferase recognizing GAAYNNNNNNNCTGG with methylation at 3(m6A),-3(m6A) from Klebsiella pneumoniae AR_0145
M.Kpn149473I Type I methyltransferase recognizing GAAYNNNNNNNCTGG with methylation at 3(m6A),-3(m6A) from Klebsiella pneumoniae Kp_Goe_149473
M.Kpn149832I Type I methyltransferase recognizing GAAYNNNNNNNCTGG with methylation at 3(m6A),-3(m6A) from Klebsiella pneumoniae Kp_Goe_149832
M.Kpn152021I Type I methyltransferase recognizing GAAYNNNNNNNCTGG with methylation at 3(m6A),-3(m6A) from Klebsiella pneumoniae Kp_Goe_152021
M.Kpn152II Type I methyltransferase recognizing GAAYNNNNNNNCTGG with methylation at 3(m6A),-3(m6A) from Klebsiella pneumoniae AR_0152
M.Kpn154414I Type I methyltransferase recognizing GAAYNNNNNNNRTDCC with methylation at 3(m6A),-4(m6A) from Klebsiella pneumoniae Kp_Goe_154414
M.Kpn223I Type I methyltransferase recognizing GAAYNNNNNNNCTGG with methylation at 3(m6A),-3(m6A) from Klebsiella pneumoniae Kpn223
M.Kpn2297I Type I methyltransferase recognizing GAAYNNNNNNNCTGG with methylation at 3(m6A),-3(m6A) from Klebsiella pneumoniae CRKP-2297
M.Kpn439II Type I methyltransferase recognizing GAAYNNNNNNNCTGG with methylation at 3(m6A),-3(m6A) from Klebsiella pneumoniae FDAARGOS_439
M.Kpn442II Type I methyltransferase recognizing GAAYNNNNNNNCTGG with methylation at 3(m6A),-3(m6A) from Klebsiella pneumoniae FDAARGOS_442
M.Kpn6671I Type I methyltransferase recognizing GAAYNNNNNNNCTGG with methylation at 3(m6A),-3(m6A) from Klebsiella pneumoniae MS6671
M.Kpn822579I Type I methyltransferase recognizing GAAYNNNNNNNCTGG with methylation at 3(m6A),-3(m6A) from Klebsiella pneumoniae Kp_Goe_822579
M.Kpn825795I Type I methyltransferase recognizing GAAYNNNNNNNCTGG with methylation at 3(m6A),-3(m6A) from Klebsiella pneumoniae Kp_Goe_825795
M.Kpn827024I Type I methyltransferase recognizing GAAYNNNNNNNCTGG with methylation at 3(m6A),-3(m6A) from Klebsiella pneumoniae Kp_Goe_827024
M.Kpn827026I Type I methyltransferase recognizing GAAYNNNNNNNCTGG with methylation at 3(m6A),-3(m6A) from Klebsiella pneumoniae Kp_Goe_827026
M.Kpn828304I Type I methyltransferase recognizing GAAYNNNNNNNCTGG with methylation at 3(m6A),-3(m6A) from Klebsiella pneumoniae Kp_Goe_828304
M.Kpn9175I Type I methyltransferase recognizing CGANNNNNNNNRTTTC with methylation at 3(m6A),-4(m6A) from Klebsiella pneumoniae NCTC9175
M.KpnAATI Type I methyltransferase recognizing GAAYNNNNNNNCTGG with methylation at 3(m6A),-3(m6A) from Klebsiella pneumoniae AATZP
M.KpnGH01I Type I methyltransferase recognizing GAAYNNNNNNNCTGG with methylation at 3(m6A),-3(m6A) from Klebsiella pneumoniae SKGH01
M.KpnNH54III Type I methyltransferase recognizing GAAYNNNNNNNCTGG with methylation at 3(m6A),-3(m6A) from Klebsiella pneumoniae NH54
M.KpnNIH31I Type I methyltransferase recognizing GAAYNNNNNNNCTGG with methylation at 3(m6A),-3(m6A) from Klebsiella pneumoniae subsp. pneumoniae KPNIH31
96% identity, 100% coverage

M.Kpn0080II Type I methyltransferase recognizing GAAYNNNNNNNRTTC with methylation at 3(m6A) from Klebsiella pneumoniae AR_0080
M.Kpn9180I Type I methyltransferase recognizing GAAYNNNNNNNRTTC with methylation at 3(m6A) from Klebsiella pneumoniae NCTC9180
96% identity, 100% coverage

M.Sen10536V Type I methyltransferase recognizing GAYANNNNNNNNCTGG with methylation at 4(m6A),-3(m6A) from Salmonella enterica NCTC10436
96% identity, 100% coverage

M.Sen10401I Type I methyltransferase recognizing CAAYNNNNNNNGTCG with methylation at 3(m6A),-3(m6A) from Salmonella enterica subsp. houtenae serovar Houten NCTC10401
96% identity, 100% coverage

M.Sen10056III Type I methyltransferase recognizing GGHANNNNNNNNGTGC with methylation at 4(m6A),-3(m6A) from Salmonella enterica NCTC10056
96% identity, 100% coverage

M.Sen55II Type I methyltransferase recognizing CAAYNNNNNNNGTCY with methylation at 3(m6A),-3(m6A) from Salmonella enterica subsp. houtenae serovar 50:g,z51:- FDAARGOS_55
96% identity, 100% coverage

M.Kox9161I Type I methyltransferase recognizing CCANNNNNNNNCTCC with methylation at 3(m6A),-3(m6A) from Klebsiella oxytoca NCTC9161
97% identity, 95% coverage

M.Sen1929I Type I methyltransferase recognizing GACNNNNNNNRTCC with methylation at 2(m6A),-3(m6A) from Salmonella enterica subsp. enterica serovar Newport USMARC-1929
M.Sen14882I Type I methyltransferase recognizing GACNNNNNNNRTCC with methylation at 2(m6A),-3(m6A) from Salmonella enterica subsp. enterica serovar Newport WA_14882
M.Sen18486II Type I methyltransferase recognizing GACNNNNNNNRTCC with methylation at 2(m6A),-3(m6A) from Salmonella enterica subsp. enterica serovar Newport CVM N18486
M.Sen21554II Type I methyltransferase recognizing GACNNNNNNNRTCC with methylation at 2(m6A),-3(m6A) from Salmonella enterica subsp. enterica serovar Newport CVM 21554
M.Sen2159III Type I methyltransferase recognizing GACNNNNNNNRTCC with methylation at 2(m6A),-3(m6A) from Salmonella enterica subsp. enterica serovar Newport CDC 2010K-2159
M.Sen22425II Type I methyltransferase recognizing GACNNNNNNNRTCC with methylation at 2(m6A),-3(m6A) from Salmonella enterica subsp. enterica serovar Newport CVM 22425
M.Sen22462II Type I methyltransferase recognizing GACNNNNNNNRTCC with methylation at 2(m6A),-3(m6A) from Salmonella enterica subsp. enterica serovar Newport CVM 22462
M.Sen3890I Type I methyltransferase recognizing GACNNNNNNNRTCC with methylation at 2(m6A),-3(m6A) from Salmonella enterica subsp. enterica serovar Newport CFSAN003890
91% identity, 100% coverage

M.SenK002I Type I methyltransferase recognizing GAYANNNNNNNNGTGG with methylation at 4(m6A),-3(m6A) from Salmonella enterica subsp. enterica serovar Kentucky K13SK002
M.SenPU131III Type I methyltransferase recognizing GAYANNNNNNNNGTGG with methylation at 4(m6A),-3(m6A) from Salmonella enterica subsp. enterica serovar Kentucky PU131
91% identity, 100% coverage

M.Sen0738I Type I methyltransferase recognizing AGANNNNNNNNCTGG with methylation at 3(m6A),-3(m6A) from Salmonella enterica subsp. enterica serovar Thompson CFSAN000738
M.Sen5741IV Type I methyltransferase recognizing AGANNNNNNNNCTGG with methylation at 3(m6A),-3(m6A) from Salmonella enterica subsp. enterica NCTC5741
M.Sen8391I Type I methyltransferase recognizing AGANNNNNNNNCTGG with methylation at 3(m6A),-3(m6A) from Salmonella enterica subsp. enterica serovar Thompson
M.Sen8496I Type I methyltransferase recognizing AGANNNNNNNNCTGG with methylation at 3(m6A),-3(m6A) from Salmonella enterica subsp. enterica serovar Thompson NCTC8496
M.Spy5740I Type I methyltransferase recognizing AGANNNNNNNNCTGG with methylation at 3(m6A),-3(m6A) from Salmonella enterica subsp. enterica serovar Thompson NCTC5740
91% identity, 100% coverage

M.Kox9149I Type I methyltransferase recognizing RTCANNNNNNNNNTTGG with methylation at 4(m6A),-4(m6A) from Klebsiella oxytoca NCTC9149
98% identity, 93% coverage

M.Sen18747III Type I methyltransferase recognizing TACNNNNNNNGTTC with methylation at 2(m6A),-3(m6A) from Salmonella enterica subsp. enterica serovar Concord CFSAN018747
90% identity, 100% coverage

M.Sen313III Type I methyltransferase recognizing CACNNNNNNNRTANYC with methylation at 2(m6A),-5(m6A) from Salmonella enterica FDAARGOS_313
M.Sen5791I Type I methyltransferase recognizing CACNNNNNNNCTGG with methylation at 2(m6A),-3(m6A) from Salmonella enterica subsp. enterica serovar Aberdeen NCTC5791
90% identity, 100% coverage

M.Sen3387I Type I methyltransferase recognizing GAGNNNNNNNRTCC with methylation at 2(m6A),-3(m6A) from Salmonella enterica subsp. enterica serovar Newport CFSAN003387
M.Sen6245II Type I methyltransferase recognizing GAGNNNNNNNRTCC with methylation at 2(m6A),-3(m6A) from Salmonella enterica subsp. enterica NCTC6245
M.Ssp6947I Type I methyltransferase recognizing GAGNNNNNNNRTCC with methylation at 2(m6A),-3(m6A) from Salmonella species NCTC 6947
90% identity, 100% coverage

M.Sen92III Type I methyltransferase recognizing GTANNNNNNNNGTTC with methylation at 3(m6A),-3(m6A) from Salmonella enterica subsp. enterica NCTC92
M.Sen5716I Type I methyltransferase recognizing GTANNNNNNNNGTTC with methylation at 3(m6A),-3(m6A) from Salmonella enterica subsp. enterica serovar Stanley NCTC5716
M.Sen5754II Type I methyltransferase recognizing GTANNNNNNNNGTTC with methylation at 3(m6A),-3(m6A) from Salmonella enterica subsp. enterica serovar Bovismorbificans NCTC5754
M.Sen64033II Type I methyltransferase recognizing GTANNNNNNNNGTTC with methylation at 3(m6A),-3(m6A) from Salmonella enterica CFSAN064033
M.SenWT8I Type I methyltransferase recognizing GTANNNNNNNNGTTC with methylation at 3(m6A),-3(m6A) from Salmonella enterica subsp. enterica serovar Stanley strain sg_wt8
90% identity, 100% coverage

M.Sen6802II Type I methyltransferase recognizing CACNNNNNNNCTGG with methylation at 2(m6A),-3(m6A) from Salmonella enterica subsp. enterica serovar Hartford NCTC6802
90% identity, 100% coverage

M.Sen7102I Type I methyltransferase recognizing GAGNNNNNNNNTCGC with methylation at 2(m6A),-4(m6A) from Salmonella enterica subsp. enterica serovar Daytona NCTC7102
90% identity, 100% coverage

M.Ecl884AI Type I methyltransferase recognizing RTCANNNNNNNNNTRGG with methylation at 4(m6A),-4(m6A) from Enterobacter cloacae MS7884A
M.Eho16691I Type I methyltransferase recognizing RTCANNNNNNNNNTRGG with methylation at 4(m6A),-4(m6A) from Enterobacter hormaechei subsp. steigerwaltii
92% identity, 99% coverage

M.Hal5920I Type I methyltransferase recognizing GAAYNNNNNNNRTTTC with methylation at 3(m6A),-4(m6A) from Hafnia alvei HUMV-5920
91% identity, 99% coverage

M.Kpn39III Type I methyltransferase recognizing CTAYNANNNNNRTCC with methylation at 3(m6A) from Klebsiella pneumoniae KPNIH39
90% identity, 100% coverage

M.Sen3124II Type I methyltransferase recognizing GACNNNNNNNRTCC with methylation at 2(m6A),-3(m6A) from Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1
91% identity, 97% coverage

M.Sru10036I Type I methyltransferase recognizing AACNNNNNNNGTTC with methylation at 2(m6A),-3(m6A) from Serratia rubidaea NCTC10036
90% identity, 99% coverage

M.EcoEI Type I methyltransferase recognizing GAGNNNNNNNATGC with methylation at ?(m6A) from Escherichia coli A58
91% identity, 99% coverage

M.SmaUMH9II Type I methyltransferase recognizing DTAGNNNNNNNRTCC with methylation at 3(m6A),-3(m6A) from Serratia marcescens UMH9
90% identity, 99% coverage

M.Mmo365II Type I methyltransferase recognizing CYYANNNNNNNNNTGGC with methylation at 4(m6A),-4(m6A) from Morganella morganii FDAARGOS_365
89% identity, 99% coverage

M.Eco9094I Type I methyltransferase recognizing CCAYNNNNNNNCTGC with methylation at 3(m6A),-3(m6A) from Escherichia coli NCTC9094
89% identity, 100% coverage

M.Mmo63III Type I methyltransferase recognizing CAAYNNNNNNNGTTG with methylation at 3(m6A) from Morganella morganii FDAARGOS_63
M.MmoTt01I Type I methyltransferase recognizing GACNNNNNNNGTTG with methylation at 2(m6A),-3(m6A) from Morganella morganii KC-Tt-01
89% identity, 99% coverage

M.Squ13194I Type I methyltransferase recognizing GYTANNNNNNNNCTGC with methylation at 4(m6A),-3(m6A) from Serratia quinivorans NCTC13194
89% identity, 100% coverage

M.Mmo172I Type I methyltransferase recognizing CYYANNNNNNNNGTTG with methylation at 4(m6A),-3(m6A) from Morganella morganii FDAARGOS_172
M.Mmo12028I Type I methyltransferase recognizing CYYANNNNNNNNGTTG with methylation at 4(m6A),-3(m6A) from Morganella morganii NCTC12028
M.Mmo438I Type I methyltransferase recognizing CYYANNNNNNNNGTTG with methylation at 4(m6A),-3(m6A) from Morganella morganii FDAARGOS_438
89% identity, 99% coverage

M.Pre7476I Type I methyltransferase recognizing GACNNNNNNNCTGG with methylation at 2(m6A),-3(m6A) from Providencia rettgeri NCTC7476
89% identity, 99% coverage

M.PreB001II Type I methyltransferase recognizing GAAYNNNNNNNNTTGG with methylation at 3(m6A) from Providencia rettgeri FZB001
89% identity, 100% coverage

M.Pst87II Type I methyltransferase recognizing GGANNNNNNNNATGC with methylation at 3(m6A),-3(m6A) from Providencia stuartii FDAARGOS_87
88% identity, 100% coverage

M.Mmo12286I Type I methyltransferase recognizing GACNNNNNNNRTAYG with methylation at 2(m6A),-4(m6A) from Morganella morganii NCTC12286
M.Mmo12289I Type I methyltransferase recognizing AAGNNNNNNNNTGGC with methylation at 2(m6A),-4(m6A) from Morganella morganii NCTC12289
89% identity, 96% coverage

M.Mmo232I Type I methyltransferase recognizing CYYANNNNNNNNGTTG with methylation at 4(m6A),-3(m6A) from Morganella morganii NCTC232
89% identity, 96% coverage

M.Mmo235I Type I methyltransferase recognizing GAGNNNNNNNNTGGC with methylation at 2(m6A),-4(m6A) from Morganella morganii NCTC235
89% identity, 96% coverage

M.Vvu36I Type I methyltransferase recognizing GGHANNNNNNNNGTCG with methylation at 4(m6A),-3(m6A) from Vibrio vulnificus FORC_036
84% identity, 98% coverage

M.Van11008II Type I methyltransferase recognizing GAAYNNNNNNNATGC with methylation at 3(m6A),-3(m6A) from Vibrio anguillarum CNEVA NB11008
84% identity, 98% coverage

M.SwoAI Type I methyltransferase recognizing CACNNNNNNNNTTTC with methylation at 2(m6A),-4(m6A) from Shewanella woodyi ATCC 51908
84% identity, 99% coverage

M.Van12159I Type I methyltransferase recognizing CYYANNNNNNNNCTTC with methylation at 4(m6A),-3(m6A) from Vibrio anguillarum NCTC12159
85% identity, 97% coverage

M.VvuCMCP6I Type I methyltransferase recognizing GGANNNNNNNNNTGGC with methylation at 3(m6A),-4(m6A) from Vibrio vulnificus CMCP6
VV1_2031 Type I restriction enzyme EcoEI M protein from Vibrio vulnificus CMCP6
84% identity, 98% coverage

• Whole-genome comparison between reference sequences and oyster Vibrio vulnificus C-genotype strains
  Guerrero, PloS one 2019
  • “...+ + VV2_1510 + - VVA0333 + - VV1_1751 + + MO6-24/0 VVA0362 + + VV1_2031 - - VVMO6_02633 + + VVA0389 + - VV1_2037 - - VVMO6_02634 + + VVA0390 + - VV1_2038 - - VVMO6_02635 + + VVA0392 + - VV1_2061 + + VVMO6_03282...”
• SOLiD sequencing of four Vibrio vulnificus genomes enables comparative genomic analysis and identification of candidate clade-specific virulence genes
  Gulig, BMC genomics 2010
  • “...kinase - COG0515RTKL VV1_1518 3-methyladenine DNA glycosylase - COG0122L VV1_1751 hypothetical protein VV1_1751 - - VV1_2031 Type I restriction enzyme EcoEI M protein - COG0286V VV1_2037 Type I restriction enzyme EcoEI R protein - COG4096V VV1_2038 transcriptional regulator - - VV1_2061 GGDEF family protein OMPH_PHOPR porin-like...”
• Genome comparison and context analysis reveals putative mobile forms of restriction-modification systems and related rearrangements
  Furuta, Nucleic acids research 2010
  • “...(II, R), PD1607 (II, M) 45/45 45/45 45/45 e Vibrio vulnificus CMCP6/YJ016 VV1_2037 (I, R), VV1_2031 (I, M), VV1_2030 (I, S) 49/49 49/49 49/49 If an inserted region contained only RM genes, it was classified as an RM insertion with a long and variable target duplication,...”

M.Vsp61001III Type I methyltransferase recognizing CAAYNNNNNNNRTAC with methylation at 3(m6A),-3(m6A) from Vibrio species HBUAS61001
84% identity, 98% coverage

M.Vpa191I Type I methyltransferase recognizing CRTANNNNNNNNCTTG with methylation at 4(m6A),-3(m6A) from Vibrio parahaemolyticus FDAARGOS_191
VP0388 type I restriction enzyme M protein from Vibrio parahaemolyticus RIMD 2210633
FORC22_0362 N-6 DNA methylase from Vibrio parahaemolyticus
84% identity, 98% coverage

• Insights into virulence: structure classification of the Vibrio parahaemolyticus RIMD mobilome
  Kinch, mSystems 2023
  • “...the switch of gene expression profiles ( 57 ). The VPaI-1 region includes two proteins (VP0388 and VP0394) with S-adenosylmethionine-dependent methyltransferase domains that might play similar phase variation roles. Finally, several domains involved in modifying sugars (GfcC, UDP-glycosyltransferase/glycogen phosphorylase, and nucleotide-diphosphate-sugar transferases) of bacterial lipopolysaccharide (LPS,...”
• Bacteriostatic effects of benzyl isothiocyanate on Vibrio parahaemolyticus: Transcriptomic analysis and morphological verification
  Liu, BMC biotechnology 2021
  • “...component of organelle membrane. The upregulated gene metF regulates 5, 10-methylenetetrahydrofolate reductase, and downregulated genes VP0388, VP0246, VP0470, VP0939, and VPA1370 regulate type I restriction enzyme M protein, hypothetical protein, carbamoyl phosphate synthase small subunit, hypothetical protein and hypothetical protein, respectively (see Additional file 4 )....”
• Potential Survival and Pathogenesis of a Novel Strain, Vibrio parahaemolyticus FORC_022, Isolated From a Soy Sauce Marinated Crab by Genome and Transcriptome Analyses
  Chung, Frontiers in microbiology 2018
  • “...I) 367725370261, 375474378670, 380436381926, 384740390666, and 394100395834 (FORC22_0350FORC22_0352, FORC22_0358FORC0360, FORC22_0362, FORC22_0365FORC22_0368, and FORC22_0372FORC22_0373) VP0380VP0382, VP0384VP0386, VP0388, VP0395VP0400, and VP0402VP0403 (98%) 390403391803, 402506405945, and 412476414155 (M636_19830, M636_19835, M636_19840, M636_19795, M636_19790, and M636_19880) VP0380, VP0397VP0400, and VP0402VP0403 (94%) VP0635VP0643 VPaI-2 (chromosome I) Absent 676971678768, and 678888685230 (M636_18615M636_18640, and...”
• Genomic Features of Environmental and Clinical Vibrio parahaemolyticus Isolates Lacking Recognized Virulence Factors Are Dissimilar
  Ronholm, Applied and environmental microbiology 2016
  • “...VP0380, VP0398 to VP0400, VP0402, VP0403 VP0380 to VP0388, VP0395 to VP0400 VP0402, VP0403 VP0380, VP0398 to VP0400, VP0402, VP0403 VP0380, VP0398, VP0400,...”
  • “...VP0636 VP0381 to VP0384 VP0381 to VP0383, VP0388, VP0395 aem.asm.org VPTS-2009 SG176 J-C2-34 22702 NCKU-TN-S02 VH3 VP1071, VP1073, VP1074, VP1075, VP1088...”
• Identification of a DNA methyltransferase gene carried on a pathogenicity island-like element (VPAI) in Vibrio parahaemolyticus and its prevalence among clinical and environmental isolates
  Wang, Applied and environmental microbiology 2006
  • “...the type I restric- tion-modification complex (VP0387, VP0388, and VP0395), V. parahaemolyticus MTase (VP0394), phage P4-like integrase (VP0380), and proteins...”
  • “...VP0380 VP0381 VP0382 VP0383 VP0384 VP0385 VP0386 VP0387 VP0388 VP0389 VP0390 VP0391 VP0392 VP0393 VP0394 VP0395 VP0396 VP0397 VP0398 VP0399 VP0400 VP0401 VP0402...”
• Four genomic islands that mark post-1995 pandemic Vibrio parahaemolyticus isolates
  Hurley, BMC genomics 2006
  • “...). All PCR negative results were confirmed by Southern hybridisation analysis using DNA probes encompassing VP0388 to VP0392. Of the 17 VPaI-1 negative V. parahaemolyticus isolates, 16 were negative for the GS-PCR assay, the exception being strain KE10462 (Table 4 ). To determine whether in each...”
• Potential Survival and Pathogenesis of a Novel Strain, Vibrio parahaemolyticus FORC_022, Isolated From a Soy Sauce Marinated Crab by Genome and Transcriptome Analyses
  Chung, Frontiers in microbiology 2018
  • “...2006 ). Four VPaIs were detected in the FORC_022 genome, as follows: VPaI-1 (FORC22_0350-FORC22_0352, FORC22_0358-FORC22_0360, FORC22_0362, FORC22_0365-FORC22_0368, and FORC22_0372-FORC22_0373), VPaI-3 (FORC22_1007-FORC22_1009 and FORC22_1034-FORC22_1041), VPaI-6 (FORC22_4366), and VPaI-7 (FORC22_4405 and FORC22_4406). VPaI-1 was reported to be unique to the pandemic group of V. parahaemolyticus strains isolated after...”
  • “...Islands (GIs) VP0380VP0403 VPaI -1 (Chromosome I) 367725370261, 375474378670, 380436381926, 384740390666, and 394100395834 (FORC22_0350FORC22_0352, FORC22_0358FORC0360, FORC22_0362, FORC22_0365FORC22_0368, and FORC22_0372FORC22_0373) VP0380VP0382, VP0384VP0386, VP0388, VP0395VP0400, and VP0402VP0403 (98%) 390403391803, 402506405945, and 412476414155 (M636_19830, M636_19835, M636_19840, M636_19795, M636_19790, and M636_19880) VP0380, VP0397VP0400, and VP0402VP0403 (94%) VP0635VP0643 VPaI-2 (chromosome I)...”

M.Eco11126I Type I methyltransferase recognizing RTCANNNNNNNNGTGG with methylation at 4(m6A),-3(m6A) from Escherichia coli NCTC11126
99% identity, 84% coverage

M.Vvu117I Type I methyltransferase recognizing CRTANNNNNNNNCTTG with methylation at 4(m6A),-3(m6A) from Vibrio vulnificus FDAARGOS_117
M.Vvu11067II Type I methyltransferase recognizing CRTANNNNNNNNCTTG with methylation at 4(m6A),-3(m6A) from Vibrio vulnificus NCTC11067
83% identity, 98% coverage

M.Spu10737II Type I methyltransferase recognizing GAAYNNNNNNNRTTGY with methylation at 3(m6A),-4(m6A) from Shewanella putrefaciens NCTC10737
83% identity, 96% coverage

M.VpaSM3III Type I methyltransferase recognizing GAAYNNNNNNNNTGTC with methylation at 3(m6A),-4(m6A) from Vibrio parahaemolyticus SM3
M.VpaSM4II Type I methyltransferase recognizing GAAYNNNNNNNNTGTC with methylation at 3(m6A),-4(m6A) from Vibrio parahaemolyticus SM4
83% identity, 98% coverage

M.AhyYL17IV Type I methyltransferase recognizing CTANNNNNNNNGTTC with methylation at 3(m6A),-3(m6A) from Aeromonas hydrophila YL17
83% identity, 96% coverage

M.AspNIH3II Type I methyltransferase recognizing GAGNNNNNNNNTCGC with methylation at 2(m6A),-4(m6A) from Aeromonas species ASNIH3
83% identity, 96% coverage

ONR73_23265 type I restriction-modification system subunit M from Aeromonas veronii
82% identity, 97% coverage

• Acquisition of Type I methyltransferase via horizontal gene transfer increases the drug resistance of Aeromonas veronii
  Ma, Microbial genomics 2023
  • “.... Scattered distribution of hsd genes in A. veronii Three hsdM genes (Locus tags: ONR73_20345, ONR73_23265 and ONR73_20695), three hsdS genes (Locus tags: ONR73_20340, ONR73_23270 and ONR73_20700) and two hsdR genes (Locus tags: ONR73_20720 and ONR73_23260) were found. These hsd genes constituted one Type I MTase...”
  • “...(Locus tag: ONR73_20340), while AveC4II was encoded by hsdR2 (Locus tag: ONR73_23260), hsdM2 (Locus tag: ONR73_23265) and hsdS2 (Locus tag: ONR73_23270). AveC4III consisted of hsdR3 (Locus tag: ONR73_20720), hsdM3 (Locus tag: ONR73_20695) and hsdS3 (Locus tag: ONR73_20700). In AveC4I and AveC4III, the hsdM and hsdS genes...”

M.Sen129II Type I methyltransferase recognizing GACNNNNNNNRTCC with methylation at 2(m6A),-3(m6A) from Salmonella enterica subsp. enterica NCTC129
89% identity, 86% coverage

M.MprAceLVI Type I methyltransferase recognizing GAGNNNNNNNGTGG with methylation at 2(m6A),-3(m6A) from Marinomonas primoryensis AceL
81% identity, 99% coverage

M.AspNIH5II Type I methyltransferase recognizing CAAGNNNNNNNCTGC with methylation at 3(m6A),-3(m6A) from Aeromonas species ASNIH5
83% identity, 96% coverage

M.Eta370III Type I methyltransferase recognizing GYACNNNNNNNGTCG with methylation at 3(m6A),-3(m6A) from Edwardsiella tarda FDAARGOS_370
82% identity, 95% coverage

M.Vvu13647I Type I methyltransferase recognizing RAACNNNNNNNNTGGC with methylation at 3(m6A),-4(m6A) from Vibrio vulnificus NCTC13647
81% identity, 98% coverage

M.Sru9419I Type I methyltransferase recognizing GTAANNNNNNNNRTDCC with methylation at 4(m6A),-4(m6A) from Serratia rubidaea NCTC9419
90% identity, 82% coverage

M.Eco9081I Type I methyltransferase recognizing CGAYNNNNNNNRTDCC with methylation at 3(m6A),-4(m6A) from Escherichia coli NCTC9081
99% identity, 71% coverage

M.Hsp116II Type I methyltransferase recognizing CCANNNNNNNNGTCG with methylation at 3(m6A),-3(m6A) from Halomonas species KO116
68% identity, 98% coverage

M.AcoA42I Type I methyltransferase recognizing GCAGNNNNNNNGTRC with methylation at 3(m6A),-3(m6A) from Azoarcus communis TSNA42
68% identity, 99% coverage

M.Msp412I Type I methyltransferase recognizing GACNNNNNNNNTGCC with methylation at 2(m6A),-4(m6A) from Marinobacter species CS412
68% identity, 97% coverage

M.Pst10450II Type I methyltransferase recognizing TGANNNNNNNNGTAG with methylation at 3(m6A),-3(m6A) from Pseudomonas stutzeri NCTC10450
68% identity, 99% coverage

M.PspR2A2I Type I methyltransferase recognizing CACNNNNNNNNTGCT with methylation at 2(m6A),-4(m6A) from Pseudomonas species R2A2
67% identity, 99% coverage

M.Ppu13185I Type I methyltransferase recognizing AGCANNNNNNNNATGC with methylation at 4(m6A),-3(m6A) from Pseudomonas putida NCTC13185
M.Ppu13186I Type I methyltransferase recognizing AGCANNNNNNNNATGC with methylation at 4(m6A),-3(m6A) from Pseudomonas putida NCTC13186
PP4741, PP_4741 type I restriction-modification system, M subunit from Pseudomonas putida KT2440
67% identity, 99% coverage

• Genetic Dissection of the Regulatory Network Associated with High c-di-GMP Levels in Pseudomonas putida KT2440
  Ramos-González, Frontiers in microbiology 2016
  • “...metal ion transporter cfcK-5 PP_4366 ( fliI ) Flagellum-specific ATP synthase (AAA+ ATPase domain) cfcK-6 PP_4741 ( hsdM ) Type I restriction-modification system, M subunit cfcK-9 PP_5064 ( betA ) Choline dehydrogenase cfcK-10 PP_0155 ( pntB ) NAD(P) transhydrogenase subunit beta cfcK-16 (9) -/++ b -/++...”
• Analysis of Pseudomonas putida KT2440 gene expression in the maize rhizosphere: in vivo [corrected] expression technology capture and identification of root-activated promoters
  Ramos-González, Journal of bacteriology 2005
  • “...PP5053 PP0006 hsdM (rap1-19) recJ (rap2-28) parC (rap2-37) PP4741 PP1477 PP4912 aceE (rap2-2) aceA (rap2-14) gnd (rap2-15) pgm (rap2-77) PP0339 PP4116 PP4043...”

M.PviYsS1I Type I methyltransferase recognizing AAGNNNNNNNCTGG with methylation at 2(m6A),-3(m6A) from Pseudomonas viciae YsS1
67% identity, 99% coverage

M.Oba14III Type I methyltransferase recognizing GAGNNNNNNNNTCGG with methylation at 2(m6A),-4(m6A) from Oxalobacteraceae bacterium AB14
66% identity, 98% coverage

M.Ssp53I Type I methyltransferase recognizing RAAAYNNNNNNNRTGG with methylation at 4(m6A),-3(m6A) from Sediminibacterium sp. OR53
64% identity, 99% coverage

M.Pmo171I Type I methyltransferase recognizing TCANNNNNNNNCTTC with methylation at 3(m6A),-3(m6A) from Pseudomonas monteilii FDAARGOS_171
68% identity, 99% coverage

M.GsuRed1VII Type I methyltransferase recognizing CGANNNNNNNNNTGAA with methylation at 3(m6A),-4(m6A) from Geoalkalibacter subterraneus Red1
67% identity, 98% coverage

M.Pae63IV Type I methyltransferase recognizing CACNNNNNNNRTGT with methylation at 2(m6A),-3(m6A) from Pseudomonas aeruginosa Carb01 63
M.Pae0110II Type I methyltransferase recognizing CACNNNNNNNRTGT with methylation at 2(m6A),-3(m6A) from Pseudomonas aeruginosa AR_0110
M.Pae0111I Type I methyltransferase recognizing CACNNNNNNNRTGT with methylation at 2(m6A),-3(m6A) from Pseudomonas aeruginosa AR_0111
M.Pae13437IV Type I methyltransferase recognizing CACNNNNNNNRTGT with methylation at 2(m6A),-3(m6A) from Pseudomonas aeruginosa NCTC13437
M.Pae13716II Type I methyltransferase recognizing CACNNNNNNNRTGT with methylation at 2(m6A),-3(m6A) from Pseudomonas aeruginosa NCTC13716
M.Pae13717II Type I methyltransferase recognizing CACNNNNNNNRTGT with methylation at 2(m6A),-3(m6A) from Pseudomonas aeruginosa NCTC13717
M.PaePA83I Type I methyltransferase recognizing CACNNNNNNNRTGT with methylation at 2(m6A),-3(m6A) from Pseudomonas aeruginosa PA83
67% identity, 99% coverage

M.Pae10782I Type I methyltransferase recognizing CACNNNNNNNRTGT with methylation at 2(m6A),-3(m6A) from Pseudomonas aeruginosa NCTC10782
67% identity, 99% coverage

M.Pse18267II Type I methyltransferase recognizing GAAYNNNNNNNRTDCC with methylation at 3(m6A),-4(m6A) from Pelobacter seleniigenes DSM 18267
66% identity, 99% coverage

M.HspRAC07I Type I methyltransferase recognizing CCAYNNNNNNNNTTCG with methylation at 3(m6A),-4(m6A) from Hydrogenophaga species RAC07
67% identity, 99% coverage

M.Xor7341II Type I methyltransferase recognizing AAGNNNNNNNNTGAG with methylation at 2(m6A),-4(m6A) from Xanthomonas oryzae pv. oryzicola CFBP7341
67% identity, 99% coverage

M.Plu11842I Type I methyltransferase recognizing CGANNNNNNNNCTCC with methylation at 3(m6A),-3(m6A) from Pseudomonas luteola NCTC11842
66% identity, 99% coverage

M.Xor7331I Type I methyltransferase recognizing AAGNNNNNNNNTGAG with methylation at -4(m6A) from Xanthomonas oryzae pv. oryzicola CFBP7331
66% identity, 99% coverage

M.Xor279I Type I methyltransferase recognizing GAGNNNNNNCCT with methylation at 2(m6A),-1(m6A) from Xanthomonas oryzae pv. oryzicola BLS279
M.Xor2286I Type I methyltransferase recognizing GAGNNNNNNCCT with methylation at 2(m6A),-1(m6A) from Xanthomonas oryzae pv. oryzicola CFBP2286
M.XorB812II Type I methyltransferase recognizing GAGNNNNNNCCT with methylation at 2(m6A),-1(m6A) from Xanthomonas oryzae pv. oryzicola B8-12
M.XorL8I Type I methyltransferase recognizing GAGNNNNNNCCT with methylation at 2(m6A),-1(m6A) from Xanthomonas oryzae pv. oryzicola L8
67% identity, 99% coverage

M.MdeFJG1III Type I methyltransferase recognizing GYAYNNNNNNNCTGG with methylation at 3(m6A),-3(m6A) from Methylomonas denitrificans FJG1
65% identity, 98% coverage

M.PfrAS1I Type I methyltransferase recognizing TCANNNNNNNNNTTCC with methylation at 3(m6A),-4(m6A) from Pseudomonas frederiksbergensis AS1
67% identity, 99% coverage

M.Xor7342II Type I methyltransferase recognizing ACANNNNNNNNNTGCT with methylation at 3(m6A),-4(m6A) from Xanthomonas oryzae pv. oryzicola CFBP7342
66% identity, 99% coverage

M.XorOR1II Type I methyltransferase recognizing CCAANNNNNNNNCTT with methylation at 4(m6A),-2(m6A) from Xanthomonas oryzae pv. oryzicola BXOR1
66% identity, 99% coverage

AFE_0684 type I restriction-modification system subunit M from Acidithiobacillus ferrooxidans ATCC 23270
64% identity, 99% coverage

• Proteomics Reveal Enhanced Oxidative Stress Responses and Metabolic Adaptation in Acidithiobacillus ferrooxidans Biofilm Cells on Pyrite
  Bellenberg, Frontiers in microbiology 2019
  • “...proteins involved in DNA repair mechanisms such as DNA exonuclease PolX (AFE_3104), restriction endonuclease EcoEI (AFE_0684), the DNA repair protein RecN (AFE_0450), were found to be increased in biofilm cells. In iron(II) ion-grown cells only eight proteins associated with functions related to protection against oxidative stress...”

M.Xor256II Type I methyltransferase recognizing CCANNNNNNNNNTGCT with methylation at 3(m6A),-4(m6A) from Xanthomonas oryzae pv. oryzicola BLS256
66% identity, 99% coverage

Pnuc_1133 N-6 DNA methylase from Polynucleobacter sp. QLW-P1DMWA-1
64% identity, 99% coverage

• Combined Methylome, Transcriptome and Proteome Analyses Document Rapid Acclimatization of a Bacterium to Environmental Changes
  Srivastava, Frontiers in microbiology 2020
  • “...transcriptional regulator, AlpA 1.79 0.000486 Pnuc_0606 DNA polymerase III subunit alpha (EC 2.7.7.7) 1.76 0.013830 Pnuc_1133 N -6 DNA methylase 1.76 0.000066 Pnuc_1241 Uncharacterized protein 1.74 0.013508 Pnuc_0303 GDP- L -fucose synthase (EC 1.1.1.271) 1.74 0.004615 Pnuc_0757 Transcriptional regulator, GntR family 1.73 0.000935 Pnuc_0820 ABC transporter...”
  • “...temperature (4C) ( Figure 2C and Supplementary Table S6 ). The N6-adenine-specific DNA methylase enzyme (Pnuc_1133) was marginally enriched (+1.15-fold; p = 0.0004) at cold incubation, suggesting its role in the DNA methylation process. We detected two 16 nucleotides long conserved motifs (CT A YNNNNNNNNTRTC and...”

M.Xax8raI Type I methyltransferase recognizing CAGNNNNNNNNTCTY with methylation at 2(m6A),-4(m6A) from Xanthomonas axonopodis pv. glycines 8ra
M.Xci122I Type I methyltransferase recognizing CAGNNNNNNNNTCTY with methylation at 2(m6A),-4(m6A) from Xanthomonas citri pv. glycines 12-2
M.XciEB08I Type I methyltransferase recognizing CAGNNNNNNNNTCTY with methylation at 2(m6A),-4(m6A) from Xanthomonas citri pv. glycines EB08
65% identity, 99% coverage

M.Sna507VII Type I methyltransferase recognizing GCAGNNNNNNNRTRTC with methylation at 3(m6A),-4(m6A) from Sphaerotilus natans subsp. sulfidivorans D-507
64% identity, 99% coverage

M.Aju10307IV Type I methyltransferase recognizing GYTANNNNNNNNRTGG with methylation at 4(m6A),-3(m6A) from Acinetobacter junii NCTC10307
M.Aju12153IV Type I methyltransferase recognizing GYTANNNNNNNNRTGG with methylation at 4(m6A),-3(m6A) from Acinetobacter junii NCTC12153
60% identity, 98% coverage

M.Aha10306II Type I methyltransferase recognizing GAYANNNNNNNNGTTG with methylation at 4(m6A),-3(m6A) from Acinetobacter haemolyticus NCTC10306
60% identity, 99% coverage

M.Gsp300II Type I methyltransferase recognizing GTANNNNNNNNCTTC with methylation at 3(m6A),-3(m6A) from Geobacillus species LC300
61% identity, 99% coverage

M.XbaD13I Type I methyltransferase recognizing CCAYNNNNNNNNTAG with methylation at 3(m6A),-3(m6A) from Xanthomonadales bacterium D13
61% identity, 99% coverage

M.PyaNHR1III Type I methyltransferase recognizing GAGNNNNNNNGTCG with methylation at 2(m6A),-3(m6A) from Pseudanabaena yagii GIHE-NHR1
61% identity, 99% coverage

M.Abr4038II Type I methyltransferase recognizing CGCANNNNNNNNCTCC with methylation at 4(m6A),-3(m6A) from Azospirillum brasilense MTCC4038
M.AbrSp7II Type I methyltransferase recognizing CGCANNNNNNNNCTCC with methylation at 4(m6A),-3(m6A) from Azospirillum brasilense Sp 7
60% identity, 99% coverage

M.BpsM1IV Type I methyltransferase recognizing CAYNNNNNNNCTCC with methylation at 2(m6A),-3(m6A) from Burkholderia pseudomallei M1
M.BpsMSIV Type I methyltransferase recognizing CAYNNNNNNNCTCC with methylation at 2(m6A),-3(m6A) from Burkholderia pseudomallei MS
60% identity, 97% coverage

M.Alw5866I Type I methyltransferase recognizing CACNNNNNNNRTANYC with methylation at 2(m6A),-5(m6A) from Acinetobacter lwoffii NCTC5866
M.Alw5867I Type I methyltransferase recognizing CACNNNNNNNRTANYC with methylation at 2(m6A),-5(m6A) from Acinetobacter lwoffii NCTC5867
59% identity, 98% coverage

M.AvaXI Type I methyltransferase recognizing TAAGNNNNNNNGTCA with methylation at 3(m6A),-3(m6A) from Anabaena variabilis ATCC 27893
61% identity, 100% coverage

M.Pae10731I Type I methyltransferase recognizing GACNNNNNNNGTTY with methylation at 2(m6A),-3(m6A) from Pseudomonas aeruginosa NCTC10731
60% identity, 98% coverage

M.TspPSB1VI Type I methyltransferase recognizing CAGNNNNNNNRTANYC with methylation at 2(m6A),-5(m6A) from Thiohalocapsa species PB-PSB1
59% identity, 99% coverage

M.Bps7894III Type I methyltransferase recognizing CCANNNNNNNNRTGCC with methylation at 3(m6A),-4(m6A) from Burkholderia pseudomallei 7894
M.BpsM1III Type I methyltransferase recognizing CCANNNNNNNNRTGCC with methylation at 3(m6A),-4(m6A) from Burkholderia pseudomallei M1
M.BpsMSIII Type I methyltransferase recognizing CCANNNNNNNNRTGCC with methylation at ?(m6A),-4(m6A) from Burkholderia pseudomallei MS
58% identity, 99% coverage

M.Lsp6406VIII Type I methyltransferase recognizing CAAYNNNNNNNNTTGG with methylation at 3(m6A),-4(m6A) from Leptolyngbya sp. PCC 6406
60% identity, 99% coverage

M.Psp88II Type I methyltransferase recognizing CAAYNNNNNNNGTTA with methylation at 3(m6A),-3(m6A) from Polaribacter sp. Hel_I_88
57% identity, 99% coverage

M.Cal14237II Type I methyltransferase recognizing CAGNNNNNNNRTTTC with methylation at 2(m6A),-4(m6A) from Cellulophaga algicola DSM 14237
56% identity, 99% coverage

M.Ccl42aIII Type I methyltransferase recognizing CNAYNNNNCTC with methylation at 3(m6A),-2(m6A) from Clostridium clariflavum 4-2a
58% identity, 98% coverage

M.Cpa598I Type I methyltransferase recognizing GAAYNNNNNNNRTANYC with methylation at 3(m6A),-5(m6A) from Clostridium pasteurianum
X276_10630 type I restriction-modification system subunit M from Clostridium beijerinckii NRRL B-598
57% identity, 99% coverage

• Dam and Dcm methylations prevent gene transfer into Clostridium pasteurianum NRRL B-598: development of methods for electrotransformation, conjugation, and sonoporation
  Kolek, Biotechnology for biofuels 2016
  • “...genome No. detected (strand) % detected (strand) Locus tag Nomenclature I GRNTAYNNNNNNNRTTC/GAAYNNNNNNNRTANYC 406 385/380 94.83/93.60 X276_10630 M.Cpa598I I CTAGNNNNNNRTC/GAYNNNNNNCTAG 606 573/560 94.55/92.41 X276_12360 M.Cpa598II In addition to above-mentioned type I R-M systems, three more putative R-M systems were predicted, including two type II R-M systems and...”

M.PspJ380I Type I methyltransferase recognizing CAANNNNNNNNCTGG with methylation at 3(m6A),-3(m6A) from Pseudomonas species J380
53% identity, 82% coverage

M.RbaPBA2bI Type I methyltransferase recognizing GACNNNNNTTTC with methylation at 2(m6A),-4(m6A) from Rhodobacteraceae bacterium isolate PB-A2_LS01-2011-b
57% identity, 93% coverage

M.Eco10960I Type I methyltransferase recognizing CGANNNNNNNNNTGAG with methylation at 3(m6A),-4(m6A) from Escherichia coli NCTC10960
52% identity, 81% coverage

M.Cco1330I Type I methyltransferase recognizing GYAYNNNNNNNCTGC with methylation at 3(m6A),-3(m6A) from Cronobacter condimenti 1330
57% identity, 72% coverage

M.PpuS12I Type I methyltransferase recognizing CGANNNNNNNNCTGG with methylation at 3(m6A),-3(m6A) from Pseudomonas putida S12
52% identity, 82% coverage

M.Cpa18696II Type I methyltransferase recognizing RAAANNNNNNNNTCGC with methylation at 4(m6A),-4(m6A) from Cohnella panacarvi Gsoil 349
54% identity, 94% coverage

M.Dae16536I Type I methyltransferase recognizing GACNNNNNNNCTGG with methylation at 2(m6A),-3(m6A) from Diaphorobacter aerolatus KACC 16536
51% identity, 82% coverage

M.Pno11628I Type I methyltransferase recognizing GGAGNNNNNNNRTG with methylation at 3(m6A),-2(m6A) from Pandoraea norimbergensis DSM-11628
51% identity, 98% coverage

M.PspR76I Type I methyltransferase recognizing GAGNNNNNNNCTGG with methylation at 2(m6A),-3(m6A) from Pseudomonas species R76
53% identity, 81% coverage

M.AviKJ1I Type I methyltransferase recognizing AYCNNNNNNGTAG with methylation at 1(m6A),-3(m6A) from Acinetobacter vivianii KJ-1
51% identity, 97% coverage

M.Kpn204I Type I methyltransferase recognizing CACNNNNNNNCTGC with methylation at 2(m6A),-3(m6A) from Klebsiella pneumoniae NCTC204
M.Kpn13695I Type I methyltransferase recognizing CACNNNNNNNCTGC with methylation at 2(m6A),-3(m6A) from Klebsiella pneumoniae NCTC13695
M.Kpn9632II Type I methyltransferase recognizing CACNNNNNNNCTGC with methylation at 2(m6A),-3(m6A) from Klebsiella pneumoniae NCTC9632
M.Kpn9635I Type I methyltransferase recognizing CACNNNNNNNCTGC with methylation at 2(m6A),-3(m6A) from Klebsiella pneumoniae NCTC9635
M.Kpn9636II Type I methyltransferase recognizing CACNNNNNNNCTGC with methylation at 2(m6A),-3(m6A) from Klebsiella pneumoniae NCTC9636
M.Kpn9637I Type I methyltransferase recognizing CACNNNNNNNCTGC with methylation at 2(m6A),-3(m6A) from Klebsiella pneumoniae NCTC9637
52% identity, 82% coverage

M.Kpn8849I Type I methyltransferase recognizing CACNNNNNNNCTGC with methylation at 2(m6A),-3(m6A) from Klebsiella pneumoniae NCTC8849
51% identity, 82% coverage

M.Cvi9370I Type I methyltransferase recognizing GAGNNNNNNNNTGAC with methylation at 2(m6A),-4(m6A) from Chromobacterium violaceum NCTC9370
56% identity, 72% coverage

M.Cta13490I Type I methyltransferase recognizing CAYNNNNNNNRTANYC with methylation at 2(m6A),-5(m6A) from Chryseobacterium taklimakanense NCTC13490
49% identity, 98% coverage

M.Mha1329I Type I methyltransferase recognizing GNGAYNNNNNNNNTGT with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 1329
M.Mha1367I Type I methyltransferase recognizing GNGAYNNNNNNNRTTG with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 1367
M.Mha1567I Type I methyltransferase recognizing GNGAYNNNNNNNRTTG with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 1567
M.Mha1571I Type I methyltransferase recognizing GNGAYNNNNNNNRTTG with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 1571
M.Mha1583II Type I methyltransferase recognizing GNGAYNNNNNNNRTTG with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 1583
M.Mha22604I Type I methyltransferase recognizing GNGAYNNNNNNNRTTG with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 22604
M.Mha22650II Type I methyltransferase recognizing GNGAYNNNNNNNRTTG with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 22650
M.Mha23217II Type I methyltransferase recognizing GNGAYNNNNNNNRTTG with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 23217
M.Mha23278II Type I methyltransferase recognizing GNGAYNNNNNNNRTTG with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 23278
M.Mha23311II Type I methyltransferase recognizing GNGAYNNNNNNNRTTG with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 23311
M.Mha23533II Type I methyltransferase recognizing GNGAYNNNNNNNNTGT with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 23533
M.Mha23558II Type I methyltransferase recognizing GNGAYNNNNNNNNTGT with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 23558
M.Mha23570II Type I methyltransferase recognizing GNGAYNNNNNNNRTTG with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 23570
M.Mha28226III Type I methyltransferase recognizing GNGAYNNNNNNNNTGT with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 28226
M.Mha28240II Type I methyltransferase recognizing GNGAYNNNNNNNRTTG with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 28240
M.Mha28253II Type I methyltransferase recognizing GNGAYNNNNNNNRTTG with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 28253
M.Mha32795I Type I methyltransferase recognizing GNGAYNNNNNNNRTTG with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 32795
M.Mha32852I Type I methyltransferase recognizing GNGAYNNNNNNNNTGT with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 32852
M.Mha33690I Type I methyltransferase recognizing GNGAYNNNNNNNNTGT with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 33690
M.Mha33702I Type I methyltransferase recognizing GNGAYNNNNNNNNTGT with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 33702
M.Mha33980I Type I methyltransferase recognizing GNGAYNNNNNNNRTTG with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 33980
M.Mha34142I Type I methyltransferase recognizing GNGAYNNNNNNNNTGT with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 34142
M.Mha37121I Type I methyltransferase recognizing GNGAYNNNNNNNRTTG with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 37121
M.Mha37778I Type I methyltransferase recognizing GNGAYNNNNNNNNTGT with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 37778
M.Mha38089I Type I methyltransferase recognizing GNGAYNNNNNNNRTTG with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 38089
M.Mha38202I Type I methyltransferase recognizing GNGAYNNNNNNNRTTG with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 38202
M.Mha39107I Type I methyltransferase recognizing GNGAYNNNNNNNNTGT with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 39107
M.Mha39309I Type I methyltransferase recognizing GNGAYNNNNNNNRTTG with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 39309
M.Mha39373I Type I methyltransferase recognizing GNGAYNNNNNNNNTGT with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 39373
M.Mha39382I Type I methyltransferase recognizing GNGAYNNNNNNNNTGT with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 39382
M.Mha39394I Type I methyltransferase recognizing GNGAYNNNNNNNRTTG with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 39394
M.Mha39433I Type I methyltransferase recognizing GNGAYNNNNNNNNTGT with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 39433
M.Mha9380III Type I methyltransferase recognizing GNGAYNNNNNNNRTTG with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica NCTC9380
M.Mha9712IV Type I methyltransferase recognizing GNGAYNNNNNNNNTGT with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica NCTC9712
50% identity, 99% coverage

M.Mha184V Type I methyltransferase recognizing GNGAYNNNNNNNNTGT with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica USDA-ARS-USMARC-184
50% identity, 99% coverage

M.Mha183V Type I methyltransferase recognizing GNGAYNNNNNNNRTTG with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica USDA-ARS-USMARC-183
M.Mha1282I Type I methyltransferase recognizing GNGAYNNNNNNNRTTG with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 1282
M.Mha1287I Type I methyltransferase recognizing GNGAYNNNNNNNNTGT with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 1287
M.Mha1309I Type I methyltransferase recognizing GNGAYNNNNNNNRTTG with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 1309
M.Mha1319I Type I methyltransferase recognizing GNGAYNNNNNNNRTTG with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 1319
M.Mha1342I Type I methyltransferase recognizing GNGAYNNNNNNNNTGT with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 1342
M.Mha1373I Type I methyltransferase recognizing GNGAYNNNNNNNRTTG with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 1373
M.Mha1383I Type I methyltransferase recognizing GNGAYNNNNNNNNTGT with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 1383
M.Mha1405I Type I methyltransferase recognizing GNGAYNNNNNNNNTGT with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 1405
M.Mha1450I Type I methyltransferase recognizing GNGAYNNNNNNNNTGT with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 1450
M.Mha1451I Type I methyltransferase recognizing GNGAYNNNNNNNNTGT with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 1451
M.Mha1454I Type I methyltransferase recognizing GNGAYNNNNNNNNTGT with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 1454
M.Mha1471I Type I methyltransferase recognizing GNGAYNNNNNNNRTTG with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 1471
M.Mha1475I Type I methyltransferase recognizing GNGAYNNNNNNNNTGT with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 1475
M.Mha1476I Type I methyltransferase recognizing GNGAYNNNNNNNNTGT with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 1476
M.Mha1498I Type I methyltransferase recognizing GNGAYNNNNNNNNTGT with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 1498
M.Mha1503I Type I methyltransferase recognizing GNGAYNNNNNNNNTGT with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 1503
M.Mha1512I Type I methyltransferase recognizing GNGAYNNNNNNNRTTG with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 1512
M.Mha1514I Type I methyltransferase recognizing GNGAYNNNNNNNRTTG with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 1514
M.Mha1532I Type I methyltransferase recognizing GNGAYNNNNNNNNTGT with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 1532
M.Mha1560I Type I methyltransferase recognizing GNGAYNNNNNNNNTGT with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 1560
M.Mha1561I Type I methyltransferase recognizing GNGAYNNNNNNNRTTG with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 1561
M.Mha1563I Type I methyltransferase recognizing GNGAYNNNNNNNNTGT with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 1563
M.Mha1576I Type I methyltransferase recognizing GNGAYNNNNNNNRTTG with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 1576
M.Mha1582I Type I methyltransferase recognizing GNGAYNNNNNNNRTTG with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 1582
M.Mha1584I Type I methyltransferase recognizing GNGAYNNNNNNNRTTG with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 1584
M.Mha1609I Type I methyltransferase recognizing GNGAYNNNNNNNRTTG with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 1609
M.Mha185VI Type I methyltransferase recognizing GNGAYNNNNNNNNTGT with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica USDA-ARS-USMARC-185
M.Mha186IV Type I methyltransferase recognizing GNGAYNNNNNNNNTGT with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 186
M.Mha187V Type I methyltransferase recognizing GNGAYNNNNNNNNTGT with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 187
M.Mha191IV Type I methyltransferase recognizing GNGAYNNNNNNNNTGT with methylation at 4(m6A) from Mannheimia haemolytica 191
M.Mha193IV Type I methyltransferase recognizing GNGAYNNNNNNNRTTG with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 193
M.Mha22549I Type I methyltransferase recognizing GNGAYNNNNNNNNTGT with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 22549
M.Mha28488I Type I methyltransferase recognizing GNGAYNNNNNNNNTGT with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 28488
M.Mha32619I Type I methyltransferase recognizing GNGAYNNNNNNNRTTG with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 32619
M.Mha33041I Type I methyltransferase recognizing GNGAYNNNNNNNNTGT with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 33041
M.Mha38599I Type I methyltransferase recognizing GNGAYNNNNNNNNTGT with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 38599
M.Mha807III Type I methyltransferase recognizing GNGAYNNNNNNNRTTG with methylation at 4(m6A),-3(m6A) from Mannheimia haemolytica 89010807N
50% identity, 99% coverage

M.CrhXL97II Type I methyltransferase recognizing CAAYNNNNNNNRTANYC with methylation at 3(m6A),-5(m6A) from Chryseobacterium rhizoplanae XL97
51% identity, 97% coverage

M.Apl11384II Type I methyltransferase recognizing CCANNNNNNNNRTTG with methylation at 3(m6A),-3(m6A) from Actinobacillus pleuropneumoniae NCTC11384
50% identity, 99% coverage

M.Hha8540VI Type I methyltransferase recognizing GAYANNNNNNNNGTG with methylation at 4(m6A),-2(m6A) from Haemophilus haemoglobinophilus NCTC8540
M.Hha10619V Type I methyltransferase recognizing CAGNNNNNNNNTGG with methylation at 2(m6A),-3(m6A) from Haemophilus haemoglobinophilus NCTC10619
50% identity, 99% coverage

M.SpnD39IIIA Type I methyltransferase recognizing CRAANNNNNNNNCTG with methylation at 4(m6A),-2(m6A) from Streptococcus pneumoniae D39
M.SpnD39IIIB Type I methyltransferase recognizing CRAANNNNNNNNNTTC with methylation at 4(m6A),-3(m6A) from Streptococcus pneumoniae D39
M.SpnD39IIID Type I methyltransferase recognizing CACNNNNNNNCTG with methylation at 2(m6A),-2(m6A) from Streptococcus pneumoniae D39
50% identity, 100% coverage

M.Spn11886I Type I methyltransferase recognizing CACNNNNNNNCTG with methylation at 2(m6A),-2(m6A) from Streptococcus pneumoniae NCTC11886
SP_0509 type I restriction-modification system, M subunit from Streptococcus pneumoniae TIGR4
BHN418_03501 HsdM family class I SAM-dependent methyltransferase from Streptococcus pneumoniae BHN418
50% identity, 100% coverage

• Prediction and Validation of Immunogenic Domains of Pneumococcal Proteins Recognized by Human CD4⁺ T Cells
  van, Infection and immunity 2019
  • “...255 5.03 1.05 36 SP_1227 TIGR4 234 DNA-binding response regulator Unknown 94 5.9 1.63 36 SP_0509 TIGR4 HsdM 487 Type I restriction-modification system, M subunit Unknown 198 6.52 1.55 36 SP_0251 TIGR4 812 Formate acetyltransferase, putative Cytoplasm 331 7.39 1.34 36 SP_1221 TIGR4 1,084 Type II...”
• Phase variation in pneumococcal populations during carriage in the human nasopharynx
  De, Scientific reports 2020
  • “...(BHN418_03486) and hsdS (BHN418_03491) on contig 14 (GenBank ASHP01000014) and part of hsdS (BHN418_03496), hsdM (BHN418_03501), and hsdR (BHN418_03506) on contig 15 (GenBank ASHP01000015). This sequence has 99% protein identity to the same sequence in S. pneumoniae D39 (Manso 7 ). In the orientation shown the...”

M.Spa11032III Type I methyltransferase recognizing CRAANNNNNNNNCTG with methylation at 4(m6A),-2(m6A) from Sphingomonas paucimobilis NCTC11032
M.Spn11893II Type I methyltransferase recognizing CRAANNNNNNNNCTT with methylation at 4(m6A),-2(m6A) from Streptococcus pneumoniae NCTC11893
50% identity, 100% coverage

M.Spn11901II Type I methyltransferase recognizing CRAANNNNNNNNCTT with methylation at 4(m6A),-2(m6A) from Streptococcus pneumoniae NCTC11901
50% identity, 100% coverage

M.Psp912II Type I methyltransferase recognizing GCAYNNNNNNNNTCTY with methylation at 3(m6A),-4(m6A) from Paenibacillus species FSL R5-0912
50% identity, 98% coverage

M.Spn12977II Type I methyltransferase recognizing CRAANNNNNNNNCTG with methylation at ?(m6A),-2(m6A) from Streptococcus pneumoniae NCTC12977
50% identity, 100% coverage

M.Spn11889II Type I methyltransferase recognizing CRAANNNNNNNNNTTC with methylation at 4(m6A),-3(m6A) from Streptococcus pneumoniae NCTC11889
M.Spn11899II Type I methyltransferase recognizing CACNNNNNNNNTTC with methylation at 2(m6A) from Streptococcus pneumoniae NCTC11899
M.Spn11899III Type I methyltransferase recognizing CRAANNNNNNNNCTG with methylation at 4(m6A),-2(m6A) from Streptococcus pneumoniae NCTC11899
M.Spn11899IV Type I methyltransferase recognizing CRAANNNNNNNNCTT with methylation at 4(m6A),-2(m6A) from Streptococcus pneumoniae NCTC11899
50% identity, 100% coverage

M.Spn11904I Type I methyltransferase recognizing CACNNNNNNNNTTC with methylation at 2(m6A),-3(m6A) from Streptococcus pneumoniae NCTC11904
M.Spn11904II Type I methyltransferase recognizing CACNNNNNNNNTTC with methylation at 2(m6A),-3(m6A) from Streptococcus pneumoniae NCTC11904
50% identity, 100% coverage

M.Spn61II Type I methyltransferase recognizing CRAANNNNNNNNCTT with methylation at 4(m6A),-2(m6A) from Streptococcus pneumoniae SP61
M.Spn556II Type I methyltransferase recognizing CRAANNNNNNNNCTT with methylation at 4(m6A),-2(m6A) from Streptococcus pneumoniae ST556
50% identity, 100% coverage

M.Sin13771II Type I methyltransferase recognizing CYAANNNNNNNNCTT with methylation at 4(m6A),-2(m6A) from Streptococcus infantis NCTC13771
M.Spn10319I Type I methyltransferase recognizing CRAANNNNNNNNCTG with methylation at 4(m6A),-2(m6A) from Streptococcus pneumoniae NCTC10319
M.Spn11888I Type I methyltransferase recognizing CACNNNNNNNNTTC with methylation at 2(m6A),-3(m6A) from Streptococcus pneumoniae NCTC11888
M.Spn11888IV Type I methyltransferase recognizing CACNNNNNNNCTG with methylation at ?(m6A),-2(m6A) from Streptococcus pneumoniae NCTC11888
M.Spn11890I Type I methyltransferase recognizing CRAANNNNNNNNCTG with methylation at 4(m6A),-2(m6A) from Streptococcus pneumoniae NCTC11890
M.Spn11895I Type I methyltransferase recognizing CRAANNNNNNNNCTT with methylation at 4(m6A) from Streptococcus pneumoniae NCTC11895
M.Spn11895VI Type I methyltransferase recognizing CRAANNNNNNNNCTK with methylation at ?(m6A),-2(m6A) from Streptococcus pneumoniae NCTC11895
M.Spn11903II Type I methyltransferase recognizing CRAANNNNNNNNDTTC with methylation at 4(m6A),-3(m6A) from Streptococcus pneumoniae NCTC11903
M.Spn12140IV Type I methyltransferase recognizing CACNNNNNNNCTG with methylation at 2(m6A),-2(m6A) from Streptococcus pneumoniae NCTC12140
M.Spn13276I Type I methyltransferase recognizing CRAANNNNNNNNCTG with methylation at 4(m6A),-2(m6A) from Streptococcus pneumoniae NCTC13276
M.Spn13735II Type I methyltransferase recognizing CACNNNNNNNCTG with methylation at 2(m6A),-2(m6A) from Streptococcus pneumoniae NCTC13735
M.Spn1374I Type I methyltransferase recognizing CACNNNNNNNCTG with methylation at 2(m6A),-2(m6A) from Streptococcus pneumoniae NCTC13734
M.Spn170132II Type I methyltransferase recognizing CRAANNNNNNNNCTK with methylation at 4(m6A),-2(m6A) from Streptococcus pneumoniae SPN XDR SMC1710-32
M.Spn7466II Type I methyltransferase recognizing CRAANNNNNNNNNTTC with methylation at 4(m6A),-3(m6A) from Streptococcus pneumoniae NCTC7466
M.Spn75752I Type I methyltransferase recognizing CACNNNNNNNCTT with methylation at 2(m6A),-2(m6A) from Streptococcus pneumoniae SN75752
M.SpnD39IIIC Type I methyltransferase recognizing CACNNNNNNNNTTC with methylation at 2(m6A),-3(m6A) from Streptococcus pneumoniae D39
M.SpnRIII Type I methyltransferase recognizing CRAANNNNNNNNCTG with methylation at 4(m6A),-2(m6A) from Streptococcus pneumoniae R6
SPD_0454 type I restriction-modification system, M subunit from Streptococcus pneumoniae D39
spr0449 EcoE type I restriction modification enzyme M subunit from Streptococcus pneumoniae R6
50% identity, 100% coverage

• A random six-phase switch regulates pneumococcal virulence via global epigenetic changes
  Manso, Nature communications 2014
  • “...to left) includes hsdR (locus_tag SPD_0455; GenBank protein database accession code ABJ53942; REBASE SpnD39ORF782P), hsdM (SPD_0454; ABJ54850; M.SpnD39ORF454P) and hsdS (SPD_0453; ABJ53819; S3.SpnD39ORF454P), a Cre recombinase (SPD_0452; ABJ54057), a truncated hsdS gene with only one variable domain (SPD_0450; ABJ55250; S2.SpnD39ORF454P) and a further truncated hsdS gene...”
• Diversification of bacterial genome content through distinct mechanisms over different timescales
  Croucher, Nature communications 2014
  • “...of S. pneumoniae R6 [EMBL accession code: AE007317 ] 49 , corresponding to the complete spr0449 spnIVRhsdM CDS and invariant 5 region of the spr0448 spnIVRhsdS CDS. The unmapped pairs of those reads mapped in the correct orientation for providing information on the downstream region should...”

M.Spn12495I Type I methyltransferase recognizing CRAANNNNNNNNCTG with methylation at 4(m6A),-2(m6A) from Streptococcus pneumoniae NCTC12495
50% identity, 100% coverage

M.Lsp12082I Type I methyltransferase recognizing ACYNNNNNNCTGC with methylation at 1(m6A),-3(m6A) from Legionella spiritensis NCTC12082
49% identity, 97% coverage

M.Cbe13035I Type I methyltransferase recognizing AAGNNNNNNNNTTGC with methylation at 2(m6A),-4(m6A) from Clostridium beijerinckii NCTC13035
49% identity, 99% coverage

M.Spn110I Type I methyltransferase recognizing CACNNNNNNNCTT with methylation at 2(m6A),-2(m6A) from Streptococcus pneumoniae NT_110_58
50% identity, 100% coverage

M.Csp205I Type I methyltransferase recognizing TTCANNNNNNNNCTC with methylation at 4(m6A),-2(m6A) from Clostridium sp. KNHs205
49% identity, 98% coverage

M.Spn475I Type I methyltransferase recognizing CRAANNNNNNNNNTTC with methylation at 4(m6A),-3(m6A) from Streptococcus pneumoniae 475
M.Spn11891I Type I methyltransferase recognizing CACNNNNNNNCTG with methylation at 2(m6A),-2(m6A) from Streptococcus pneumoniae NCTC11891
M.Spn11891III Type I methyltransferase recognizing CRAANNNNNNNNNTTC with methylation at 4(m6A),-3(m6A) from Streptococcus pneumoniae NCTC11891
M.Spn11900I Type I methyltransferase recognizing CACNNNNNNNCTG with methylation at ?(m6A),-2(m6A) from Streptococcus pneumoniae NCTC11900
M.Spn11905I Type I methyltransferase recognizing CRAANNNNNNNNCTG with methylation at 4(m6A),-2(m6A) from Streptococcus pneumoniae NCTC11905
M.Spn11905II Type I methyltransferase recognizing CRAANNNNNNNNCTT with methylation at ?(m6A),-2(m6A) from Streptococcus pneumoniae NCTC11905
M.Spn13754I Type I methyltransferase recognizing CACNNNNNNNCTG with methylation at 2(m6A),-2(m6A) from Streptococcus pneumoniae NCTC13754
M.Spn13754II Type I methyltransferase recognizing CACNNNNNNNNTTC with methylation at 2(m6A),-3(m6A) from Streptococcus pneumoniae NCTC13754
M.Spn525I Type I methyltransferase recognizing CACNNNNNNNNTTC with methylation at 2(m6A),-3(m6A) from Streptococcus pneumoniae 525
M.Spn566I Type I methyltransferase recognizing CACNNNNNNNCTG with methylation at 2(m6A),-2(m6A) from Streptococcus pneumoniae 566
M.Spn573IV Type I methyltransferase recognizing CRAANNNNNNNNCTG with methylation at 4(m6A),-2(m6A) from Streptococcus pneumoniae 573
M.Spn574I Type I methyltransferase recognizing CRAANNNNNNNNNTTC with methylation at 4(m6A),-3(m6A) from Streptococcus pneumoniae 574
M.Spns521I Type I methyltransferase recognizing CRAANNNNNNNNNTTC with methylation at 4(m6A),-3(m6A) from Streptococcus pneumoniae 521
50% identity, 100% coverage

M.AmaHL49I Type I methyltransferase recognizing AAGNNNNNNNRTTGY with methylation at 2(m6A),-4(m6A) from Algoriphagus marincola HL-49
48% identity, 97% coverage

M.Ega8736I Type I methyltransferase recognizing CRTANNNNNNNNNTCC with methylation at 4(m6A),-3(m6A) from Enterococcus gallinarum NCTC8736
49% identity, 98% coverage

M.AciII Type I methyltransferase recognizing CYAANNNNNNNNCTG with methylation at 4(m6A),-2(m6A) from Arthrobacter citreus
49% identity, 98% coverage

M.Spn11908I Type I methyltransferase recognizing CRAANNNNNNNNCTT with methylation at 4(m6A) from Streptococcus pneumoniae NCTC11908
50% identity, 100% coverage

M.Apl10976III Type I methyltransferase recognizing CACNNNNNNNGTTY with methylation at 2(m6A),-3(m6A) from Actinobacillus pleuropneumoniae NCTC10976
49% identity, 99% coverage

M.BpaFA6I Type I methyltransferase recognizing GCANNNNNNNNRTRTC with methylation at 3(m6A),-4(m6A) from Bacillus paralicheniformis FA6
48% identity, 98% coverage

M.Jda07I Type I methyltransferase recognizing CAYNNNNNNNNTTAC with methylation at 2(m6A),-4(m6A) from Jeotgalibaca dankookensis EX-07
49% identity, 98% coverage

M.Efa2244I Type I methyltransferase recognizing GACNNNNNNNNTAC with methylation at 2(m6A),-3(m6A) from Enterococcus faecalis 3012STDY6252244
M.Sag8182I Type I methyltransferase recognizing GACNNNNNNNNTAC with methylation at 2(m6A),-3(m6A) from Streptococcus agalactiae NCTC8182
56% identity, 83% coverage

M.Sag515CII Type I methyltransferase recognizing GACNNNNNNNCTT with methylation at 2(m6A),-2(m6A) from Streptococcus agalactiae 515
55% identity, 83% coverage

M.AalSMS7III Type I methyltransferase recognizing GAGNNNNNNNGTG with methylation at 2(m6A),-2(m6A) from Arenibacter algicola SMS7
48% identity, 93% coverage

M.Bli8721I Type I methyltransferase recognizing CAAYNNNNNNNNTGC with methylation at 3(m6A),-3(m6A) from Bacillus licheniformis NCTC8721
48% identity, 98% coverage

M.LspCC1I Type I methyltransferase recognizing CTAYNNNNNNNNTCC with methylation at 3(m6A),-3(m6A) from Lentibacillus species JNUCC-1
48% identity, 98% coverage

M.MavHJWI Type I methyltransferase recognizing CAGCNNNNNNCTC with methylation at 2(m6A),-2(m6A) from Mycobacterium avium HJW
MAV_5027 type I restriction-modification system, M subunit from Mycobacterium avium 104
49% identity, 97% coverage

• Adaptive Changes in Mycobacterium avium Gene Expression Profile Following Infection of Genetically Susceptible and Resistant Mice
  Ignatov, Acta naturae 2010
  • “...gene rearrangements. Also, in sample B6, we detected an increased expression of the MAV_5024 and MAV_5027 genes coding for type II restriction-modification enzymes that protect cells from foreign DNA. The increased expression of the MAV_0382 (subunits of DNA-polymerase III) and MAV_4450 (ribosomal protein) genes in sample...”

M.Bpi12874IV Type I methyltransferase recognizing GRNTANNNNNNNNNTGG with methylation at 5(m6A),-3(m6A) from Brachyspira pilosicoli NCTC12874
49% identity, 96% coverage

M.Sru2024I Type I methyltransferase recognizing CYAANNNNNNNNCTG with methylation at 4(m6A),-2(m6A) from Selenomonas ruminantium AC2024
47% identity, 100% coverage

M.Nzo12229I Type I methyltransferase recognizing CYYANNNNNNNCTG with methylation at 4(m6A),-2(m6A) from Neisseria zoodegmatis NCTC12229
48% identity, 96% coverage

M.Lsp19320I Type I methyltransferase recognizing GAAYNNNNNNNNTGC with methylation at 3(m6A),-3(m6A) from Lactococcus species KACC 19320
49% identity, 100% coverage

M.Mhy10570II Type I methyltransferase recognizing CAGNNNNNNNNTGG with methylation at 2(m6A),-3(m6A) from Megamonas hypermegale NCTC10570
46% identity, 98% coverage

SSU1273 type I restriction-modification system M protein from Streptococcus suis P1/7
51% identity, 90% coverage

• Rapid evolution of virulence and drug resistance in the emerging zoonotic pathogen Streptococcus suis
  Holden, PloS one 2009
  • “...VanZ like family protein + + + SSU1272 type I restriction-modification system S protein + SSU1273 type I restriction-modification system M protein + + + SSU1274 type I restriction-modification system R protein + + + SSU1383 putative acyl carrier protein phosphodiesterase + + + SSU1402 putative...”

M.Cla13003II Type I methyltransferase recognizing CRAANNNNNNNNCTT with methylation at 4(m6A),-2(m6A) from Campylobacter lanienae NCTC13003
45% identity, 97% coverage

M.Mhy10571II Type I methyltransferase recognizing CRTANNNNNNNNNTGC with methylation at 4(m6A),-3(m6A) from Megamonas hypermegale NCTC10571
45% identity, 98% coverage

M.Esu35585II Type I methyltransferase recognizing CAAYNNNNNNNRTAG with methylation at 3(m6A),-3(m6A) from Eubacterium sulci
46% identity, 98% coverage

MNF30_02040 HsdM family class I SAM-dependent methyltransferase from Mycoplasma mycoides subsp. capri
44% identity, 100% coverage

• First Report and Comparative Genomic Analysis of a Mycoplasma mycoides Subspecies capri HN-A in Hainan Island
  Zhang, Microorganisms 2022
  • “...system. The MNF30_00015 and MNF30_00030 genes contained in ORTHOMCL912 encode HsdS protein. The MNF30_00035 and MNF30_02040 genes contained in ORTHOMCL913 encode HsdM protein. MNF30_00025 and MNF30_02035 encode HsdR (K01153). The type I RM system is ubiquitous in bacteria and it is considered as the most primitive...”

M.Pcr12858I Type I methyltransferase recognizing GCAYNNNNNNNCTG with methylation at 3(m6A),-2(m6A) from Porphyromonas crevioricanis NCTC12858
44% identity, 96% coverage

M.Sru3002III Type I methyltransferase recognizing GTCANNNNNNNNGTC with methylation at 4(m6A),-2(m6A) from Selenomonas ruminantium AB3002
47% identity, 96% coverage

M.Pdo1046II Type I methyltransferase recognizing CCANNNNNNNNRTC with methylation at 3(m6A),-2(m6A) from Phocaeicola dorei RJX1046
46% identity, 97% coverage

M.SenPU131II Type I methyltransferase recognizing GACNNNNNNGATG with methylation at 2(m6A),-2(m6A) from Salmonella enterica subsp. enterica serovar Kentucky PU131
46% identity, 94% coverage

M.Bsp14I Type I methyltransferase recognizing GCANNNNNNNNNTGC with methylation at 3(m6A) from Butyrivibrio sp. FCS014
47% identity, 94% coverage

M.PveF0319I Type I methyltransferase recognizing ACAYNNNNNNNRTC with methylation at 3(m6A),-2(m6A) from Prevotella veroralis F0319
44% identity, 95% coverage

M.BdoJR04II Type I methyltransferase recognizing CAAYNNNNNNNRTAG with methylation at 3(m6A),-3(m6A) from Bacteroides dorei JR04
M.BdoJR05I Type I methyltransferase recognizing CAAYNNNNNNNRTAG with methylation at 3(m6A),-3(m6A) from Bacteroides dorei JR05
43% identity, 97% coverage

M.Pin1933II Type I methyltransferase recognizing GAAYNNNNNNNRTG with methylation at 3(m6A),-2(m6A) from Prevotella intermedia KCOM 1933
44% identity, 96% coverage

M.PspE225III Type I methyltransferase recognizing GAAYNNNNNNNNTCG with methylation at 3(m6A),-3(m6A) from Prevotella species E2-25
43% identity, 96% coverage

M.Ara36733II Type I methyltransferase recognizing GAGNNNNNNGATG with methylation at 2(m6A),-2(m6A) from Actinomyces radicidentis
45% identity, 95% coverage

M.MdeFJG1IV Type I methyltransferase recognizing GAGNNNNNNGCTC with methylation at 2(m6A),-2(m6A) from Methylomonas denitrificans FJG1
48% identity, 72% coverage

M.PspE1522II Type I methyltransferase recognizing CAAYNNNNNNNNTTYG with methylation at 3(m6A),-4(m6A) from Prevotella species E15-22
43% identity, 96% coverage

Q7MPU6 type I site-specific deoxyribonuclease (EC 3.1.21.3) from Vibrio vulnificus (see paper)
44% identity, 89% coverage

M.Osp894I Type I methyltransferase recognizing GAGNNNNNNGATG with methylation at 2(m6A),-2(m6A) from Ottowia species oral taxon 894 W10237
46% identity, 69% coverage

M.Lbr556I Type I methyltransferase recognizing RTCANNNNNNNNNTCC with methylation at 4(m6A),-3(m6A) from Lactobacillus brevis UCCLB556
46% identity, 91% coverage

M.Psp4604II Type I methyltransferase recognizing GAGNNNNNNGCTG with methylation at 2(m6A),-2(m6A) from Paracoccus species CBA4604
45% identity, 94% coverage

M.Rba2021III Type I methyltransferase recognizing CYAANNNNNNNNGTC with methylation at 4(m6A),-2(m6A) from Ruminococcaceae bacterium AE2021
43% identity, 92% coverage

M.Ssp1112II Type I methyltransferase recognizing GACCNNNNNGCTG with methylation at 2(m6A),-2(m6A) from Streptomyces species 11-1-2
43% identity, 95% coverage

M.Hfe13102V Type I methyltransferase recognizing CTAYNNNNNNNRTG with methylation at 3(m6A),-2(m6A) from Helicobacter fennelliae NCTC13102
44% identity, 88% coverage

M.Cup11540I Type I methyltransferase recognizing TAAYNNNNNNNTAYC with methylation at 3(m6A),-4(m6A) from Campylobacter upsaliensis NCTC11540
42% identity, 96% coverage

M.Fen1006III Type I methyltransferase recognizing CRTANNNNNNNGTTG with methylation at 4(m6A),-3(m6A) from Francisella endociliophora strain FSC1006
38% identity, 98% coverage

5ybbA / Q8R9Q4 Structural basis underlying complex assembly andconformational transition of the type i r-m system (see paper)
39% identity, 96% coverage

• Ligand: s-adenosylmethionine (5ybbA)

M.TteMI Type I methyltransferase recognizing CACNNNNNNNTGC with methylation at 2(m6A),-3(m6A) from Thermoanaerobacter tengcongensis MB4T
TTE1547 Type I restriction-modification system methyltransferase subunit from Thermoanaerobacter tengcongensis MB4
39% identity, 93% coverage

• Structure of HsdS subunit from Thermoanaerobacter tengcongensis sheds lights on mechanism of dynamic opening and closing of type I methyltransferase
  Gao, PloS one 2011
  • “...tengcongensis genomic DNA [18] . The PCR products of tte-hsdS (ORF: TTE1545) and tte-hsdM (ORF: TTE1547) were cloned into the pET-DUET co-expression vector at cloning sites 1 (with N-terminal His tag) and 2 (without tag) respectively. Based on this co-expression vector of wild type TTE-HsdS/wild type...”

M.Bst12778I Type I methyltransferase recognizing TACNNNNNNRTCNNC with methylation at 2(m6A),-5(m6A) from Bacteriovorax stolpii DSM 12778
38% identity, 93% coverage

M.Fph036I Type I methyltransferase recognizing GRTANNNNNNNNTAYC with methylation at 4(m6A) from Francisella philomiragia O#319-036 [FSC 153]
38% identity, 98% coverage

M.FtnUII Type I methyltransferase recognizing CYYANNNNNNNCTC with methylation at 4(m6A),-2(m6A) from Francisella tularensis subsp. novicida U112
FTN_1152 type I restriction-modification system, subunit M (methyltransferase) from Francisella tularensis subsp. novicida U112
37% identity, 98% coverage

• Structural and functional analysis of the Francisella lysine decarboxylase as a key actor in oxidative stress resistance
  Felix, Scientific reports 2021
  • “...1.243209089 1.20616E05 dapD FTN_1727 2,3,4,5-tetrahydropyridine-2,6-carboxylate N -succinyltransferase 1.185622324 0.000977552 FTN_1258 Hypothetical protein 1.11437438 0.000177817 hsdM FTN_1152 Type I restriction-modification system, subunit M (methyltransferase) 1.098834276 0.000436818 FTN_1316 Hypothetical protein 1.075883638 0.005337719 FTN_1628 LysR family transcriptional regulator 1.010217775 0.001268379 hdsR FTN_0710 Type I restriction-modification system, subunit R (restriction)...”
  • “...although they lack functional KEGG assignment. These proteins included enzymes from type I restriction-modification systems (FTN_1152, HsdM; FTN_0710, HsdR) 52 and the N6-adenine-specific methylase (FTN_0655). In contrast, some other DNA repair proteins were expressed at higher levels following ldcF deletion. An example is exodeoxyribonuclease III (XthA),...”
• Identification of a novel small RNA modulating Francisella tularensis pathogenicity
  Postic, PloS one 2012
  • “...(HsdS) is encoded by FTN_1154 (green) and the modification subunit M (HsdM) is encoded by FTN_1152 (orange). The corresponding pseudogenes (indicated with gene names below arrows) in F. tularensis subsp. holarctica LVS and subsp. tularensis Schu S4 are represented using the same colors. The ftrC gene...”
• Genetic dissection of the Francisella novicida restriction barrier
  Gallagher, Journal of bacteriology 2008
  • “...(FTN_ 0710); for FtnUII (locus 3; type I), hsdMII (FTN_1152), hsdSII (FTN_1154), and hsdRII (FTN_1155); for FtnUIII (locus 4; type III), res (FTN_1487) and mod...”

M.Cly7489I Type I methyltransferase recognizing CYYANNNNNNNNTCNG with methylation at 4(m6A),-4(m6A) from Cellulophaga lytica DSM 7489
36% identity, 96% coverage

M.PspE19II Type I methyltransferase recognizing GCANNNNNNNNTGCG with methylation at 3(m6A) from Prevotella species E1-9
M.PspE133III Type I methyltransferase recognizing GCANNNNNNNNTGCG with methylation at 3(m6A),-4(m6A) from Prevotella species E13-3
M.PspE1aII Type I methyltransferase recognizing GCANNNNNNNNTGCG with methylation at 3(m6A) from Prevotella species E1-a
36% identity, 84% coverage

M.PspE225I Type I methyltransferase recognizing GCANNNNNNNNTGCG with methylation at 3(m6A),-4(m6A) from Prevotella species E2-25
36% identity, 84% coverage

M.GspJM1III Type I methyltransferase recognizing RTAGNNNNNNRTGG with methylation at 3(m6A),-3(m6A) from Gillisia sp. JM1
36% identity, 96% coverage

M.PspE133I Type I methyltransferase recognizing TACNNNNNNCTC with methylation at 2(m6A),-2(m6A) from Prevotella species E13-3
36% identity, 98% coverage

M.Cco9557II Type I methyltransferase recognizing CRAANNNNNNNRTTG with methylation at 4(m6A),-3(m6A) from Campylobacter coli BFR-CA-9557
M.Cco11437VI Type I methyltransferase recognizing CRAANNNNNNNRTTG with methylation at ?(m6A),-3(m6A) from Campylobacter coli NCTC11437
M.Cco54106I Type I methyltransferase recognizing CRAANNNNNNNRTAG with methylation at 4(m6A),-3(m6A) from Campylobacter coli CFSAN054106
36% identity, 96% coverage

M.Cco11366I Type I methyltransferase recognizing CYAANNNNNNNNTAYC with methylation at 4(m6A),-4(m6A) from Campylobacter coli NCTC11366
M.Cco12568III Type I methyltransferase recognizing CYAANNNNNNNNTAYC with methylation at 4(m6A),-4(m6A) from Campylobacter coli NCTC12568
36% identity, 96% coverage

M.PliMII Type I methyltransferase recognizing AAGNNNNNNNTGGG with methylation at 1(m6A),-4(m6A) from Planctomyces limnophilus DSM 3776
36% identity, 96% coverage

New Search

Statistics

How It Works

PaperBLAST builds a database of protein sequences that are linked to scientific articles. These links come from automated text searches against the articles in EuropePMC and from manually-curated information from GeneRIF, UniProtKB/Swiss-Prot, BRENDA, CAZy (as made available by dbCAN), BioLiP, CharProtDB, MetaCyc, EcoCyc, TCDB, REBASE, the Fitness Browser, and a subset of the European Nucleotide Archive with the /experiment tag. Given this database and a protein sequence query, PaperBLAST uses protein-protein BLAST to find similar sequences with E < 0.001.

To build the database, we query EuropePMC with locus tags, with RefSeq protein identifiers, and with UniProt accessions. We obtain the locus tags from RefSeq or from MicrobesOnline. We use queries of the form "locus_tag AND genus_name" to try to ensure that the paper is actually discussing that gene. Because EuropePMC indexes most recent biomedical papers, even if they are not open access, some of the links may be to papers that you cannot read or that our computers cannot read. We query each of these identifiers that appears in the open access part of EuropePMC, as well as every locus tag that appears in the 500 most-referenced genomes, so that a gene may appear in the PaperBLAST results even though none of the papers that mention it are open access. We also incorporate text-mined links from EuropePMC that link open access articles to UniProt or RefSeq identifiers. (This yields some additional links because EuropePMC uses different heuristics for their text mining than we do.)

For every article that mentions a locus tag, a RefSeq protein identifier, or a UniProt accession, we try to select one or two snippets of text that refer to the protein. If we cannot get access to the full text, we try to select a snippet from the abstract, but unfortunately, unique identifiers such as locus tags are rarely provided in abstracts.

PaperBLAST also incorporates manually-curated protein functions:

• Proteins from NCBI's RefSeq are included if a GeneRIF entry links the gene to an article in PubMed^®. GeneRIF also provides a short summary of the article's claim about the protein, which is shown instead of a snippet.
• Proteins from Swiss-Prot (the curated part of UniProt) are included if the curators identified experimental evidence for the protein's function (evidence code ECO:0000269). For these proteins, the fields of the Swiss-Prot entry that describe the protein's function are shown (with bold headings).
• Proteins from BRENDA, a curated database of enzymes, are included if they are linked to a paper in PubMed and their full sequence is known.
• Every protein from the non-redundant subset of BioLiP, a database of ligand-binding sites and catalytic residues in protein structures, is included. Since BioLiP itself does not include descriptions of the proteins, those are taken from the Protein Data Bank. Descriptions from PDB rely on the original submitter of the structure and cannot be updated by others, so they may be less reliable. (For SitesBLAST and Sites on a Tree, we use a larger subset of BioLiP so that every ligand is represented among a group of structures with similar sequences, but for PaperBLAST, we use the non-redundant set provided by BioLiP.)
• Every protein from EcoCyc, a curated database of the proteins in Escherichia coli K-12, is included, regardless of whether they are characterized or not.
• Proteins from the MetaCyc metabolic pathway database are included if they are linked to a paper in PubMed and their full sequence is known.
• Proteins from the Transport Classification Database (TCDB) are included if they have known substrate(s), have reference(s), and are not described as uncharacterized or putative. (Some of the references are not visible on the PaperBLAST web site.)
• Every protein from CharProtDB, a database of experimentally characterized protein annotations, is included.
• Proteins from the CAZy database of carbohydrate-active enzymes are included if they are associated with an Enzyme Classification number. Even though CAZy does not provide links from individual protein sequences to papers, these should all be experimentally-characterized proteins.
• Proteins from the REBASE database of restriction enzymes are included if they have known specificity.
• Every protein with an evidence-based reannotation (based on mutant phenotypes) in the Fitness Browser is included.
• Sequence-specific transcription factors (including sigma factors and DNA-binding response regulators) with experimentally-determined DNA binding sites from the PRODORIC database of gene regulation in prokaryotes.
• Putative transcription factors from RegPrecise that have manually-curated predictions for their binding sites. These predictions are based on conserved putative regulatory sites across genomes that contain similar transcription factors, so PaperBLAST clusters the TFs at 70% identity and retains just one member of each cluster.
• Coding sequence (CDS) features from the European Nucleotide Archive (ENA) are included if the /experiment tag is set (implying that there is experimental evidence for the annotation), the nucleotide entry links to paper(s) in PubMed, and the nucleotide entry is from the STD data class (implying that these are targeted annotated sequences, not from shotgun sequencing). Also, to filter out genes whose transcription or translation was detected, but whose function was not studied, nucleotide entries or papers with more than 25 such proteins are excluded. Descriptions from ENA rely on the original submitter of the sequence and cannot be updated by others, so they may be less reliable.

Except for GeneRIF and ENA, the curated entries include a short curated description of the protein's function. For entries from BioLiP, the protein's function may not be known beyond binding to the ligand. Many of these entries also link to articles in PubMed.

For more information see the PaperBLAST paper (mSystems 2017) or the code. You can download PaperBLAST's database here.

Changes to PaperBLAST since the paper was written:

• November 2023: incorporated PRODORIC and RegPrecise. Many PRODORIC entries were not linked to a protein sequence (no UniProt identifier), so we added this information.
• February 2023: BioLiP changed their download format. PaperBLAST now includes their non-redundant subset. SitesBLAST and Sites on a Tree use a larger non-redundant subset that ensures that every ligand is represented within each cluster. This should ensure that every binding site is represented.
• June 2022: incorporated some coding sequences from ENA with the /experiment tag.
• March 2022: incorporated BioLiP.
• April 2020: incorporated TCDB.
• April 2019: EuropePMC now returns table entries in their search results. This has expanded PaperBLAST's database, but most of the new entries are of low relevance, and the resulting snippets are often just lists of locus tags with annotations.
• February 2018: the alignment page reports the conservation of the hit's functional sites (if available from from Swiss-Prot or UniProt)
• January 2018: incorporated BRENDA.
• December 2017: incorporated MetaCyc, CharProtDB, CAZy, REBASE, and the reannotations from the Fitness Browser.
• September 2017: EuropePMC no longer returns some table entries in their search results. This has shrunk PaperBLAST's database, but has also reduced the number of low-relevance hits.

Many of these changes are described in Interactive tools for functional annotation of bacterial genomes.

Secrets

PaperBLAST cannot provide snippets for many of the papers that are published in non-open-access journals. This limitation applies even if the paper is marked as "free" on the publisher's web site and is available in PubmedCentral or EuropePMC. If a journal that you publish in is marked as "secret," please consider publishing elsewhere.

Omissions from the PaperBLAST Database

Many important articles are missing from PaperBLAST, either because the article's full text is not in EuropePMC (as for many older articles), or because the paper does not mention a protein identifier such as a locus tag, or because of PaperBLAST's heuristics. If you notice an article that characterizes a protein's function but is missing from PaperBLAST, please notify the curators at UniProt or add an entry to GeneRIF. Entries in either of these databases will eventually be incorporated into PaperBLAST. Note that to add an entry to UniProt, you will need to find the UniProt identifier for the protein. If the protein is not already in UniProt, you can ask them to create an entry. To add an entry to GeneRIF, you will need an NCBI Gene identifier, but unfortunately many prokaryotic proteins in RefSeq do not have corresponding Gene identifers.

References

PaperBLAST: Text-mining papers for information about homologs.
M. N. Price and A. P. Arkin (2017). mSystems, 10.1128/mSystems.00039-17.

Europe PMC in 2017.
M. Levchenko et al (2017). Nucleic Acids Research, 10.1093/nar/gkx1005.

Gene indexing: characterization and analysis of NLM's GeneRIFs.
J. A. Mitchell et al (2003). AMIA Annu Symp Proc 2003:460-464.

UniProt: the universal protein knowledgebase.
The UniProt Consortium (2016). Nucleic Acids Research, 10.1093/nar/gkw1099.

BRENDA in 2017: new perspectives and new tools in BRENDA.
S. Placzek et al (2017). Nucleic Acids Research, 10.1093/nar/gkw952.

The EcoCyc database: reflecting new knowledge about Escherichia coli K-12.
I. M. Keeseler et al (2016). Nucleic Acids Research, 10.1093/nar/gkw1003.

The MetaCyc database of metabolic pathways and enzymes.
R. Caspi et al (2018). Nucleic Acids Research, 10.1093/nar/gkx935.

CharProtDB: a database of experimentally characterized protein annotations.
R. Madupu et al (2012). Nucleic Acids Research, 10.1093/nar/gkr1133.

The carbohydrate-active enzymes database (CAZy) in 2013.
V. Lombard et al (2014). Nucleic Acids Research, 10.1093/nar/gkt1178.

The Transporter Classification Database (TCDB): recent advances
M. H. Saier, Jr. et al (2016). Nucleic Acids Research, 10.1093/nar/gkv1103.

REBASE - a database for DNA restriction and modification: enzymes, genes and genomes.
R. J. Roberts et al (2015). Nucleic Acids Research, 10.1093/nar/gku1046.

Deep annotation of protein function across diverse bacteria from mutant phenotypes.
M. N. Price et al (2016). bioRxiv, 10.1101/072470.