PaperBLAST
PaperBLAST Hits for SwissProt::P32037 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 (Mus musculus (Mouse)) (493 a.a., MGTTKVTPSL...)
Show query sequence
>SwissProt::P32037 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 (Mus musculus (Mouse))
MGTTKVTPSLVFAVTVATIGSFQFGYNTGVINAPETILKDFLNYTLEERLEDLPSEGLLT
ALWSLCVAIFSVGGMIGSFSVGLFVNRFGRRNSMLLVNLLAIIAGCLMGFAKIAESVEML
ILGRLLIGIFCGLCTGFVPMYIGEVSPTALRGAFGTLNQLGIVVGILVAQIFGLDFILGS
EELWPGLLGLTIIPAILQSAALPFCPESPRFLLINKKEEDQATEILQRLWGTSDVVQEIQ
EMKDESVRMSQEKQVTVLELFRSPNYVQPLLISIVLQLSQQLSGINAVFYYSTGIFKDAG
VQEPIYATIGAGVVNTIFTVVSLFLVERAGRRTLHMIGLGGMAVCSVFMTISLLLKDDYE
AMSFVCIVAILIYVAFFEIGPGPIPWFIVAELFSQGPRPAAIAVAGCCNWTSNFLVGMLF
PSAAAYLGAYVFIIFAAFLIFFLIFTFFKVPETKGRTFEDIARAFEGQAHSGKGPAGVEL
NSMQPVKETPGNA
Running BLASTp...
Found 250 similar proteins in the literature:
GTR3_MOUSE / P32037 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Mus musculus (Mouse) (see 3 papers)
NP_035531 solute carrier family 2, facilitated glucose transporter member 3 isoform b from Mus musculus
100% identity, 100% coverage
- function: Facilitative glucose transporter (PubMed:35810171). Can also mediate the uptake of various other monosaccharides across the cell membrane (By similarity). Mediates the uptake of glucose, 2- deoxyglucose, galactose, mannose, xylose and fucose, and probably also dehydroascorbate (By similarity). Does not mediate fructose transport (By similarity). Required for mesendoderm differentiation (PubMed:35810171).
catalytic activity: D-glucose(out) = D-glucose(in) (RHEA:60376)
catalytic activity: D-galactose(in) = D-galactose(out) (RHEA:34915)
subunit: Interacts with SMIM43; the interaction may promote SLC2A3- mediated glucose transport to meet the energy needs of mesendoderm differentiation. - LPCAT1 Facilitates Keratinocyte Hyperproliferation and Skin Inflammation in Psoriasis by Regulating GLUT3.
Huang, The Journal of investigative dermatology 2024 (PubMed)- GeneRIF: LPCAT1 Facilitates Keratinocyte Hyperproliferation and Skin Inflammation in Psoriasis by Regulating GLUT3.
- GLUT3 promotes macrophage signaling and function via RAS-mediated endocytosis in atopic dermatitis and wound healing.
Yu, The Journal of clinical investigation 2023 - GeneRIF: GLUT3 promotes macrophage signaling and function via RAS-mediated endocytosis in atopic dermatitis and wound healing.
- Recurrent moderate hypoglycemia accelerates the progression of Alzheimer's disease through impairment of the TRPC6/GLUT3 pathway.
He, JCI insight 2022 - GeneRIF: Recurrent moderate hypoglycemia accelerates the progression of Alzheimer's disease through impairment of the TRPC6/GLUT3 pathway.
- The glucose transporter GLUT3 controls T helper 17 cell responses through glycolytic-epigenetic reprogramming.
Hochrein, Cell metabolism 2022 - GeneRIF: The glucose transporter GLUT3 controls T helper 17 cell responses through glycolytic-epigenetic reprogramming.
- CD205+ polymorphonuclear myeloid-derived suppressor cells suppress antitumor immunity by overexpressing GLUT3.
Fu, Cancer science 2021 - GeneRIF: CD205(+) polymorphonuclear myeloid-derived suppressor cells suppress antitumor immunity by overexpressing GLUT3.
- Adult glut3 homozygous null mice survive to demonstrate neural excitability and altered neurobehavioral responses reminiscent of neurodevelopmental disorders.
Shin, Experimental neurology 2021 - GeneRIF: Adult glut3 homozygous null mice survive to demonstrate neural excitability and altered neurobehavioral responses reminiscent of neurodevelopmental disorders.
- High NOV/CCN3 expression during high-fat diet pregnancy in mice affects GLUT3 expression and the mTOR pathway.
Wang, American journal of physiology. Endocrinology and metabolism 2021 (PubMed)- GeneRIF: High NOV/CCN3 expression during high-fat diet pregnancy in mice affects GLUT3 expression and the mTOR pathway.
- Developing Brain Glucose Transporters, Serotonin, Serotonin Transporter, and Oxytocin Receptor Expression in Response to Early-Life Hypocaloric and Hypercaloric Dietary, and Air Pollutant Exposures.
Ye, Developmental neuroscience 2021 - GeneRIF: Developing Brain Glucose Transporters, Serotonin, Serotonin Transporter, and Oxytocin Receptor Expression in Response to Early-Life Hypocaloric and Hypercaloric Dietary, and Air Pollutant Exposures.
- More
- Proteomic analysis reveals activation of platelet- and fibrosis-related pathways in hearts of ApoE-/- mice exposed to diesel exhaust particles.
Jung, Scientific reports 2023 - “...TGFB1 Transforming growth factor beta-1 proprotein 1.88 0.034 O08742 GP5 Platelet glycoprotein V 1.87 0.035 P32037 SLC2A3 Solute carrier family 2, facilitated glucose transporter member 3 1.77 0.008 Q07235 SERPINE2 Glia-derived nexin 1.75 0.018 P12399 CTLA2A Protein CTLA-2-alpha 1.75 0.018 Q8BTM8 FLNA Filamin-A 1.67 0.030 P41317...”
- Unraveling the Proteomic Landscape of Intestinal Epithelial Cell-Derived Exosomes in Mice.
Ding, Frontiers in physiology 2022 - “...0.735 0.083 Not 12 Q5DTL9 Slc4a10 Sodium-driven chloride bicarbonate exchanger 39.14 0.734 0.025 Down 13 P32037 Slc2a3 Solute carrier family 2, facilitated glucose transporter member 3 25.83 0.734 0.227 Not 14 Q8VEM8 Slc25a3 Phosphate carrier protein, mitochondrial 250.32 0.732 0.000 Down 15 Q9Z2J0 Slc23a1 Solute carrier...”
- miR-29a/b1 Regulates the Luteinizing Hormone Secretion and Affects Mouse Ovulation
Guo, Frontiers in endocrinology 2021 - “...P01216 Cga Glycoprotein hormones alpha chain OS=Mus musculus GN=Cga PE=2 SV=1 14 kDa 0.00035 1.35 P32037 Slc2a3 Solute carrier family 2, facilitated glucose transporter member 3 OS=Mus musculus GN=Slc2a3 PE=1 SV=1 53 kDa < 0.0001 1.35 Q8VCT4 Ces1d Carboxylesterase 1D OS=Mus musculus GN=Ces1d PE=1 SV=1 62...”
- Proteomics Landscape of Host-Pathogen Interaction in Acinetobacter baumannii Infected Mouse Lung
Li, Frontiers in genetics 2021 - “...P27870 Vav1 Vav 1 oncogene 1.22 1.66 P50404 Sftpd Surfactant associated protein D 1.35 1.56 P32037 Slc2a3 Solute carrier family 2 (facilitated glucose transporter), member 3 1.36 1.53 Q8BND5 Qsox1 Quiescin Q6 sulfhydryl oxidase 1 1.29 1.42 Q3U2S8 Hvcn1 Hydrogen voltage-gated channel 1 1.60 1.35 P28033...”
- The Impacts of Surgery and Intracerebral Electrodes in C57BL/6J Mouse Kainate Model of Epileptogenesis: Seizure Threshold, Proteomics, and Cytokine Profiles
Tse, Frontiers in neurology 2021 - “...3.6494 0.00901 17.52368 19.70244 18.78533 19.755233 Proteins downregulated in both surgery groups (vehicle and KA) P32037 Solute carrier family 2-(Glucose transporter type 3, brain) (GLUT-3) Slc2a3 Glut3 24.736 0.00002 4.6986 0.00191 22.52552 22.390868 22.63737 22.245415 Q62283 Tetraspanin-7 (Tspan-7/CD antigen CD231) Tspan7 Mxs1 21.247 4.31E-05 4.3654 0.00347...”
- Environmental Enrichment Upregulates Striatal Synaptic Vesicle-Associated Proteins and Improves Motor Function
Song, Frontiers in neurology 2018 - “...carboxyl-terminal hydrolase USP9X 1.51 O70161-3 Isoform 3 of Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma PIP5K1C 1.51 P32037 Solute carrier family 2, facilitated glucose transporter member 3 SLC2A3 1.51 Q91ZA3 Propionyl-CoA carboxylase alpha chain, mitochondrial PCCA 1.51 E9Q035 Protein Gm20425 GM20425 1.51 Q7TMY8-4 Isoform 4 of E3 ubiquitin-protein...”
- Major facilitator superfamily
Pao, Microbiology and molecular biology reviews : MMBR 1998 - “...P20303 S37476 P11168 P14246 P12336 P47842 P28568 P11169 P32037 P47843 Q07647 P14672 P14142 P19357 P22732 P46408 P43427 Q00712 B30310 U39197 U29377 U43375 U52842...”
GTR3_RAT / Q07647 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Rattus norvegicus (Rat) (see 3 papers)
TC 2.A.1.1.12 / Q07647 Glucose uniporter, Glut3 (also transports dehydro-ascorbate; Maulén et al., 2003). Down-regulated in the brains of Alzheimer's disease patients (Liu et al., 2008b) from Rattus norvegicus (Rat) (see 2 papers)
94% identity, 100% coverage
- function: Facilitative glucose transporter. Can also mediate the uptake of various other monosaccharides across the cell membrane. Mediates the uptake of glucose, 2-deoxyglucose, galactose, mannose, xylose and fucose, and probably also dehydroascorbate. Does not mediate fructose transport. Required for mesendoderm differentiation (By similarity).
catalytic activity: D-glucose(out) = D-glucose(in) (RHEA:60376)
catalytic activity: D-galactose(in) = D-galactose(out) (RHEA:34915)
subunit: Interacts with SMIM43; the interaction may promote SLC2A3- mediated glucose transport to meet the energy needs of mesendoderm differentiation. - substrates: glucose
tcdb comment: The structure of the human orthologue with D-glucose bound was solved at 1.5 Å resolution in the outward occluded conformation (Deng et al. 2015). Sugars are predominantly coordinated by polar residues in the C-terminal domain. The conformational transition from the outward-open to the outward-occluded states entails a prominent local rearrangement of the extracellular part of TMS 7. Comparison of the outward-facing GLUT3 structures with inward-open GLUT1 provides insight into the alternating access cycle for GLUTs, whereby the C-terminal domain provides the primary substrate-binding site and the N-terminal domain undergoes rigid-body rotation with respect to the C-terminal domain (Deng et al. 2015). Glut3 is involved in several disease states in humans (Lechermeier et al. 2019) - Proteomic investigation of acute and chronic hypoxia/reoxygenation responsive proteins and pathways in H9C2 cardiomyoblasts
Öztuğ, Turkish journal of biology = Turk biyoloji dergisi 2024 - “...alpha 1.56564E-16 O55043 Rho guanine nucleotide exchange factor 7 1.69661E-06 Q63433 Serine/threonine-protein kinase N1 8.76119E-12 Q07647 Solute carrier family 2, facilitated glucose transporter member 3 6.61577E-08 Q2M2R8 Peroxisomal targeting signal 1 receptor 4.86371E-05 Q9Z2J4 Nexilin 1.56564E-16 Q7TP54 Rho family-interacting cell polarization regulator 2 1.1613E-06 D4ACN8 Plasminogen...”
- Major facilitator superfamily
Pao, Microbiology and molecular biology reviews : MMBR 1998 - “...P11168 P14246 P12336 P47842 P28568 P11169 P32037 P47843 Q07647 P14672 P14142 P19357 P22732 P46408 P43427 Q00712 B30310 U39197 U29377 U43375 U52842 Z46381 L27651...”
- “...P37021 P09830 P09098 P21906 P43581 P13181 P11636 P30605 P07921 P15685 S59368 Q07647 U11843 P15686 Q02563 X78855 Q06222 SP SP SP SP SP SP SP SP SP SP PIR SP GB...”
XP_006237358 solute carrier family 2, facilitated glucose transporter member 3 isoform X1 from Rattus norvegicus
94% identity, 99% coverage
- Fructose-rich diet and walnut supplementation differently regulate rat hypothalamic and hippocampal glucose transporters expression.
Dakic, Journal of the science of food and agriculture 2021 (PubMed)- GeneRIF: Fructose-rich diet and walnut supplementation differently regulate rat hypothalamic and hippocampal glucose transporters expression.
- Aging alters glucose uptake in the naïve and injured rodent spinal cord.
von, Neuroscience letters 2019 - GeneRIF: findings show that age alters glucose uptake and GLUT3/4 expression profiles before and after Spinal Cord Injury.
- Altered lactate metabolism in Huntington's disease is dependent on GLUT3 expression.
Solís-Maldonado, CNS neuroscience & therapeutics 2018 - GeneRIF: Study found no differences in mRNA or protein levels of neuronal monocarboxylate transporters (MCTs). Functional analyses revealed that neuronal MCT2 had high catalytic efficiency in Huntington's disease (HD) cells. Ascorbic acid did not stimulate lactate uptake in HD cells; and was unable to inhibit glucose transport in HD cells because they exhibit decreased expression of the neuronal glucose transporter GLUT3.
- Chronic stress modulates regional cerebral glucose transporter expression in an age-specific and sexually-dimorphic manner.
Kelly, Physiology & behavior 2014 - GeneRIF: Hippocampal mRNA abundance of GLUT3 decreases with age in males and females
- Extracellular ATP-prinoceptor signaling and AMP-activated protein kinase regulate astrocytic glucose transporter 3 in an in vitro ischemia.
Iwabuchi, Neurochemistry international 2013 (PubMed)- GeneRIF: results suggest AMPK-regulated ATP production triggers the release of ATP to activate P2Y receptor signaling, which is another candidate that regulates GLUT3 expression under the ischemic condition
- IGF-1 induces hypoxia-inducible factor 1α-mediated GLUT3 expression through PI3K/Akt/mTOR dependent pathways in PC12 cells.
Yu, Brain research 2012 (PubMed)- GeneRIF: Expression of GLUT3 in response to IGF-1 is dependent on phosphatidylinositol (PI)-3-kinase and mTOR activity and requires transcription factor HIF-1alpha in neuronal PC12 cells.
- Triiodothyronine stimulates glucose transport in bone cells.
Zoidis, Endocrine 2012 (PubMed)- GeneRIF: Data suggest that triiodothyronine (T3) up-regulates Glut1 and Glut3 in osteoblasts; thus, increased glucose uptake induced by T3 may be mediated by these high-affinity glucose transporters.
- The expression of genes involved in glucose metabolism is affected by N-methyl-D-aspartate receptor antagonism: a putative link between metabolism and an animal model of psychosis.
Iasevoli, Journal of neuroscience research 2012 (PubMed)- GeneRIF: The results show that Hk1 and GLUT3 may play a role in the pathophysiology of ketamine-induced behavioral abnormalities.
- More
GTR3_RABIT / Q9XSC2 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Oryctolagus cuniculus (Rabbit) (see paper)
83% identity, 99% coverage
- function: Facilitative glucose transporter. Can also mediate the uptake of various other monosaccharides across the cell membrane. Mediates the uptake of glucose, 2-deoxyglucose, galactose, mannose, xylose and fucose, and probably also dehydroascorbate. Does not mediate fructose transport. Required for mesendoderm differentiation (By similarity).
catalytic activity: D-glucose(out) = D-glucose(in) (RHEA:60376)
catalytic activity: D-galactose(in) = D-galactose(out) (RHEA:34915)
subunit: Interacts with SMIM43; the interaction may promote SLC2A3- mediated glucose transport to meet the energy needs of mesendoderm differentiation.
GTR3_HUMAN / P11169 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Homo sapiens (Human) (see 6 papers)
TC 2.A.1.1.91 / P11169 Solute carrier family 2, facilitated glucose transporter member 3 (Glucose transporter type 3, brain) (GLUT-3 or GLUT3). It mediates the facilitative uptake of glucose, 2-deoxyglucose, galactose, mannose, xylose and fucose, and probably dehydroascorbate, but not fructose from Homo sapiens (see 6 papers)
NP_008862 solute carrier family 2, facilitated glucose transporter member 3 from Homo sapiens
83% identity, 99% coverage
- function: Facilitative glucose transporter (PubMed:26176916, PubMed:32860739, PubMed:9477959). Can also mediate the uptake of various other monosaccharides across the cell membrane (PubMed:26176916, PubMed:9477959). Mediates the uptake of glucose, 2- deoxyglucose, galactose, mannose, xylose and fucose, and probably also dehydroascorbate (PubMed:26176916, PubMed:9477959). Does not mediate fructose transport (PubMed:26176916, PubMed:9477959). Required for mesendoderm differentiation (By similarity).
catalytic activity: D-glucose(out) = D-glucose(in) (RHEA:60376)
catalytic activity: D-galactose(in) = D-galactose(out) (RHEA:34915)
subunit: Interacts with SMIM43; the interaction may promote SLC2A3- mediated glucose transport to meet the energy needs of mesendoderm differentiation. - substrates: glucose
tcdb comment: GLUT3, a key neuronal transporter, exhibits multiple intermediate states (Sun and Zheng 2019) - Glut-3 Gene Knockdown as a Potential Strategy to Overcome Glioblastoma Radioresistance.
Pucci, International journal of molecular sciences 2024 - GeneRIF: Glut-3 Gene Knockdown as a Potential Strategy to Overcome Glioblastoma Radioresistance.
- SLC2A3 promotes tumor progression through lactic acid-promoted TGF-β signaling pathway in oral squamous cell carcinoma.
Jiang, PloS one 2024 - GeneRIF: SLC2A3 promotes tumor progression through lactic acid-promoted TGF-beta signaling pathway in oral squamous cell carcinoma.
- The YTHDC1/GLUT3/RNF183 axis forms a positive feedback loop that modulates glucose metabolism and bladder cancer progression.
Yan, Experimental & molecular medicine 2023 - GeneRIF: The YTHDC1/GLUT3/RNF183 axis forms a positive feedback loop that modulates glucose metabolism and bladder cancer progression.
- GLUT3 promotes macrophage signaling and function via RAS-mediated endocytosis in atopic dermatitis and wound healing.
Yu, The Journal of clinical investigation 2023 - GeneRIF: GLUT3 promotes macrophage signaling and function via RAS-mediated endocytosis in atopic dermatitis and wound healing.
- Concurrent presence of diabetes affects the GLUT3 programming of glucose metabolism in glioblastoma.
Kocaeli, European review for medical and pharmacological sciences 2023 (PubMed)- GeneRIF: Concurrent presence of diabetes affects the GLUT3 programming of glucose metabolism in glioblastoma.
- Peritoneal Expression of SGLT-2, GLUT1, and GLUT3 in Peritoneal Dialysis Patients.
Schricker, Kidney & blood pressure research 2022 (PubMed)- GeneRIF: Peritoneal Expression of SGLT-2, GLUT1, and GLUT3 in Peritoneal Dialysis Patients.
- miR-3189-targeted GLUT3 repression by HDAC2 knockdown inhibits glioblastoma tumorigenesis through regulating glucose metabolism and proliferation.
Kwak, Journal of experimental & clinical cancer research : CR 2022 - GeneRIF: miR-3189-targeted GLUT3 repression by HDAC2 knockdown inhibits glioblastoma tumorigenesis through regulating glucose metabolism and proliferation.
- The glucose transporter GLUT3 controls T helper 17 cell responses through glycolytic-epigenetic reprogramming.
Hochrein, Cell metabolism 2022 - GeneRIF: The glucose transporter GLUT3 controls T helper 17 cell responses through glycolytic-epigenetic reprogramming.
- More
- Comparison of the amyloid plaque proteome in Down syndrome, early-onset Alzheimer's disease, and late-onset Alzheimer's disease
Martá-Ariza, Acta neuropathologica 2025 - “...P02686 MBP Myelin basic protein 1.97E-06 1.7 P13637 ATP1A3 Sodium/potassium-transporting ATPase subunit alpha-3 1.95E-09 1.6 P11169 SLC2A3 Solute carrier family 2, facilitated glucose transporter member 3 1.97E-06 1.5 P41594 GRM5 Metabotropic glutamate receptor 5 1.45E-07 1.5 Late-onset ADPlaque vs Non-plaque Uniprot Accession ID Gene name Name...”
- “...1.25E-06 1.6 P20916 MAG Myelin-associated glycoprotein 4.16E-06 1.6 P02686 MBP Myelin basic protein 7.42E-06 1.6 P11169 SLC2A3 Solute carrier family 2, facilitated glucose transporter member 3 3.52E-05 1.5 P13637 ATP1A3 Sodium/potassium-transporting ATPase subunit alpha-3 2.8E-07 1.5 AD non-plaque tissue pairwise comparisons We identified 263 differentially expressed...”
- miR-373 promotes invasion and metastasis of colorectal cancer cells via activating ERK/MAPK pathway
Chen, Scientific reports 2024 - “...R P value Q9BTV4 1.412143144 UP 2.38652E-06 P28360 0.750072908 DOWN 2.34629E-05 P80188 1.349647612 UP 3.29035E-06 P11169 0.782828283 DOWN 2.38279E-05 Q8NDM7 1.347945205 UP 1.51136E-05 P47929 0.80342651 DOWN 0.000158276 Q9Y2Y6 1.661934339 UP 2.82104E-05 Q14533 0.788375559 DOWN 0.004104687 Q96L50 1.572898799 UP 3.46669E-05 Q02410 0.811047389 DOWN 0.004520402 P02787 1.200586725 UP...”
- Comparison of the Amyloid Plaque Proteome in Down Syndrome, Early-Onset Alzheimer's Disease and Late-Onset Alzheimer's Disease.
Martá-Ariza, Research square 2024 - “...P02686 MBP Myelin basic protein 1.97E-06 1.7 P13637 ATP1A3 Sodium/potassium-transporting ATPase subunit alpha-3 1.95E-09 1.6 P11169 SLC2A3 Solute carrier family 2, facilitated glucose transporter member 3 1.97E-06 1.5 P41594 GRM5 Metabotropic glutamate receptor 5 1.45E-07 1.5 Late-onset AD - Plaque vs Non-plaque Uniprot Accession ID Gene...”
- “...1.25E-06 1.6 P20916 MAG Myelin-associated glycoprotein 4.16E-06 1.6 P02686 MBP Myelin basic protein 7.42E-06 1.6 P11169 SLC2A3 Solute carrier family 2, facilitated glucose transporter member 3 3.52E-05 1.5 P13637 ATP1A3 Sodium/potassium-transporting ATPase subunit alpha-3 2.8E-07 1.5...”
- Dual inhibitory potential of ganoderic acid A on GLUT1/3: computational and in vitro insights into targeting glucose metabolism in human lung cancer.
Bashir, RSC advances 2024 - “...protein sequences for GLUT1 and GLUT3 were obtained from UniProt with the IDs P11166 and P11169, respectively, for this investigation. The outward-open conformation of GLUT3 protein structure labeled with PDB ID: 4ZW9 has a resolution of 1.5 and contains a single mutation (N43T). 27 To generate...”
- Overexpression of SERPINA3 suppresses tumor progression by modulating SPOP/NF‑κB in lung cancer
Jin, International journal of oncology 2023 - “...cancer type 2 susceptibility protein 384.202 19.397 0.000 O43791 SPOP Speckle-type POZ 42.132 16.291 0.042 P11169 SLC2A3 Solute carrier family 2, facilitated glucose transporter member 3 53.924 14.177 0.000 Q96PE1 ADGRA2 Adhesion G protein-coupled receptor A2 142.647 7.983 0.018 P41220 RGS2 Regulator of G-protein signaling 2...”
- Magnetic transferrin nanoparticles (MTNs) assay as a novel isolation approach for exosomal biomarkers in neurological diseases
Jang, Biomaterials research 2023 - “...Noelin Y Y Cluster 1 P51149 HUMAN RAB7A Ras-related protein Rab-7a Y N Cluster 2 P11169 HUMAN SLC2A3 Solute carrier family 2, facilitated glucose transporter member 3 Y N Cluster 3 Q66K66 HUMAN TMEM198 Transmembrane protein 198 N Y Cluster 1 P24821 HUMAN TNC Tenascin Y...”
- New findings on the action of hypericin in hypoxic cancer cells with a focus on the modulation of side population cells
Buľková, Biomedicine & pharmacotherapy = Biomedecine & pharmacotherapie 2023 - “...SPRYD4 SPRY domain-containing protein 4 -1,07 0,48 0,003 Q9UHR5 SAP30BP SAP30-binding protein -1,03 0,49 0,006 P11169 SLC2A3 Solute carrier family 2, facilitated glucose transporter member 3 -0,99 0,50 0,009 Q9BQ70 TCF25 Transcription factor 25 -0,95 0,52 0,009 Q13423 NNT NAD(P) transhydrogenase, mitochondrial (MTCH) -0,95 0,52 0,005...”
- Defining the proteomic landscape of cultured macrophages and their polarization continuum.
Oates, Immunology and cell biology 2023 - “...CD63 CD63 antigen 1.44 0.60 1.48 P13473 LAMP2 Lysosomeassociated membrane glycoprotein 2 0.36 0.64 1.43 P11169 SLC2A3 Solute carrier family 2, facilitated glucose transporter member 3 0.89 0.61 1.42 P11717 IGF2R Cationindependent mannose6phosphate receptor 1.04 0.48 0.58 Q92542 NCSTN Nicastrin 0.46 0.05 0.52 P48060 GLIPR1 Glioma...”
- More
NP_777028 solute carrier family 2, facilitated glucose transporter member 3 from Bos taurus
83% identity, 99% coverage
GTR3_SHEEP / P47843 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Ovis aries (Sheep) (see paper)
NP_001009770 solute carrier family 2, facilitated glucose transporter member 3 from Ovis aries
82% identity, 99% coverage
- function: Facilitative glucose transporter. Can also mediate the uptake of various other monosaccharides across the cell membrane. Mediates the uptake of glucose, 2-deoxyglucose, galactose, mannose, xylose and fucose, and probably also dehydroascorbate. Does not mediate fructose transport. Required for mesendoderm differentiation (By similarity).
catalytic activity: D-glucose(out) = D-glucose(in) (RHEA:60376)
catalytic activity: D-galactose(in) = D-galactose(out) (RHEA:34915)
subunit: Interacts with SMIM43; the interaction may promote SLC2A3- mediated glucose transport to meet the energy needs of mesendoderm differentiation. - Impact of Placental SLC2A3 Deficiency during the First-Half of Gestation.
Lynch, International journal of molecular sciences 2022 - GeneRIF: Impact of Placental SLC2A3 Deficiency during the First-Half of Gestation.
- iTRAQ-Based Identification of Proteins Related to Muscle Growth in the Pacific Abalone, Haliotis discus hannai.
Huang, International journal of molecular sciences 2017 - “...A1, actin-2, actin, solute carrier family 2 facilitated glucose transporter member 3 (SLC2A3; Accession Number: P47843) ACTB, GDPD1 Endometrial cancer - kitasatospora griseola strain MF730-N6 RKJC_4, EGFR, GDPD1 Shigellosis actin A1, actin-2, actin profilin (Accession Number: F4XXT7), ACTB, GDPD1 Regulation of actin cytoskeleton actin A1, actin-2,...”
- Production and release of antimicrobial and immune defense proteins by mammary epithelial cells following Streptococcus uberis infection of sheep
Addis, Infection and immunity 2013 - “...Q258K2 P28783 Q1JPB0 P20000 P20700 Q8SPQ0 P27214 O46522 P47843 Integrin beta-2 Myeloperoxidase Annexin A3 Vimentin Filamin A Coronin 1A Myosin 9 Protein S100A9...”
P58352 Solute carrier family 2, facilitated glucose transporter member 3 from Bos taurus
82% identity, 99% coverage
O62787 Solute carrier family 2, facilitated glucose transporter member 3 from Sus scrofa
81% identity, 99% coverage
- GPX5-Enriched Exosomes Improve Sperm Quality and Fertilization Ability.
Huang, International journal of molecular sciences 2024 - “...Accession Protein Name Fold of Change (HCR/LCR) p -Value O18994 Glutathione peroxidase 5 4.14 0.0094 O62787 Glucose transporter type 3 3.46 0.0141 O97763 Niemann Pick type C2 protein homolog 2.01 0.0010 P00336 L-lactate dehydrogenase B chain 4.50 0.0340 P00339 L-lactate dehydrogenase A chain isoform X3 2.62...”
GTR14_HUMAN / Q8TDB8 Solute carrier family 2, facilitated glucose transporter member 14; Glucose transporter type 14; GLUT-14 from Homo sapiens (Human) (see 3 papers)
TC 2.A.1.1.90 / Q8TDB8 Solute carrier family 2, facilitated glucose transporter member 14 (Glucose transporter type 14) (GLUT-14) from Homo sapiens (see 4 papers)
82% identity, 94% coverage
- function: Hexose transporter that can mediate the transport of glucose and dehydroascorbate across the cell membrane.
catalytic activity: D-glucose(out) = D-glucose(in) (RHEA:60376)
catalytic activity: L-dehydroascorbate(out) = L-dehydroascorbate(in) (RHEA:60380) - substrates: glucose
- Insights into Substrate and Inhibitor Selectivity among Human GLUT Transporters through Comparative Modeling and Molecular Docking
Ferreira, ACS omega 2019 - “...Q6PXP3; GLUT8: Q9NY64; GLUT9: Q9NRM0; GLUT10: O95528; GLUT11: Q9BYW1; GLUT12: Q8TD20; GLUT13 (MYCT): Q96QE2; GLUT14: Q8TDB8). Sequence alignment was manually checked in ViTO, 39 taking into account secondary structure prediction by the PSIPRED server. 47 Models were then built based on templates PDB 4ZW9 (GLUT3) and...”
- Discovery of a Human Testis-specific Protein Complex TEX101-DPEP3 and Selection of Its Disrupting Antibodies.
Schiza, Molecular & cellular proteomics : MCP 2018 - THE CONCISE GUIDE TO PHARMACOLOGY 2017/18: Transporters
Alexander, British journal of pharmacology 2017 - “...UniProt SLC2A1 , P11166 SLC2A2 , P11168 SLC2A3 , P11169 SLC2A4 , P14672 SLC2A14 , Q8TDB8 Common abreviation GLUT1 GLUT2 GLUT3 GLUT4 GLUT14 Substrates Dglucosamine (Dglucose = Dglucosamine) [ 537 ], dehydroascorbic acid [ 47 ], Dglucose (Dglucose = Dglucosamine) [ 537 ] Dglucosamine (Dglucosamine >...”
- The Concise Guide to PHARMACOLOGY 2015/16: Transporters
Alexander, British journal of pharmacology 2015 - “...UniProt SLC2A1 , P11166 SLC2A2 , P11168 SLC2A3 , P11169 SLC2A4 , P14672 SLC2A14 , Q8TDB8 Substrates Dglucosamine (Dglucose = Dglucosamine) [ 487 ], dehydroascorbic acid [ 39 ], Dglucose (Dglucose = Dglucosamine) [ 487 ] Dglucosamine (Dglucosamine > Dglucose) [ 487 ], Dglucose (Dglucosamine >...”
- Proton-coupled sugar transport in the prototypical major facilitator superfamily protein XylE
Wisedchaisri, Nature communications 2014 - “...GLUT8 (Q9NY64); Homo sapiens facilitated glucose transporter GLUT11 (Q9BYW1); Homo sapiens facilitated glucose transporter GLUT14 (Q8TDB8). Simulation system setup The crystal of structure of XylE with substrate bound in the outward-facing partially occluded conformation (PDB 4GBY) was used as initial coordinates. The pKa values of titratable...”
- Unraveling the sperm proteome and post-genomic pathways associated with sperm nuclear DNA fragmentation
Intasqui, Journal of assisted reproduction and genetics 2013 - “...P30613 P0CG38 P0CG39 P30041 P13861 P06702 Q9H0C2 Q8TDB8 P11169 Q15506 Q6UW49 Q9UJZ1 0.169 0.208 0.313 0.061 0.118 Identified Identified Identified Identified...”
- “...Int J Androl. 2008;31(3):337-45. 80. UniProt Entry Q8TDB8, http://www.uniprot.org/uniprot/Q8TDB8 81. Wang X, Sharma RK, Gupta A, George V, Thomas AJ, Falcone...”
- The Concise Guide to PHARMACOLOGY 2013/14: transporters
Alexander, British journal of pharmacology 2013 - “...GLUT2 GLUT3 GLUT4 GLUT14 HGNC, UniProt SLC2A1, P11166 SLC2A2, P11168 SLC2A3, P11169 SLC2A4, P14672 SLC2A14, Q8TDB8 Substrates D-glucose = D-glucosamine 104 , dehydroascorbic acid 99 D-glucosamine > D-glucose 104 D-glucose D-glucosamine D-glucose 104 Radioligands ( K d ) [3H]2-deoxyglucose [3H]2-deoxyglucose [3H]2-deoxyglucose [3H]2-deoxyglucose Class II transporters Overview...”
- Proteome alterations in primary human alveolar macrophages in response to influenza A virus infection.
Liu, Journal of proteome research 2012 - “...IPI00910047 P08107 Heat shock 70 kDa protein 1 HSPA1A 2.58 14 1 22.5 1.54E-203 IPI00152505 Q8TDB8 Glucose transporter member 14 GLUT14 2.49 2 2 2.9 0.02043 IPI00796379 F5H6I0 Beta-2-microglobulin B2M 2.21 3 3 21.3 3.74E-12 IPI00220007 B4E1T5 Apolipoprotein-L2 APOL2 2.14 4 4 10.4 1.54E-07 IPI00013455 P30622...”
- More
NP_001273166 solute carrier family 2, facilitated glucose transporter member 14 isoform d from Homo sapiens
82% identity, 91% coverage
- Adaptation to HIF1α Deletion in Hypoxic Cancer Cells by Upregulation of GLUT14 and Creatine Metabolism.
Valli, Molecular cancer research : MCR 2019 (PubMed)- GeneRIF: Under hypoxia and HIF1 blockade, cancer cells adapt their energy metabolism via upregulation of the GLUT14 glucose transporter and creatine metabolism providing new avenues for drug targeting.
- The SLC2A14 gene, encoding the novel glucose/dehydroascorbate transporter GLUT14, is associated with inflammatory bowel disease.
Amir, The American journal of clinical nutrition 2017 - GeneRIF: Three alleles in the SLC2A14 gene associated independently with inflammatory bowel disease.
- The SLC2A14 gene: genomic locus, tissue expression, splice variants, and subcellular localization of the protein.
Amir, Biochemistry and cell biology = Biochimie et biologie cellulaire 2016 (PubMed)- GeneRIF: report presents an expanded SLC2A14 gene locus and a more diverse tissue expression, concurring with the existing evidence for disease associations
- Both GLUT-1 and GLUT-14 are Independent Prognostic Factors in Gastric Adenocarcinoma.
Berlth, Annals of surgical oncology 2015 (PubMed)- GeneRIF: High expression of GLUT-14 was associated with Gastric Adenocarcinoma.
- Genetic association of SLC2A14 polymorphism with Alzheimer's disease in a Han Chinese population.
Wang, Journal of molecular neuroscience : MN 2012 (PubMed)- GeneRIF: SLC2A14 polymorphism has a possible role in changing the genetic susceptibility to late Alzheimer disease age of onset in a Han Chinese population.
7sptA / P11169 Crystal structure of exofacial state human glucose transporter glut3 (see paper)
84% identity, 95% coverage
- Ligand: alpha-d-glucopyranose (7sptA)
B7Z5A7 cDNA FLJ57557, highly similar to Solute carrier family 2, facilitated glucose transporter member 3 from Homo sapiens
84% identity, 85% coverage
NP_990842 solute carrier family 2, facilitated glucose transporter member 3 from Gallus gallus
72% identity, 98% coverage
P28568 Solute carrier family 2, facilitated glucose transporter member 3 from Gallus gallus
71% identity, 98% coverage
- Major facilitator superfamily
Pao, Microbiology and molecular biology reviews : MMBR 1998 - “...P13355 P11167 P20303 S37476 P11168 P14246 P12336 P47842 P28568 P11169 P32037 P47843 Q07647 P14672 P14142 P19357 P22732 P46408 P43427 Q00712 B30310 U39197 U29377...”
NP_001152798 solute carrier family 2, facilitated glucose transporter member 1 from Canis lupus familiaris
67% identity, 96% coverage
- Histological and immunohistochemical evaluation of stroma variations and their correlation with the Ki-67 index and expressions of glucose transporter 1 and monocarboxylate transporter 1 in canine thyroid C-cell carcinomas.
Kawamura, The Journal of veterinary medical science 2016 - GeneRIF: stroma variations reflect tumor cell proliferation and expressions of GLUT-1 and MCT-1 in canine thyroid C-cell carcinomas
- Hypoxia-Related Marker GLUT-1, CAIX, Proliferative Index and Microvessel Density in Canine Oral Malignant Neoplasia.
Meier, PloS one 2016 - GeneRIF: Hypoxia-Related Marker GLUT-1, CAIX, Proliferative Index and Microvessel Density in Canine Oral Malignant Neoplasia.
- Akita dogs possess GLUT1 in erythrocytes, and Na,K-ATPase activity enables more efficient ascorbic acid recycling.
Ogawa, The Journal of veterinary medical science 2016 - GeneRIF: All Akita dogs had GLUT1 in erythrocyte membranes
- Glucose transporter 1 expression accompanies hypoxia sensing in the cyclic canine corpus luteum.
Papa, Reproduction (Cambridge, England) 2014 (PubMed)- GeneRIF: Our data reveal that the glucose transporter is regulated throughout the corpus luteum lifespan and suggest that the corpus luteum depends on the sensing of hypoxia and the status of luteal vascularisation.
XP_020952567 solute carrier family 2, facilitated glucose transporter member 1 from Sus scrofa
68% identity, 96% coverage
Q59GX2 Solute carrier family 2, facilitated glucose transporter member 1 (Fragment) from Homo sapiens
67% identity, 91% coverage
- Proteome architecture of human-induced pluripotent stem cell-derived three-dimensional organoids as a tool for early diagnosis of neuronal disorders
Negi, Indian journal of pharmacology 2023 - “...3.793E-03 61 P33240 Cleavage stimulation factor subunit 2 CSTF2 2 60.9 5 1.67 2.576E-02 62 Q59GX2 Solute carrier family 2 (Facilitated glucose transporter) SLC2A1 3 57 6 1.65 5.484E-03 63 Q8NHP8 Putative phospholipase B-like 2 PLBD2 4 65.4 15 1.62 1.496E-02 64 Q1ZYL5 Tropomyosin 1 alpha...”
- Proteomics changes after negative pressure wound therapy in diabetic foot ulcers
Jia, Molecular medicine reports 2021 - “...ATP1B3 0.0047 ko04966 Collecting duct acid secretion E2RVJ0, V9HW21 SLC4A1, HEL-76 0.0065 ko04911 Insulin secretion Q59GX2, P54709 N/A, ATP1B3 0.0109 ko04210 Apoptosis O43236, P02549, P25774 SEPT4, SPTA1, CTSS 0.0133 ko05166 Human T-cell leukemia virus 1 infection Q59GX2, Q9Y277, P27824 N/A, VDAC3, CANX 0.0192 ko05143 African trypanosomiasis...”
- Enhancement of red blood cell transfusion compatibility using CRISPR-mediated erythroblast gene editing.
Hawksworth, EMBO molecular medicine 2018 - “...protein STOM 52 14 102 14 1.35 E7EMK3 Flotillin2 FLOT2 35 15 32 15 0.98 Q59GX2 Solute carrier family 2 (Facilitated glucose transporter) Glut1 SLC2A1 13 9 86 9 1.14 C8C504 Betaglobin HBB 94 21 2,705 1 0.93 P00915 Carbonic anhydrase 1 CA1 72 16 370...”
- Proteomic identification of nuclear processes manipulated by cytomegalovirus early during infection
Carter, Proteomics 2015 - “...7.94E-11 O75182 SIN3B Paired amphipathic helix protein Sin3b 2.44 8.80E-03 2.92E-02 3 3 3.9 8.47E-25 Q59GX2 SLC2A1 Solute carrier family 2 2.40 1.09E-02 3.41E-02 2 2 3.5 2.68E-10 J3QRU1 YES Tyrosine-protein kinase Yes 2.35 3.24E-03 1.40E-02 4 5 8.4 6.52E-11 O00505 KPNA3 Importin subunit alpha-4 2.35...”
- LC/MS-based quantitative proteomic analysis of paraffin-embedded archival melanomas reveals potential proteomic biomarkers associated with metastasis
Huang, PloS one 2009 - “...Q8TBK5 RPL6 60S ribosomal protein L6 2 0.005 Q02878 GAPDHS Glyceraldehyde-3-phosphate dehydrogenase, testis-specific 3 0.006 Q59GX2 GLUT1 Solute carrier family 2, facilitated glucose transporter member 1 2 0.007 Q14568 HSP90AA2 Heat shock protein HSP 90-alpha 2 17 0.008 P07195 LDHB L-lactate dehydrogenase B chain 12 0.008...”
GTR1_MOUSE / P17809 Solute carrier family 2, facilitated glucose transporter member 1; Glucose transporter type 1, erythrocyte/brain; GLUT-1; GT1 from Mus musculus (Mouse) (see 7 papers)
NP_035530 solute carrier family 2, facilitated glucose transporter member 1 isoform 1 from Mus musculus
68% identity, 96% coverage
- function: Facilitative glucose transporter, which is responsible for constitutive or basal glucose uptake (PubMed:17320047, PubMed:35810171). Has a very broad substrate specificity; can transport a wide range of aldoses including both pentoses and hexoses (By similarity). Most important energy carrier of the brain: present at the blood-brain barrier and assures the energy-independent, facilitative transport of glucose into the brain (By similarity). In association with BSG and NXNL1, promotes retinal cone survival by increasing glucose uptake into photoreceptors (By similarity). Required for mesendoderm differentiation (PubMed:35810171).
catalytic activity: D-glucose(out) = D-glucose(in) (RHEA:60376)
subunit: Found in a complex with ADD2, DMTN and SLC2A1. Interacts (via C-terminus cytoplasmic region) with DMTN isoform 2. Interacts with SNX27; the interaction is required when endocytosed to prevent degradation in lysosomes and promote recycling to the plasma membrane. Interacts with GIPC (via PDZ domain). Interacts with STOM. Interacts with SGTA (via Gln-rich region) (By similarity). Interacts with isoform 1 of BSG (By similarity). Interacts with SMIM43; the interaction may promote SLC2A1-mediated glucose transport to meet the energy needs of mesendoderm differentiation (PubMed:35810171).
disruption phenotype: Early embryonic lethality. - GLUT1 regulates the release of VEGF-A in the alveolar epithelium of lipopolysaccharide-induced acute lung injury.
Liang, Cell biology international 2024 (PubMed)- GeneRIF: GLUT1 regulates the release of VEGF-A in the alveolar epithelium of lipopolysaccharide-induced acute lung injury.
- GLUT1 mediates the release of HMGB1 from airway epithelial cells in mixed granulocytic asthma.
Tang, Biochimica et biophysica acta. Molecular basis of disease 2024 (PubMed)- GeneRIF: GLUT1 mediates the release of HMGB1 from airway epithelial cells in mixed granulocytic asthma.
- GLUT1-mediated glucose import in B cells is critical for anaplerotic balance and humoral immunity.
Bierling, Cell reports 2024 (PubMed)- GeneRIF: GLUT1-mediated glucose import in B cells is critical for anaplerotic balance and humoral immunity.
- Expression of the monocarboxylate transporter MCT1 is required for virus-specific mouse CD8+ T cell memory development.
D'Aria, Proceedings of the National Academy of Sciences of the United States of America 2024 - GeneRIF: Expression of the monocarboxylate transporter MCT1 is required for virus-specific mouse CD8[+] T cell memory development.
- GLUT1 Promotes NLRP3 Inflammasome Activation of Airway Epithelium in Lipopolysaccharide-Induced Acute Lung Injury.
Li, The American journal of pathology 2024 (PubMed)- GeneRIF: GLUT1 Promotes NLRP3 Inflammasome Activation of Airway Epithelium in Lipopolysaccharide-Induced Acute Lung Injury.
- GLUT1 overexpression enhances CAR T cell metabolic fitness and anti-tumor efficacy.
Shi, Molecular therapy : the journal of the American Society of Gene Therapy 2024 - GeneRIF: GLUT1 overexpression enhances CAR T cell metabolic fitness and anti-tumor efficacy.
- Astrocytic GLUT1 reduction paradoxically improves central and peripheral glucose homeostasis.
Ardanaz, Science advances 2024 - GeneRIF: Astrocytic GLUT1 reduction paradoxically improves central and peripheral glucose homeostasis.
- GLUT1 is redundant in hypoxic and glycolytic nucleus pulposus cells of the intervertebral disc.
Johnston, JCI insight 2023 - GeneRIF: GLUT1 is redundant in hypoxic and glycolytic nucleus pulposus cells of the intervertebral disc.
- More
- Extracellular Vesicles Secreted by Mouse Decidual Cells Carry Critical Information for the Establishment of Pregnancy
Ma, Endocrinology 2022 - “...cell death protein 6 0.00E+00 6.94E+05 UD Slc2a1 P17809 Solute carrier family 2, facilitated glucose transporter member 1 0.00E+00 3.26E+05 UD Igfbp7 F8WH23...”
- SWATH-Based Comprehensive Determination of the Localization of Apical and Basolateral Membrane Proteins Using Mouse Liver as a Model Tissue.
Hirano, Biomedicines 2022 - “...B2RX12 1.71 0.00 Yes Numb Q9QZS3 1.82 0.01 Yes Dnm2 P39054 1.74 0.02 Potentially Slc2a1 P17809 1.59 0.05 Yes Vapa Q9WV55 1.77 0.03 Yes Ap2m1 P84091 1.68 0.01 Yes Stx4 P70452 1.76 0.01 Yes Ap2a2 P17427 1.66 0.00 Yes Enzymes Efr3a Q8BG67 1.74 0.01 Yes Ap2s1...”
- Efficient isolation of brain capillary from a single frozen mouse brain for protein expression analysis.
Ogata, Journal of cerebral blood flow and metabolism : official journal of the International Society of Cerebral Blood Flow and Metabolism 2021 - Alport syndrome: Proteomic analysis identifies early molecular pathway alterations in Col4a3 knock out mice.
Nicolaou, Nephrology (Carlton, Vic.) 2020 - “...MM Glutathione Stransferase Mu 2 P52825 CPT2 4.34E02 0.5 NN MM Carnitine Opalmitoyltransferase 2, mitochondrial P17809 GTR1 2.83E03 0.5 NN MM Solute carrier family 2, facilitated glucose transporter member 1 O70133 DHX9 1.61E03 0.5 NN MM ATPdependent RNA helicase A O88322 NID2 4.49E03 0.5 NN MM...”
- PAX2 promotes epithelial ovarian cancer progression involving fatty acid metabolic reprogramming.
Feng, International journal of oncology 2020 - “...Protein accession no. Gene Protein description RM-PAX2 RM-WPI ratio Regulated type P - value Glycolysis P17809 Slc2a1, Glut-1, Glut1 Solute carrier family 2, facilitated glucose transporter member 1 0.86 - 0.3308 P17710 Hk1 Hexokinase-1 0.91 - 0.1620 O08528 Hk2 Hexokinase-2 0.83 - 0.2196 Q3TRM8 Hk3 Hexokinase-3...”
- MS/MS in silico subtraction-based proteomic profiling as an approach to facilitate disease gene discovery: application to lens development and cataract.
Aryal, Human genetics 2020 - “...Q9WUB3 Glycogen phosphorylase, muscle form None found 59 Nedd8 P29595 NEDD8 None found 60 Slc2a1 P17809 Solute carrier family 2, facilitated glucose transporter member 1 None found 61 Sf3b5 Q923D4 Splicing factor 3B subunit 5 (SF3b5) None found 62 Kif1a P33173 Kinesin-like protein KIF1A None found...”
- “...4.0 16.5 3.0E-93 0.00000 97.9 5.9 Cadm1 Q8R5M8 3.5 11.9 5.0E-31 0.00000 28.8 2.4 Slc2a1 P17809 3.1 9.5 1.0E-10 0.00000 11.5 1.2 Arvcf P98203 3.0 8.4 4.0E-19 0.00000 21.3 2.5 Tjp1 P39447 2.9 7.6 1.0E-41 0.00000 47.9 6.3 Ezr P26040 2.8 7.1 3.0E-70 0.00000 108.9 15.3...”
- Label-free quantitative mass spectrometry analysis of differential protein expression in the developing cochlear sensory epithelium
Darville, Proteome science 2018 - “...normalized spectral countsS.D. P62631 Elongation factor 1-alpha 2 20.79.79 Q6GQT1 Alpha-2-macroglobulin-P 11.54.54 P19221 Prothrombin 10.76.05 P17809 Acyl-CoA synthetase long-chain family member 6 9.408.54 Q5ICG5 Solute carrier family 2, facilitated glucose transporter member 1 8.408.77 P22599 Alpha-1-antitrypsin 12 5.804.88 Q99K67 Alpha-aminoadipic semialdehyde synthase 4.503.79 P00920 Carbonic anhydrase...”
- Native KCC2 interactome reveals PACSIN1 as a critical regulator of synaptic inhibition
Mahadevan, eLife 2017 - “...1 X JAGN1 Q5XKN4 12.0 1 X PPFIA3 P60469 11.0 1 X X X SLC2A1 P17809 11.0 0.96 X YWHAE P62259 10.0 0.99 X X X X X ACTN4 P57780 9.0 1 X X CRMP1 P97427 8.0 1 X X X X PITPNM2 Q6ZPQ6 8.0 1...”
- More
GTR1_RAT / P11167 Solute carrier family 2, facilitated glucose transporter member 1; Glucose transporter type 1, erythrocyte/brain; GLUT-1 from Rattus norvegicus (Rat) (see 6 papers)
NP_620182 solute carrier family 2, facilitated glucose transporter member 1 from Rattus norvegicus
67% identity, 96% coverage
- function: Facilitative glucose transporter, which is responsible for constitutive or basal glucose uptake (PubMed:2211693). Has a very broad substrate specificity; can transport a wide range of aldoses including both pentoses and hexoses (By similarity). Most important energy carrier of the brain: present at the blood-brain barrier and assures the energy-independent, facilitative transport of glucose into the brain (By similarity). In association with BSG and NXNL1, promotes retinal cone survival by increasing glucose uptake into photoreceptors (By similarity). Required for mesendoderm differentiation (By similarity).
catalytic activity: D-glucose(out) = D-glucose(in) (RHEA:60376)
subunit: Found in a complex with ADD2, DMTN and SLC2A1. Interacts (via C-terminus cytoplasmic region) with DMTN. Interacts with SNX27; the interaction is required when endocytosed to prevent degradation in lysosomes and promote recycling to the plasma membrane. Interacts with STOM (By similarity). Interacts with GIPC (via PDZ domain) (PubMed:10198040). Interacts with SGTA (via Gln-rich region) (PubMed:15708368). Interacts with isoform 1 of BSG (By similarity). Interacts with SMIM43; the interaction may promote SLC2A1-mediated glucose transport to meet the energy needs of mesendoderm differentiation (By similarity). - Proteomics Reveals the Potential Protective Mechanism of Hydrogen Sulfide on Retinal Ganglion Cells in an Ischemia/Reperfusion Injury Animal Model
Liu, Pharmaceuticals (Basel, Switzerland) 2020 - “...Atp2b2 0.0227347 low Q7TP47 Syncrip 0.0239965 low Q8NCB2 CAMKV 0.0247766 low P14854 COX6B1 0.0270203 low P11167 Slc2a1 0.0276784 low P45479 Ppt1 0.0279009 high Q9QZA2 Pdcd6ip 0.0299058 low P41498 Acp1 0.032686 high P10155 TROVE2 0.0333496 high Q64428 Hadha 0.0337918 low P83916 CBX1 0.0342579 high Q64560 Tpp2 0.0352463...”
- Membrane Protein Identification in Rodent Brain Tissue Samples and Acute Brain Slices
Joost, Cells 2019 - “...5 4 5 Transporters Q9JHZ9 System N amino acid transporter 1 10 2 0 1 P11167 Solute carrier family 2, facilitated glucose transporter member 1 11 3 3 2 Q8VII6 Choline transporter-like protein 1 10 1 1 0 Q63016 Large neutral amino acids transporter small subunit...”
- Stress alters the expression of cancer-related genes in the prostate.
Flores, BMC cancer 2017 - “...inhibitor/apoptosis Skp2 B2GUZ0 S-phase kinase-associated protein 2 (p45) 1.56 1.67 Ubiquitin ligase/cell cycle regulation Slc2a1 P11167 Solute carrier family 2 (facilitated glucose transporter, member 1 1.25 1.32 Glucose transporter/metabolism (nutrient uptake) Tinf2 Q5XIB8 TERF 1 (TRF1)- interacting nuclear factor 2 4.29 6.11 Telomeric DNA binding/chrosomome stability...”
- Eggshell membrane ameliorates hepatic fibrogenesis in human C3A cells and rats through changes in PPARγ-Endothelin 1 signaling.
Jia, Scientific reports 2014 - “...P02466 Collagen alpha-2(I) chain Col1a2 1.14 0.94 P62828 GTP-binding nuclear protein Ran Ran 1.58 0.81 P11167 Solute carrier family 2, facilitated glucose transporter member 1 Slc2a1 2.12 0.61 P13221 Aspartate aminotransferase, cytoplasmic Got1 1.02 0.83 P67874 Casein kinase II subunit beta Csnk2b 1.21 0.67 P48675 Desmin...”
- Carbon source metabolism and its regulation in cancer cells.
Yin, Critical reviews in eukaryotic gene expression 2012 - “...2 Major Metabolic Enzymes Up-regulated by HIF-1 Genes Swiss Prot Reference Slc2a1 Glucose transporter 1 P11167 119 HK2 Hexokinase 2 P52789 120 Ldha Lactate dehydrogenase A P06151 121 PDK1 pyruvate dehydrogenase kin; ase 1 Q15118 40 CAIX carbonic anhydrase IX Q8VHB5 42 MCT4 Monocarboxylate transporter4 Q15427...”
- “...3 Major Metabolic Enzymes Up-regulated by c-Myc Genes Swiss Prot Reference Slc2a1 Glucose transporter 1 P11167 47 HK2 Hexokinase 2 P52789 46 Ldha Lactate dehydrogenase A P06151 45 PDK1 Pyruvate dehydrogenase kinase 1 Q15118 46 Pfkl Phosphofructokinase (PFK1) P30835 47 Eno1 Enolase 1 P04764 47 TABLE...”
- Age-related changes in the retinal pigment epithelium (RPE).
Gu, PloS one 2012 - “...58 6.1 Y & A Solute carrier family 2, facilitated glucose transporter member 1 (Glut-1) P11167 55 13.0 Y & A Sulfated glycoprotein 1 (SGP-1) (Prosaposin) P10960 40 25.5 Y & A Transmembrane emp24 domain-containing protein 4 B5DEM3 30 12.8 A Ubiquitin carboxyl-terminal hydrolase 19 Q6J1Y9...”
- A microarray study of gene and protein regulation in human and rat brain following middle cerebral artery occlusion.
Mitsios, BMC neuroscience 2007 - “...0.6-fold 26 37 2.4-fold 3 days 0.05-fold 21 days Glucose Transporter 1 K03195 P11166 M13979 P11167 0.6-fold 26 37 11.6-fold 4 h 21 d Amongst these genes we examined in more detail a small subset with no prior report of a role in stroke (PAK1, MMP11...”
- High-throughput identification of IMCD proteins using LC-MS/MS.
Pisitkun, Physiological genomics 2006 - More
- Increased GLUT1 expression and localization to Golgi apparatus of acinar cells in the parotid gland of Goto-Kakizaki diabetic rats.
Maruo, Archives of oral biology 2023 (PubMed)- GeneRIF: Increased GLUT1 expression and localization to Golgi apparatus of acinar cells in the parotid gland of Goto-Kakizaki diabetic rats.
- A glucose-sensing mechanism with glucose transporter 1 and pyruvate kinase in the area postrema regulates hepatic glucose production in rats.
Li, The Journal of biological chemistry 2023 - GeneRIF: A glucose-sensing mechanism with glucose transporter 1 and pyruvate kinase in the area postrema regulates hepatic glucose production in rats.
- Intermedin alleviates diabetic vascular calcification by inhibiting GLUT1 through activation of the cAMP/PKA signaling pathway.
Zhang, Atherosclerosis 2023 (PubMed)- GeneRIF: Intermedin alleviates diabetic vascular calcification by inhibiting GLUT1 through activation of the cAMP/PKA signaling pathway.
- Measurements of basal d-glucose transport through GLUT1 across the intact plasma membrane of isolated segments from single fast- and slow-twitch skeletal muscle fibres of rat.
Rudayni, Acta physiologica (Oxford, England) 2022 - GeneRIF: Measurements of basal d-glucose transport through GLUT1 across the intact plasma membrane of isolated segments from single fast- and slow-twitch skeletal muscle fibres of rat.
- Cortical Dysplasia in Rats Provokes Neurovascular Alterations, GLUT1 Dysfunction, and Metabolic Disturbances That Are Sustained Post-Seizure Induction.
Ghosh, Molecular neurobiology 2022 - GeneRIF: Cortical Dysplasia in Rats Provokes Neurovascular Alterations, GLUT1 Dysfunction, and Metabolic Disturbances That Are Sustained Post-Seizure Induction.
- PPARγ alleviates peritoneal fibrosis progression along with promoting GLUT1 expression and suppressing peritoneal mesothelial cell proliferation.
Feng, Molecular and cellular biochemistry 2022 - GeneRIF: PPARgamma alleviates peritoneal fibrosis progression along with promoting GLUT1 expression and suppressing peritoneal mesothelial cell proliferation.
- Impact of hyperglycemia on the expression of GLUT1 during oral carcinogenesis in rats.
Dalal, Molecular biology reports 2022 (PubMed)- GeneRIF: Impact of hyperglycemia on the expression of GLUT1 during oral carcinogenesis in rats.
- Fetal Myocardial Expression of GLUT1: Roles of BPA Exposure and Cord Blood Exosomes in a Rat Model.
Ermini, Cells 2022 - GeneRIF: Fetal Myocardial Expression of GLUT1: Roles of BPA Exposure and Cord Blood Exosomes in a Rat Model.
- More
NP_990540 solute carrier family 2, facilitated glucose transporter member 1 from Gallus gallus
67% identity, 96% coverage
- Role of cardiac hypoxia in the pathogenesis of sudden death syndrome in broiler chickens - A metabolic and molecular study.
Safaei, Acta veterinaria Hungarica 2021 (PubMed)- GeneRIF: Role of cardiac hypoxia in the pathogenesis of sudden death syndrome in broiler chickens - A metabolic and molecular study.
- Localisation and function of glucose transporter GLUT1 in chicken (Gallus gallus domesticus) spermatozoa: relationship between ATP production pathways and flagellar motility.
Setiawan, Reproduction, fertility, and development 2020 (PubMed)- GeneRIF: Localisation and function of glucose transporter GLUT1 in chicken (Gallus gallus domesticus) spermatozoa: relationship between ATP production pathways and flagellar motility.
- Insulin acutely increases glucose transporter 1 on plasma membranes and glucose uptake in an AKT-dependent manner in chicken adipocytes.
Shimamoto, General and comparative endocrinology 2019 (PubMed)- GeneRIF: GLUT1 is an insulin-responsive GLUT in chicken adipocytes.
- Effects of first exogenous nutrients on the mRNA levels of atrogin-1/MAFbx and GLUT1 in the skeletal muscles of newly hatched chicks.
Ijiri, Comparative biochemistry and physiology. Part A, Molecular & integrative physiology 2017 (PubMed)- GeneRIF: effects of first exogenous nutrients on the mRNA levels of muscle atrophy F-box (atrogin-1/MAFbx) and glucose transporters (GLUTs) in the skeletal muscles of newly hatched chicks with no feed experience
- Gene expression pattern of glucose transporters in the skeletal muscles of newly hatched chicks.
Shimamoto, Bioscience, biotechnology, and biochemistry 2016 (PubMed)- GeneRIF: Phosphorylated AKT level was high in the skeletal muscles, suggesting a relationship between AKT and GLUT1 expression.
- Altered gene and protein expression of glucose transporter1 underlies dexamethasone inhibition of insulin-stimulated glucose uptake in chicken muscles.
Zhao, Journal of animal science 2012 (PubMed)- GeneRIF: The results of the present study indicate that the altered GLUT-1 gene and protein expression may contribute to the insulin resistance induced by dexamethasone treatment in chicken muscles.
SLC2A1 / P11166 solute carrier family 2, facilitated glucose transporter member 1 from Homo sapiens (see 25 papers)
GTR1_HUMAN / P11166 Solute carrier family 2, facilitated glucose transporter member 1; Glucose transporter type 1, erythrocyte/brain; GLUT-1; HepG2 glucose transporter from Homo sapiens (Human) (see 36 papers)
TC 2.A.1.1.28 / P11166 The erythrocyte/brain hexose facilitator, glucose transporter-1, Gtr1 or Glut1. Transports D-glucose, dehydroascorbate, arsenite and the flavonone, quercetin, via one pathway and water via a distinct channel. Sugar transport has been suggested to function via a sliding mechanism involving several sugar binding sites (Cunningham et al., 2006). Glut1 is the receptor for human T-cell leukemia virus (HTLV)) (Manel et al., 2003). It is regulated by stomatin (TC# 8.A.21) to take up dehydroascorbate (Montel-Hagen et al., 2008). Mutations cause Glut1 deficiency syndrome, a human encephalopathy that results from decreased glucose flux through the blood brain barrier from Homo sapiens (Human) (see 21 papers)
NP_006507 solute carrier family 2, facilitated glucose transporter member 1 from Homo sapiens
67% identity, 96% coverage
- function: Facilitative glucose transporter, which is responsible for constitutive or basal glucose uptake (PubMed:10227690, PubMed:10954735, PubMed:18245775, PubMed:19449892, PubMed:25982116, PubMed:27078104, PubMed:32860739). Has a very broad substrate specificity; can transport a wide range of aldoses including both pentoses and hexoses (PubMed:18245775, PubMed:19449892). Most important energy carrier of the brain: present at the blood-brain barrier and assures the energy- independent, facilitative transport of glucose into the brain (PubMed:10227690). In association with BSG and NXNL1, promotes retinal cone survival by increasing glucose uptake into photoreceptors (By similarity). Required for mesendoderm differentiation (By similarity).
catalytic activity: D-glucose(out) = D-glucose(in) (RHEA:60376)
subunit: Interacts with GIPC (via PDZ domain) (By similarity). Found in a complex with ADD2, DMTN and SLC2A1. Interacts (via C-terminus cytoplasmic region) with DMTN isoform 2 (PubMed:18347014). Interacts with SNX27; the interaction is required when endocytosed to prevent degradation in lysosomes and promote recycling to the plasma membrane (PubMed:23563491). Interacts with STOM (PubMed:23219802). Interacts with SGTA (via Gln-rich region) (By similarity). Interacts with isoform 1 of BSG (PubMed:25957687). - substrates: D-glucose, Dehydroascorbate, Quercetin, arsenite
tcdb comment: Mueckler and Makepeace (2009) have presented a model of the exofacial substrate-binding site and helical folding of Glut1. Glut1, 2, 4 and 9 are functional both in the plasma membrane and the endoplasmic reticulum (Takanaga and Frommer, 2010). Glut1 is down-regulated in the brains of Alzheimer's disease patients (Liu et al., 2008b).Metabolic stress rapidly stimulates blood-brain barrier endothelial cell sugar transport by acute up-regulation of plasma membrane GLUT1 levels, possibly involving an AMP-activated kinase activity (Cura and Carruthers, 2010). Serves as a receptor for neuropilin-1 (923aas; 2 TMSs; O14786) and heparan sulfate proteoglycans (HSPGs) (Hoshino, 2012). Glut1 has a nucleotide binding site, and nucleotide binding affects transport activity (Yao and Bajjalieh 2009). The protein serves as a receptor for dermatin and β-adducin which help link the spectrin-actin junctional complex to the erythrocyte plasma membrane (Khan et al. 2008). May play a role in paroxysmal dyskinesias (Erro et al. 2017). GLUT1 mediates infection of CD4+ lymphocytes by human T cell leukemia virus type 1 (Jin et al. 2006). Mutations in disordered regions can cause disease by introducing dileucine motifs, For example, mutations that are causative of GLUT1 deficiency syndrome are of this type and the mutated protein mislocalizes to intracellular compartments (Meyer et al. 2018). Glucose transits along a transmembrane pathway through significant rotational motions while maintaining hydrogen bonds with the protein (Galochkina et al. 2019). It is phosphoryated by protein kinase C-B (TC# 8.A.104.1.4) (Lee et al. 2015). GLUT1-mediated exchange of fluorosugars has been studied (Shishmarev et al. 2018) - Human umbilical cord mesenchymal stem cell-derived exosomal miR-214-3p regulates the progression of gallbladder cancer by regulating ACLY/GLUT1.
Liu, Advances in clinical and experimental medicine : official organ Wroclaw Medical University 2024 (PubMed)- GeneRIF: Human umbilical cord mesenchymal stem cell-derived exosomal miR-214-3p regulates the progression of gallbladder cancer by regulating ACLY/GLUT1.
- Gene expression of protein kinase AMP-activated catalytic subunit alpha 1 (PRKAA1), solute carrier family 2 member 1 (SLC2A1) and mechanistic target of rapamycin (MTOR) in metformin-treated type 2 diabetes patients with COVID-19: impact on inflammation markers.
Petakh, Inflammopharmacology 2024 (PubMed)- GeneRIF: Gene expression of protein kinase AMP-activated catalytic subunit alpha 1 (PRKAA1), solute carrier family 2 member 1 (SLC2A1) and mechanistic target of rapamycin (MTOR) in metformin-treated type 2 diabetes patients with COVID-19: impact on inflammation markers.
- Inhibition of glycolysis and SIRT1/GLUT1 signaling ameliorates the apoptotic effect of Leptosidin in prostate cancer cells.
Park, Phytotherapy research : PTR 2024 (PubMed)- GeneRIF: Inhibition of glycolysis and SIRT1/GLUT1 signaling ameliorates the apoptotic effect of Leptosidin in prostate cancer cells.
- GLUT1 mediates the release of HMGB1 from airway epithelial cells in mixed granulocytic asthma.
Tang, Biochimica et biophysica acta. Molecular basis of disease 2024 (PubMed)- GeneRIF: GLUT1 mediates the release of HMGB1 from airway epithelial cells in mixed granulocytic asthma.
- BRIX1 promotes ribosome synthesis and enhances glycolysis by selected translation of GLUT1 in colorectal cancer.
Jiang, The journal of gene medicine 2024 (PubMed)- GeneRIF: BRIX1 promotes ribosome synthesis and enhances glycolysis by selected translation of GLUT1 in colorectal cancer.
- HNRNPC Regulates GLUT1/LDHA Pathway by Stabilizing FOXM1 mRNA to Promote the Progression and Aerobic Glycolysis of Multiple Myeloma.
Wu, Annals of clinical and laboratory science 2024 (PubMed)- GeneRIF: HNRNPC Regulates GLUT1/LDHA Pathway by Stabilizing FOXM1 mRNA to Promote the Progression and Aerobic Glycolysis of Multiple Myeloma.
- Ubiquitin-specific protease 54 regulates GLUT1-mediated aerobic glycolysis to inhibit lung adenocarcinoma progression by modifying p53 degradation.
Chen, Oncogene 2024 (PubMed)- GeneRIF: Ubiquitin-specific protease 54 regulates GLUT1-mediated aerobic glycolysis to inhibit lung adenocarcinoma progression by modifying p53 degradation.
- PURA and GLUT1: Sweet partners for brain health.
Colombo, Biochimica et biophysica acta. Molecular basis of disease 2024 (PubMed)- GeneRIF: PURA and GLUT1: Sweet partners for brain health.
- More
- Network Pharmacology, Molecular Docking, and In Vitro Insights into the Potential of Mitragyna speciosa for Alzheimer's Disease
Hossain, International journal of molecular sciences 2024 - “...Disintegrin and metalloproteinase domain-containing protein 17 28 P05164 MPO Myeloperoxidase 29 P22303 ACHE Acetylcholinesterase 30 P11166 SLC2A1 Solute carrier family 2 31 P08473 MME Neprilysin 32 P49810 PSEN2 Presenilin-2 33 P07339 CTSD Cathepsin D 34 P07333 CSF1R Macrophage colony-stimulating factor 1 receptor 35 P30556 AGTR1 Type-1...”
- Insulin signaling and pharmacology in humans and in corals
Murthy, PeerJ 2024 - “...(2017) Ohira et al. (2005) GLUT1 Solute carrier family 2, facilitated glucose transporter member 1 P11166 (GTR1_HUMAN) Mueckler & Makepeace (2008) GLUT4 Solute carrier family 2, facilitated glucose transporter member 4 P14672 (GLUT4_HUMAN) Kawanishi et al. (2000) GRB2 Growth factor receptor-bound protein 2 P62993 (GRB2_HUMAN) Lowenstein...”
- “...Q14409 Glycerol kinase 3 553 pdam_00006960 100 1.00E46 2.50E50 424 11468 8476 (476) 18 GLUT1 P11166 Solute carrier family 2, facilitated glucose transporter member 1 492 pdam_00006372 100 1.40E40 4.10E44 445 15470 40484 (495) 45 GLUT4 P14672 Solute carrier family 2, facilitated glucose transporter member 4...”
- Endoplasmic Reticulum Stress in Bronchopulmonary Dysplasia: Contributor or Consequence?
Wu, Cells 2024 - “...Q04771 Enzyme Plasma membrane 1 Epilepsy, migraine SCN1A P35498 Transporter Plasma membrane 1 Dystonia SLC2A1 P11166 Transporter Plasma membrane 1 Diarrhea (cholera toxin) NHE3 P48764 Transporter Plasma membrane 1 Diabetes KCNJ11 Q14654 Transporter Plasma membrane 1 Intrahepatic cholestasis ATP8B1 O43520 Transporter Plasma membrane, Golgi apparatus, or...”
- Isolation method of brain microvessels from small frozen human brain tissue for blood-brain barrier protein expression analysis.
Ogata, Fluids and barriers of the CNS 2024 - “...Q8WUX1 Detected only in Bcap - SLC6A12 P48065 Detected only in Bcap - SLC2A1 (GLUT1) P11166 122 4.66E-06 SLC7A1 (ATRC1) P30825 36.7 8.42E-05 SLC16A1 (MCT1) P53985 15.8 5.55E-02 SLC5A6 (SMVT) Q9Y289 15.3 9.17E-03 SLC9A3R2 (NHERF2) Q15599 12.0 3.42E-05 SLC38A3 (SNAT3) Q99624 7.41 9.82E-04 SLC7A5 (LAT1) Q01650...”
- Dual inhibitory potential of ganoderic acid A on GLUT1/3: computational and in vitro insights into targeting glucose metabolism in human lung cancer.
Bashir, RSC advances 2024 - “...employed. The protein sequences for GLUT1 and GLUT3 were obtained from UniProt with the IDs P11166 and P11169, respectively, for this investigation. The outward-open conformation of GLUT3 protein structure labeled with PDB ID: 4ZW9 has a resolution of 1.5 and contains a single mutation (N43T). 27...”
- The Plasmodium vivax MSP1P-19 is involved in binding of reticulocytes through interactions with the membrane proteins band3 and CD71.
Zuo, The Journal of biological chemistry 2024 - “...Ankyrin1 P16157 7.6 206.1 9 4 Solute carrier family 2, facilitated glucose transporter member 1 P11166 4.33 54.1 2 5 55kDa erythrocyte membrane protein Q00013 5.35 52.3 2 6 Protein band 4.2 P16452 1.88 77.0 1 Extracellular loop 5 of band3 serves as a critical binding...”
- The Effect of a Nature-Based Gel on Gingival Inflammation and the Proteomic Profile of Crevicular Fluid: A Randomized Clinical Trial.
Figueiredo, Gels (Basel, Switzerland) 2024 - “...wound healing P10153 Non-secretory ribonuclease catalytic activity, acting on rna defense response to other organism P11166 Solute carrier family 2, facilitated glucose transporter member 1 transporter activity transmembrane transport P13224 Platelet glycoprotein Ib beta chain molecular transducer activity wound healing P16157-2 Ankyrin-1 structural molecule activity vesicle-mediated...”
- Strictosamide promotes wound healing through activation of the PI3K/AKT pathway.
Ming, Heliyon 2024 - “...IX alpha subunit SCN9A Q15858 NAD-dependent deacetylasesirtuin 2 SIRT2 Q8IXJ6 Glucose transporter (by homology) SLC2A1 P11166 Tyrosine-protein kinase SYK SYK P43405 DNA topoisomerase I TOP1 P11387 Fig. 7 Screening of STR and wound healing hub genes. (A). Venn diagram of the STR and the wound healing-related...”
- More
P13355 Solute carrier family 2, facilitated glucose transporter member 1 from Oryctolagus cuniculus
67% identity, 96% coverage
- Major facilitator superfamily
Pao, Microbiology and molecular biology reviews : MMBR 1998 - “...P46501 U28735 U41023 U31961 P27674 P46896 P11166 P17809 P13355 P11167 P20303 S37476 P11168 P14246 P12336 P47842 P28568 P11169 P32037 P47843 Q07647 P14672 P14142...”
GTR1_CHICK / P46896 Solute carrier family 2, facilitated glucose transporter member 1; Glucose transporter type 1; GLUT-1; GT1 from Gallus gallus (Chicken) (see paper)
67% identity, 96% coverage
- function: Facilitative glucose transporter, which is responsible for constitutive or basal glucose uptake. Has a very broad substrate specificity; can transport a wide range of aldoses including both pentoses and hexoses. Most important energy carrier of the brain: present at the blood-brain barrier and assures the energy-independent, facilitative transport of glucose into the brain (By similarity). In association with BSG and NXNL1, promotes retinal cone survival by increasing glucose uptake into photoreceptors (PubMed:25957687). Required for mesendoderm differentiation (By similarity).
catalytic activity: D-glucose(out) = D-glucose(in) (RHEA:60376)
subunit: Interacts with isoform 1 of BSG. - Embryonic protein undernutrition by albumen removal programs the hepatic amino acid and glucose metabolism during the perinatal period in an avian model
Willems, PloS one 2014 - “...43,9 51 1 3 Cp GLUT1 Solute carrier family 2, facilitated glucose transporter member 1 P46896 8.82 54,1 42 2 1 Cm SMAD3 Mothers against decapentaplegic homolog 3 P84023 6.70 48,3 37 1 3 Cp, Nu LDHB L-lactate dehydrogenase B chain P00337 7.07 36,3 36 1...”
- Major facilitator superfamily
Pao, Microbiology and molecular biology reviews : MMBR 1998 - “...U28737 Z66522 Z66522 P46501 U28735 U41023 U31961 P27674 P46896 P11166 P17809 P13355 P11167 P20303 S37476 P11168 P14246 P12336 P47842 P28568 P11169 P32037 P47843...”
GTR1_BOVIN / P27674 Solute carrier family 2, facilitated glucose transporter member 1; Glucose transporter type 1, erythrocyte/brain; GLUT-1 from Bos taurus (Bovine) (see paper)
XP_006068373 solute carrier family 2, facilitated glucose transporter member 1 isoform X1 from Bubalus bubalis
NP_777027 solute carrier family 2, facilitated glucose transporter member 1 from Bos taurus
67% identity, 96% coverage
- function: Facilitative glucose transporter, which is responsible for constitutive or basal glucose uptake. Has a very broad substrate specificity; can transport a wide range of aldoses including both pentoses and hexoses. Most important energy carrier of the brain: present at the blood-brain barrier and assures the energy-independent, facilitative transport of glucose into the brain (By similarity). In association with BSG and NXNL1, promotes retinal cone survival by increasing glucose uptake into photoreceptors (By similarity). Required for mesendoderm differentiation (By similarity).
catalytic activity: D-glucose(out) = D-glucose(in) (RHEA:60376)
subunit: Found in a complex with ADD2, DMTN and SLC2A1. Interacts (via C-terminus cytoplasmic region) with DMTN. Interacts with SNX27; the interaction is required when endocytosed to prevent degradation in lysosomes and promote recycling to the plasma membrane. Interacts with GIPC (via PDZ domain). Interacts with STOM. Interacts with SGTA (via Gln-rich region) (By similarity). Interacts with BSG (By similarity). Interacts with SMIM43; the interaction may promote SLC2A1-mediated glucose transport to meet the energy needs of mesendoderm differentiation (By similarity). - Expression profiling of glucose transporter 1 (GLUT1) and apoptotic genes (BAX and BCL2) in milk enriched mammary epithelial cells (MEC) in riverine buffalo during lactation.
Yadav, Animal biotechnology 2014 (PubMed)- GeneRIF: Milk enriched mammary epithelial cells were used to study the expression pattern of GLUT1 and apoptotic genes (BAX and BCL2) across different stages of lactation in riverine buffalo in relation to milk yield.
- Glucose transporter expression differs between bovine monocyte and macrophage subsets and is influenced by milk production.
Eger, Journal of dairy science 2016 (PubMed)- GeneRIF: Low GLUT1 and GLUT3 expression in nonclassical monocytes was unaltered during differentiation into macrophages. GLUT4 mRNA was only detectable in unstimulated macrophages. Neither monocytes nor macrophages were insulin responsive.
- Glucose transporter and hypoxia-associated gene expression in the mammary gland of transition dairy cattle.
Mattmiller, Journal of dairy science 2011 (PubMed)- GeneRIF: Significant increases in GLUT1 gene expression were observed during early lactation.
- GLUT-1 glucose transporters in the blood-brain barrier: differential phosphorylation.
Devraj, Journal of neuroscience research 2011 - GeneRIF: the different conformations of the GLUT-1 transporter in luminal (blood facing) and abluminal (brain facing) membranes of bovine cerebral endothelial cells arise from differential phosphorylation of GLUT-1
- Hyperthermia-induced Hsp90·eNOS preserves mitochondrial respiration in hyperglycemic endothelial cells by down-regulating Glut-1 and up-regulating G6PD activity.
Presley, The Journal of biological chemistry 2010 - GeneRIF: Hyperthermia-induced Hsp90.eNOS preserves mitochondrial respiration in hyperglycemic endothelial cells by down-regulating Glut-1 and up-regulating G6PD activity.
- Human T cell leukemia virus envelope binding and virus entry are mediated by distinct domains of the glucose transporter GLUT1.
Manel, The Journal of biological chemistry 2005 (PubMed)- GeneRIF: distinct domains of the glucose transporter GLUT1 mediate HTLV envelope binding and virus entry
- Distinct regulation of glucose transport and GLUT1/GLUT3 transporters by glucose deprivation and IGF-I in chromaffin cells.
Fladeby, Biochimica et biophysica acta 2003 (PubMed)- GeneRIF: distinct regulation by glucose deprivation in chromaffin cells
TC 2.A.1.1.86 / H9BPB6 The sea bream facilitative glucose transporter 1 (GLUT1) from Sparus aurata
64% identity, 97% coverage
5eqgA / P11166 Human glut1 in complex with inhibitor (2~{s})-3-(4-fluorophenyl)-2-[2- (3-hydroxyphenyl)ethanoylamino]-~{n}-[(1~{s})-1- phenylethyl]propanamide (see paper)
68% identity, 91% coverage
- Ligand: (2~{s})-3-(4-fluorophenyl)-2-[2-(3-hydroxyphenyl)ethanoylamino]-~{n}-[(1~{s})-1-phenylethyl]propanamide (5eqgA)
TC 2.A.1.1.130 / Q63ZP5 Glucose transporter 1, GLUT1 or Slc2A1 of 491 aas and 12 TMSs from Xenopus laevis
67% identity, 94% coverage
- substrates: glucose
tcdb comment: Expression occurs in the mesodermal region of Xenopus embryos, especially in the dorsal blastopore lip at the gastrula stage. It is an important player during gastrulation cell movement (Suzawa et al. 2007)
NP_001034897 solute carrier family 2, facilitated glucose transporter member 1a from Danio rerio
65% identity, 95% coverage
B3KVN0 Solute carrier family 2, facilitated glucose transporter member 1 from Homo sapiens
69% identity, 81% coverage
G8F2R2 Solute carrier family 2, facilitated glucose transporter member 1 from Macaca fascicularis
61% identity, 96% coverage
LOC109056673 solute carrier family 2, facilitated glucose transporter member 3-like from Cyprinus carpio
59% identity, 88% coverage
XP_002667169 solute carrier family 2, facilitated glucose transporter member 3 from Danio rerio
60% identity, 87% coverage
Q27994 Solute carrier family 2, facilitated glucose transporter member 4 from Bos taurus
59% identity, 91% coverage
NP_001301156 solute carrier family 2, facilitated glucose transporter member 4 from Capra hircus
59% identity, 91% coverage
GLUT4_MOUSE / P14142 Solute carrier family 2, facilitated glucose transporter member 4; GT2; Glucose transporter type 4, insulin-responsive; GLUT-4 from Mus musculus (Mouse) (see 8 papers)
NP_033230 solute carrier family 2, facilitated glucose transporter member 4 isoform 1 from Mus musculus
59% identity, 91% coverage
- function: Insulin-regulated facilitative glucose transporter, which plays a key role in removal of glucose from circulation (PubMed:26240143, PubMed:26629404). Response to insulin is regulated by its intracellular localization: in the absence of insulin, it is efficiently retained intracellularly within storage compartments in muscle and fat cells (PubMed:26240143, PubMed:26629404). Upon insulin stimulation, translocates from these compartments to the cell surface where it transports glucose from the extracellular milieu into the cell (PubMed:26240143, PubMed:26629404).
catalytic activity: D-glucose(out) = D-glucose(in) (RHEA:60376)
subunit: Binds to DAXX (By similarity). Interacts via its N-terminus with SRFBP1 (By similarity). Interacts with NDUFA9 (By similarity). Interacts with TRARG1; the interaction is required for proper SLC2A4 recycling after insulin stimulation (PubMed:26629404). - Modulation of adiposity and adipocyte inflammation by methanol extracts <i>of Alpinia calcarata</i> leaf in high-fat-diet induced-obese mice: Involvement of COX-2 and PPAR-γ
Ahmad, Heliyon 2025 - “...442347 COX-2 Q05769 1,8 cineole 2758 PPAR P37238 -pinene 14896 IL-6 P08505 Camphor 2537 GLUT-4 P14142 Methyl cinnamate 637520 2.2 Plant extract preparation The desired plant leaves of A. calcarata were harvested from botanical garden in Dhaka, Bangladesh. The plant was validated by the Dhaka National...”
- Matrix Metalloproteinase-2 as a novel regulator of glucose utilization by adipocytes.
Lempicki, bioRxiv : the preprint server for biology 2024 - “...isoleucine. AlphaFold2 (AF2) in silico folding analysis, utilizing the identified murine GLUT4 extracellular loop (Uniprot: P14142, residues 6477) and full-length murine MMP2 (Uniprot: P33434), conformed the peptide to the active site of MMP2 in a substrate-like fashion with isoleucine occupying the P1 pocket adjacent to the...”
- Identification of Sortilin Alternatively Spliced Variants in Mouse 3T3L1 Adipocytes.
Lui, International journal of molecular sciences 2021 - “...to mouse sortilin luminal domain (PDB ID: 5NMR). Mouse Glut4 protein (Swiss Model in Expasy (P14142)) and folded sortilin proteins were minimized in Schrodinger protein preparation wizard (2019-1: Maestro, Schrdinger, LLC, New York, NY, USA). Molecular dynamics simulations were done using NAMD 2.12 [ 30 ]...”
- Identification of the MuRF1 Skeletal Muscle Ubiquitylome Through Quantitative Proteomics.
Baehr, Function (Oxford, England) 2021 - “...365, 511, 713 O09165 Calsequestrin-1 Casq1 79 Q9CZW4 Long-chain fatty acidCoA ligase 3 Acsl3 96 P14142 Solute carrier family 2, facilitated glucose transporter member 4 Slc2a4 261 P62082 40S ribosomal protein S7 Rps7 86 Q8C878 NEDD8-activating enzyme E1 catalytic subunit Uba3 398 Q505G8 Zinc finger protein...”
- Hydrogen sulfide increases glutathione biosynthesis, and glucose uptake and utilisation in C2C12 mouse myotubes.
Parsanathan, Free radical research 2018 - “...(Q9WTR6), and rat (D4ADU2), and a similar comparison of sequences of Slc2a4/GLUT4 human (P14672), mouse (P14142), and rat (P19357) indicated that the localization of cysteine residues is conserved in all species. Amino acid sequences were aligned with default parameters and checked for transmembrane annotation to rule...”
- “...class. SWISS- MODEL workspace was used to generate models for mouse Slc7a11 (Q9WTR6) and Slc2a4 (P14142). The SWISS-MODEL template library (SMTL version 2016-11-09, PDB release 2016-11-05) was searched with Blast [ 41 ] and HHBlits [ 42 ] for evolutionarily related structures matching the target sequences....”
- Proteomic analysis of 3T3-L1 preadipocytes having a higher cell proliferation rate after treatment with low-molecular-weight silk fibroin peptides
Huang, Cell proliferation 2010 (secret) - Major facilitator superfamily
Pao, Microbiology and molecular biology reviews : MMBR 1998 - “...P12336 P47842 P28568 P11169 P32037 P47843 Q07647 P14672 P14142 P19357 P22732 P46408 P43427 Q00712 B30310 U39197 U29377 U43375 U52842 Z46381 L27651 X78855 D83045...”
- Adipose tissue macrophage-derived microRNA-210-3p disrupts systemic insulin sensitivity by silencing GLUT4 in obesity.
Patra, The Journal of biological chemistry 2024 - GeneRIF: Adipose tissue macrophage-derived microRNA-210-3p disrupts systemic insulin sensitivity by silencing GLUT4 in obesity.
- Nuclear Factor-Kappa-B Mediates the Advanced Glycation End Product-Induced Repression of Slc2a4 Gene Expression in 3T3-L1 Adipocytes.
Michalani, International journal of molecular sciences 2024 - GeneRIF: Nuclear Factor-Kappa-B Mediates the Advanced Glycation End Product-Induced Repression of Slc2a4 Gene Expression in 3T3-L1 Adipocytes.
- Picalm, a novel regulator of GLUT4-trafficking in adipose tissue.
Gaugel, Molecular metabolism 2024 - GeneRIF: Picalm, a novel regulator of GLUT4-trafficking in adipose tissue.
- GSK3α phosphorylates dynamin-2 to promote GLUT4 endocytosis in muscle cells.
Laiman, The Journal of cell biology 2023 - GeneRIF: GSK3alpha phosphorylates dynamin-2 to promote GLUT4 endocytosis in muscle cells.
- Effects of short-term endurance and strength exercise in the molecular regulation of skeletal muscle in hyperinsulinemic and hyperglycemic Slc2a4+/- mice.
Muñoz, Cellular and molecular life sciences : CMLS 2023 - GeneRIF: Effects of short-term endurance and strength exercise in the molecular regulation of skeletal muscle in hyperinsulinemic and hyperglycemic Slc2a4[+/-] mice.
- Tectorigenin targets PKACα to promote GLUT4 expression in skeletal muscle and improve insulin resistance in vitro and in vivo.
Yao, International journal of biological sciences 2023 - GeneRIF: Tectorigenin targets PKACalpha to promote GLUT4 expression in skeletal muscle and improve insulin resistance in vitro and in vivo.
- Bone marrow mesenchymal stem cell-derived exosomes reduce insulin resistance and obesity in mice via the PI3K/AKT signaling pathway.
Shi, FEBS open bio 2023 - GeneRIF: Bone marrow mesenchymal stem cell-derived exosomes reduce insulin resistance and obesity in mice via the PI3K/AKT signaling pathway.
- Microtubule-mediated GLUT4 trafficking is disrupted in insulin-resistant skeletal muscle.
Knudsen, eLife 2023 - GeneRIF: Microtubule-mediated GLUT4 trafficking is disrupted in insulin-resistant skeletal muscle.
- More
NP_001152799 solute carrier family 2, facilitated glucose transporter member 4 from Canis lupus familiaris
60% identity, 91% coverage
GLUT4_HUMAN / P14672 Solute carrier family 2, facilitated glucose transporter member 4; Glucose transporter type 4, insulin-responsive; GLUT-4 from Homo sapiens (Human) (see 7 papers)
TC 2.A.1.1.80 / P14672 Insulin-responsive facilitative glucose transporter in skeletal and cardiac muscle, adipose, and other tissues, Glut4 (GTR4; SLC2A4; 509aas). Defects in Glut4 cause noninsulin-dependent diabetes mellitus (NIDDM) from Homo sapiens (see 12 papers)
NP_001033 solute carrier family 2, facilitated glucose transporter member 4 from Homo sapiens
59% identity, 91% coverage
- function: Insulin-regulated facilitative glucose transporter, which plays a key role in removal of glucose from circulation. Response to insulin is regulated by its intracellular localization: in the absence of insulin, it is efficiently retained intracellularly within storage compartments in muscle and fat cells. Upon insulin stimulation, translocates from these compartments to the cell surface where it transports glucose from the extracellular milieu into the cell.
catalytic activity: D-glucose(out) = D-glucose(in) (RHEA:60376)
subunit: Interacts with NDUFA9 (By similarity). Binds to DAXX (PubMed:11842083). Interacts via its N-terminus with SRFBP1 (PubMed:16647043). Interacts with TRARG1; the interaction is required for proper SLC2A4 recycling after insulin stimulation (By similarity). - substrates: glucose
tcdb comment: Hyperinsulinemia leads to uncoupled insulin regulation of the GLUT4 glucose transporter and the FoxO1 transcription factor (Gonzalez et al., 2011). The first luminal loop confers insulin responsiveness to GLUT4 (Kim and Kandror, 2012). Exercise increases Glut4 synthesis in a process involving several protein kinases, the Glut4 enhancer factor (GEF; SLC2A4 regulator; Q9NR83), and the myocyte enhancing factor 2 (MEF2; NP_001139257). (McGee and Hargreaves 2006; Wright 2007; Zorzano et al. 2005). monoclonal antibodies against the GLUT4 inward-open and outward-open states have been isoated (Tucker et al. 2018). It is phosphoryated by protein kinase C-β, PRKCB or PKCB (Lee et al. 2015) - GLUT4 localisation with the plasma membrane is unaffected by an increase in plasma free fatty acid availability.
Barrett, Lipids in health and disease 2024 - GeneRIF: GLUT4 localisation with the plasma membrane is unaffected by an increase in plasma free fatty acid availability.
- Insulin-Activated Signaling Pathway and GLUT4 Membrane Translocation in hiPSC-Derived Cardiomyocytes.
Querio, International journal of molecular sciences 2024 - GeneRIF: Insulin-Activated Signaling Pathway and GLUT4 Membrane Translocation in hiPSC-Derived Cardiomyocytes.
- Picalm, a novel regulator of GLUT4-trafficking in adipose tissue.
Gaugel, Molecular metabolism 2024 - GeneRIF: Picalm, a novel regulator of GLUT4-trafficking in adipose tissue.
- Glucose transporter 4: Insulin response mastermind, glycolysis catalyst and treatment direction for cancer progression.
Chang, Cancer letters 2023 (PubMed)- GeneRIF: Glucose transporter 4: Insulin response mastermind, glycolysis catalyst and treatment direction for cancer progression.
- Microtubule-mediated GLUT4 trafficking is disrupted in insulin-resistant skeletal muscle.
Knudsen, eLife 2023 - GeneRIF: Microtubule-mediated GLUT4 trafficking is disrupted in insulin-resistant skeletal muscle.
- Effect of an acute long-duration exercise bout on skeletal muscle lipid droplet morphology, GLUT 4 protein, and perilipin protein expression.
Bajpeyi, European journal of applied physiology 2023 - GeneRIF: Effect of an acute long-duration exercise bout on skeletal muscle lipid droplet morphology, GLUT 4 protein, and perilipin protein expression.
- Talin1 regulates glucose metabolism and endometrial receptivity via GLUT-4 in patients with polycystic ovary syndrome and insulin resistance.
Li, Gynecological endocrinology : the official journal of the International Society of Gynecological Endocrinology 2023 (PubMed)- GeneRIF: Talin1 regulates glucose metabolism and endometrial receptivity via GLUT-4 in patients with polycystic ovary syndrome and insulin resistance.
- The intracellular helical bundle of human glucose transporter GLUT4 is important for complex formation with ASPL.
Huang, FEBS open bio 2023 - GeneRIF: The intracellular helical bundle of human glucose transporter GLUT4 is important for complex formation with ASPL.
- More
- Stem Cell-Associated Proteins and Extracellular Matrix Composition of the Human Atrioventricular Junction
Thorsell, Cells 2024 - “...Mitochondrial respiratory chain CD300LG Q6UXG3 CMRF35-like molecule 9 2.76 4.04 10 3 Immune system SLC2A4 P14672 Solute carrier family 2, facilitated glucose transporter member 4 2.24 7.20 10 3 Glucose homeostasis, response to hypoxia SDHD O14521 Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial 2.12 1.40...”
- Insulin signaling and pharmacology in humans and in corals
Murthy, PeerJ 2024 - “...(GTR1_HUMAN) Mueckler & Makepeace (2008) GLUT4 Solute carrier family 2, facilitated glucose transporter member 4 P14672 (GLUT4_HUMAN) Kawanishi et al. (2000) GRB2 Growth factor receptor-bound protein 2 P62993 (GRB2_HUMAN) Lowenstein et al. (1992) GSK-3 Glycogen synthase kinase-3 alpha Glycogen synthase kinase-3 beta P49840 (GSK3A_HUMAN) P49841 (GSK3B_HUMAN)...”
- “...glucose transporter member 1 492 pdam_00006372 100 1.40E40 4.10E44 445 15470 40484 (495) 45 GLUT4 P14672 Solute carrier family 2, facilitated glucose transporter member 4 509 pdam_00014912 100 3.60E39 9.90E43 437 23485 27484 (494) 28 GRB2 P62993 Growth factor receptor-bound protein 2 217 pdam_00010914 100 3.50E36...”
- Elucidating the Potential Inhibitor against Type 2 Diabetes Mellitus Associated Gene of GLUT4
Aldahish, Journal of personalized medicine 2023 - “...protein sequence for this protein was retrieved from the UniProt knowledge database with accession number P14672 [ 18 ] ( https://www.uniprot.org/ accessed on 5 February 2022). 2.2. Phylogenetic Analysis and Motif Detection After retrieving the gene sequences, a customized BLAST [ 19 ] search was executed...”
- Coronavirus accessory protein ORF3 biology and its contribution to viral behavior and pathogenesis.
Si, iScience 2023 - “...chain P04235 TM-QALLKNEQL YQPL R DRE DTQYSRLG-COOH (Van Den Elsen etal. 162 ) Human GLUT4 P14672 TM-HRTPSLLEQEVKPSTELE YLGP D END -COOH (Wollscheid etal. 163 ) Mouse GLUT4 Q27994 TM-HRTPSLLEQEVKPSTELE YLGP D EHD -COOH (Abe etal. 164 ) Note : The YXX motif is underlined, and the...”
- Establishing mammalian GLUT kinetics and lipid composition influences in a reconstituted-liposome system.
Suades, Nature communications 2023 - “...previously in 33 , 34 . hGLUT1 (Uniprot: P11166), hGLUT3 (Uniprot: P11169), and hGLUT4 (Uniprot: P14672) encoding genes were synthesized and cloned into the mammalian expression pCDNA3.1 (+) by GeneArt. A TEV cleavage site (ENLYFQ) and eGFP (Uniprot: C5MKY7) sequence containing a twin strep tag were...”
- The proteome and phosphoproteome of circulating extracellular vesicle-enriched preparations are associated with characteristic clinical features in type 1 diabetes.
Casu, Frontiers in endocrinology 2023 - “...0.57 1.56E-10 9.09E-08 P02749 APOH 2.00 0.20 4.13E-04 0.0399 Q5T0T0 MARCHF8 1.95 -0.52 1.31E-07 2.53E-05 P14672 SLC2A4 0.88 -0.95 9.48E-04 0.0689 P01031 C5 -1.45 -0.69 1.34E-04 0.0156 O75069 TMCC2 -1.47 -0.76 6.08E-04 0.0505 Q9H4B7 TUBB1 -1.76 0.06 8.95E-07 0.0001 Log2FC, base 2 logarithm of fold change;...”
- Exploring the mechanism of Alisma orientale for the treatment of pregnancy induced hypertension and potential hepato-nephrotoxicity by using network pharmacology, network toxicology, molecular docking and molecular dynamics simulation
Liao, Frontiers in pharmacology 2022 - “...Matrilysin MMP7 P09237 Treat 144 Solute carrier family 2, facilitated glucose transporter member 4 SLC2A4 P14672 Toxic 67 Neutrophil collagenase MMP8 P22894 Treat 145 Transcription factor Sp1 SP1 P08047 Toxic 68 Nitric oxide synthase, inducible NOS2 P35228 Treat 146 Sterol regulatory element-binding protein 1 SREBF1 P36956...”
- Integrated Network Pharmacology and Gut Microbiota Study on the Mechanism of Huangqin Decoction in Treatment Diabetic Enteritis.
Xu, Applied bionics and biomechanics 2022 - “...24 SLPI Antileukoproteinase P03973 25 SLC2A4 Solute carrier family 2, facilitated glucose transporter member 4 P14672 26 SELE E-selectin P16581 27 RELA Transcription factor p65 Q04206 28 PRSS1 Trypsin-1 P07477 29 PPARG Peroxisome proliferator-activated receptor gamma Q08209 30 NOS3 Nitric oxide synthase, endothelial P37231 31 NOS2...”
- More
7wsmA / P14672 Cryo-em structure of human glucose transporter glut4 bound to cytochalasin b in lipid nanodiscs (see paper)
59% identity, 93% coverage
- Ligand: cytochalasin b (7wsmA)
NP_001075335 solute carrier family 2, facilitated glucose transporter member 4 from Equus caballus
59% identity, 91% coverage
NP_777029 solute carrier family 2, facilitated glucose transporter member 4 from Bos taurus
58% identity, 91% coverage
GLUT4_RAT / P19357 Solute carrier family 2, facilitated glucose transporter member 4; Glucose transporter type 4, insulin-responsive; GLUT-4 from Rattus norvegicus (Rat) (see 6 papers)
XP_006246658 solute carrier family 2, facilitated glucose transporter member 4 isoform X2 from Rattus norvegicus
58% identity, 91% coverage
- function: Insulin-regulated facilitative glucose transporter, which plays a key role in removal of glucose from circulation (PubMed:2211693, PubMed:2645527, PubMed:2649253). Response to insulin is regulated by its intracellular localization: in the absence of insulin, it is efficiently retained intracellularly within storage compartments in muscle and fat cells (PubMed:2211693, PubMed:2645527, PubMed:2649253). Upon insulin stimulation, translocates from these compartments to the cell surface where it transports glucose from the extracellular milieu into the cell (PubMed:2211693, PubMed:2645527, PubMed:2649253).
catalytic activity: D-glucose(out) = D-glucose(in) (RHEA:60376)
subunit: Binds to DAXX. Interacts via its N-terminus with SRFBP1 (By similarity). Interacts with NDUFA9 (PubMed:16396496). Interacts with TRARG1; the interaction is required for proper SLC2A4 recycling after insulin stimulation (By similarity). - African walnut (Plukenetia conophora) oil promotes glucose uptake while improving energy metabolism and steroidogenesis and maintaining surface architecture in rat testes.
Erukainure, Frontiers in nutrition 2024 - “...2.15.1 Protein target selection and preparation The active site amino acid sequence of GLUT4 protein (P19357) was retrieved from https://www.uniprot.org/ , and the structure was modeled with https://swissmodel.expasy.org/ . The protein was prepared and refined using Discovery Studio 2021 ( https://discover.3ds.com/discovery-studio-visualizer-download ) for docking. This was...”
- Intestinal changes associated with fluoride exposure in rats: Integrative morphological, proteomic and microbiome analyses
Dionizio, Chemosphere 2021 - “...with changed expression interacted with Solute carrier family 2, facilitated glucose transporter member 4 (GLUT4, P19357), ( Fig. 1A ), Mitogen-activated protein kinase 3 (MAPK3, P21708), 5-AMP-activated protein kinase catalytic subunit alpha-1 (AMPK subunit alpha-1, P54645), 5-AMP-activated protein kinase subunit beta-1 (AMPK subunit beta-1, P80386), Polyubiquitin...”
- “...Dynein light chain 1 , cytoplasmic (P63170), Polyubiquitin-6 (Q63429) ( Fig. 2A ) or GLUT4 (P19357), MAPK3 (P21708), Dystrophin (P11530), Calcium/calmodulin-dependent protein kinase kinase 1 (CaM-kinase kinase 1, P97756) and Regulating synaptic membrane exocytosis protein 1 (Q9JIR4) ( Fig. 2B ). Subchronic fluoride exposure reduced Gastrotropin...”
- Identification of Aortic Proteins Involved in Arterial Stiffness in Spontaneously Hypertensive Rats Treated With Perindopril:A Proteomic Approach
Miotto, Frontiers in physiology 2021 - “...proteins Mitogen-activated protein kinase 3 (P21708), Solute carrier family 2, facilitated glucose transporter member 4 (P19357), UV excision repair protein RAD23 homolog B (Q4KMA2), Heterogeneous nuclear ribonucleoprotein K (P61980), Small ubiquitin-related modifier 3 (Q5XIF4), Desmin (P48675), Gap junction alpha-1 protein (P08050), and Tumor necrosis factor (P16599);...”
- “...three main interaction proteins, Mitogen-activated protein kinase 3 (P21708), solute carrier muscle family-2 glucose transporter (P19357), and UV excision Rad23 homolog (Q4KMA2), that interacted with several proteins up- or downregulated in the aorta sample, after SHRc Wistar comparisons, like long-chain specific acyl-CoA dehydrogenase- mitochondrial (P15650), heat...”
- Long-Term Lead Exposure Since Adolescence Causes Proteomic and Morphological Alterations in the Cerebellum Associated with Motor Deficits in Adult Rats
Leão, International journal of molecular sciences 2020 - “...by its accession ID from Uniprot. Solute carrier family 2, facilitated glucose transporter member 4 (P19357); Sideroflexin-1 (Q63965); Ubiquitin-conjugating enzyme E2 N (Q9EQX9); Peroxiredoxin-6 (O35244); Dihydrolipoyl dehydrogenase, mitochondrial (Q6P6R2); Aspartate aminotransferase, mitochondrial (P00507); Isoaspartyl peptidase/L-asparaginase (Q8VI04); Runt-related transcription factor 2 (Q9Z2J9); Nicalin (Q5XIA1); Mammalian ependymin-related protein...”
- Inflammation and apoptosis accelerate progression to irreversible atrophy in denervated intrinsic muscles of the hand compared with biceps: proteomic analysis of a rat model of obstetric brachial plexus palsy.
Yu, Neural regeneration research 2020 - “...A0A0G2K5G8 * , Q3HSE5 * , P12369 * , G3V8R5 * , Q9Z2S9 * , P19357, M0RD75, D3ZM60, P13286, P27881, P62142, F1LLZ7, A2RRU1, P97531, G3V8V3, Q4G050, A0A0G2K9C8, Q6P727, Q9Z1N1 0.002 Pyruvate metabolism 17 A0A0G2K5G8 * , P52873 * , Q6P7Q4, P11980, P04636, A0A0G2K4C6, P35745, F7FKI5, P17764,...”
- “...AMPK signaling 16 P12785 * , A0A0G2K5G8 * , Q3HSE5 * , G3V8R5 * , P19357, A0A0G2JSQ0, Q52KS1, A2RRU1, Q5XIJ7, Q5PQN8, D4AC16, A0A0G2JYA4, Q9Z1N1, P62716, C9DRP4, Q63704 0.005 Fatty acid metabolism 12 P12785 * , A0A0G2K5G8 * , Q63151 * , P33124, P17764, Q9WVK7, Q9WVK3, P08503,...”
- Chronic treatment with fluoride affects the jejunum: insights from proteomics and enteric innervation analysis
Dionizio, Scientific reports 2018 - “...in expression interacted with Solute carrier family 2 , facilitated glucose transporter member 4 (GLUT4; P19357) and Small ubiquitin-related modifier 3 (Q5XIF4) (Fig. 5A ) or with Polyubiquitin-C (Q63429) and Elongation factor 2 (P05197) (Fig. 5B ). As for the group treated with 50 mgF/L, most...”
- “...dissociation inhibitor alpha (P50398) and Solute carrier family 2 , facilitated glucose transporter member 4 (P19357). The access numbers of the unique proteins of the control (dark red nodes) correspond to: Aconitate hydratase , mitochondrial (Q9ER34), Cytochrome c oxidase subunit 4 isoform 1 , mitochondrial (P10888)...”
- Hydrogen sulfide increases glutathione biosynthesis, and glucose uptake and utilisation in C2C12 mouse myotubes.
Parsanathan, Free radical research 2018 - “...(D4ADU2), and a similar comparison of sequences of Slc2a4/GLUT4 human (P14672), mouse (P14142), and rat (P19357) indicated that the localization of cysteine residues is conserved in all species. Amino acid sequences were aligned with default parameters and checked for transmembrane annotation to rule out the transmembrane...”
- Diabetic Retinopathy and Laser Therapy in Rats: A Protein-Protein Interaction Network Analysis.
Safaei, Journal of lasers in medical sciences 2017 - More
- The SIRT3/GSK-3β/GLUT4 axis might be involved in maternal hypoxia-induced skeletal muscle insulin resistance in old male rat offspring.
Zhu, Toxicology and applied pharmacology 2024 (PubMed)- GeneRIF: The SIRT3/GSK-3beta/GLUT4 axis might be involved in maternal hypoxia-induced skeletal muscle insulin resistance in old male rat offspring.
- Immunoglobulin-Mediated Cardiac Protection From Ischemia/Reperfusion Injury in Diabetic Rats Is Associated With Endothelial Nitric Oxide Synthase/Glucose Transporter-4 Signaling Pathway.
Babiker, Journal of cardiovascular pharmacology 2024 (PubMed)- GeneRIF: Immunoglobulin-Mediated Cardiac Protection From Ischemia/Reperfusion Injury in Diabetic Rats Is Associated With Endothelial Nitric Oxide Synthase/Glucose Transporter-4 Signaling Pathway.
- Microtubule-mediated GLUT4 trafficking is disrupted in insulin-resistant skeletal muscle.
Knudsen, eLife 2023 - GeneRIF: Microtubule-mediated GLUT4 trafficking is disrupted in insulin-resistant skeletal muscle.
- Impact of Normal and Overweight Pregnancy in GLUT4 and Glucose-Dependent Vascular Contractility.
Juarez, Pharmacology 2023 (PubMed)- GeneRIF: Impact of Normal and Overweight Pregnancy in GLUT4 and Glucose-Dependent Vascular Contractility.
- Exercise preconditioning promotes myocardial GLUT4 translocation and induces autophagy to alleviate exhaustive exercise-induced myocardial injury in rats.
Guo, Journal of molecular histology 2023 (PubMed)- GeneRIF: Exercise preconditioning promotes myocardial GLUT4 translocation and induces autophagy to alleviate exhaustive exercise-induced myocardial injury in rats.
- Electrical stimulated GLUT4 signalling attenuates critical illness-associated muscle wasting.
Addinsall, Journal of cachexia, sarcopenia and muscle 2022 - GeneRIF: Electrical stimulated GLUT4 signalling attenuates critical illness-associated muscle wasting.
- Hydroxytyrosol modifies skeletal muscle GLUT4/AKT/Rac1 axis in trained rats.
Casuso, Journal of cellular physiology 2021 (PubMed)- GeneRIF: Hydroxytyrosol modifies skeletal muscle GLUT4/AKT/Rac1 axis in trained rats.
- Complexin-2 redistributes to the membrane of muscle cells in response to insulin and contributes to GLUT4 translocation.
Pavarotti, The Biochemical journal 2021 (PubMed)- GeneRIF: Complexin-2 redistributes to the membrane of muscle cells in response to insulin and contributes to GLUT4 translocation.
- More
NP_001090886 solute carrier family 2, facilitated glucose transporter member 2 from Sus scrofa
49% identity, 92% coverage
NP_001121905 solute carrier family 2, facilitated glucose transporter member 4 from Sus scrofa
59% identity, 91% coverage
- Effect of heat stress on performance and expression of selected amino acid and glucose transporters, HSP90, leptin and ghrelin in growing pigs.
Cervantes, Journal of thermal biology 2016 (PubMed)- GeneRIF: Feed intake remains low whereas respiratory frequency and body temperature remain higher and expression of HSP90, CAT1, SGLT1 and GLUT4 increases in some tissues in pigs under chronic heat stress conditions.
- Developmental changes in the expression of the GLUT2 and GLUT4 genes in the longissimus dorsi muscle of Yorkshire and Tibetan pigs.
Liang, Genetics and molecular research : GMR 2015 (PubMed)- GeneRIF: analysis of time- and breed-specific expression patterns of GLUT2 and GLUT4, which highlight their potential as candidate genes for assessing adipose deposition and muscle development in pigs
- Expression study of GLUT4 translocation-related genes in a porcine pre-diabetic model.
Kristensen, Mammalian genome : official journal of the International Mammalian Genome Society 2015 (PubMed)- GeneRIF: TBC1D4, insulin receptor and GLUT4 showed altered expression in some tissues in pre-diabetic pigs.
- Chronic elevated calcium blocks AMPK-induced GLUT-4 expression in skeletal muscle.
Park, American journal of physiology. Cell physiology 2009 (PubMed)- GeneRIF: Chronic elevated calcium blocks AMPK-induced GLUT-4 expression in skeletal muscle.
H2QNR0 Solute carrier family 2, facilitated glucose transporter member 2 from Pan troglodytes
49% identity, 92% coverage
SLC2A2 / P11168 solute carrier family 2, facilitated glucose transporter member 2 from Homo sapiens (see 3 papers)
GTR2_HUMAN / P11168 Solute carrier family 2, facilitated glucose transporter member 2; Glucose transporter type 2, liver; GLUT-2 from Homo sapiens (Human) (see 9 papers)
TC 2.A.1.1.29 / P11168 Glucosamine/glucose uniporter, Glut-2; it may also transport dehydroascorbate (Mardones et al., 2011; from Homo sapiens (Human) (see 7 papers)
NP_000331 solute carrier family 2, facilitated glucose transporter member 2 isoform 1 from Homo sapiens
49% identity, 92% coverage
- function: Facilitative hexose transporter that mediates the transport of glucose, fructose and galactose (PubMed:16186102, PubMed:23396969, PubMed:28083649, PubMed:8027028, PubMed:8457197). Likely mediates the bidirectional transfer of glucose across the plasma membrane of hepatocytes and is responsible for uptake of glucose by the beta cells; may comprise part of the glucose-sensing mechanism of the beta cell (PubMed:8027028). May also participate with the Na(+)/glucose cotransporter in the transcellular transport of glucose in the small intestine and kidney (PubMed:3399500). Also able to mediate the transport of dehydroascorbate (PubMed:23396969).
catalytic activity: D-glucose(out) = D-glucose(in) (RHEA:60376)
catalytic activity: D-fructose(out) = D-fructose(in) (RHEA:60372)
catalytic activity: L-dehydroascorbate(out) = L-dehydroascorbate(in) (RHEA:60380)
catalytic activity: D-galactose(in) = D-galactose(out) (RHEA:34915) - substrates: Glucosamine, glucose
tcdb comment: Maulén et al., 2003), and cotransport water against an osmotic gradient (Naftalin, 2008). Mutations may give rise to the rare autosomal recessive Fanconi-Bickel syndrome (Batool et al. 2019) - (Re-)Viewing Role of Intracellular Glucose Beyond Extracellular Regulation of Glucose-Stimulated Insulin Secretion by Pancreatic Cells
Firdos,, ACS omega 2024 - “...musculus P14246 SLC2A2 solute carrier family 2, facilitated glucose transporter member 2 524 H. sapiens P11168 RPA1 replication protein A 70kDa DNA-binding subunit 623 M. musculus Q8VEE4 RPA1 replication protein A 70kDa DNA-binding subunit 616 H. sapiens P27694 XRCC6/XRCC5 Ku7080 heterodimer A chain 609 H. sapiens...”
- Understanding the molecular mechanisms of human diseases: the benefits of fission yeasts.
Acs-Szabo, Microbial cell (Graz, Austria) 2024 - Do mitochondria use efflux pumps to protect their ribosomes from antibiotics?
Islam, Microbiology (Reading, England) 2023 - “...6.7E^12 Q8WW24, 1.4E^14 [ 79, 112 ] HXT13, NCU01633 Q1K4S3 MFS Q8J2J7, 2.1E^85 P23586, 1.2E^52 P11168, 2.6E^48 [ 79 ] NCU04809 Q756M6 MFS T2AWG3, 0.0014 Q8GYF4, 1.4E^24 B3KT41, 0.0022 [ 79 ] NCU09551 Q7S2B0 MFS G1UAY0, 2.3E^6 Q56ZZ7, 2.3E^7 Q8NBP5, 8.4E^9 [ 78 ] NCU10021 Q7S0I5...”
- A Network Pharmacology Method Combined with Molecular Docking Verification to Explore the Therapeutic Mechanisms Underlying Simiao Pill Herbal Medicine against Hyperuricemia
Qian, BioMed research international 2023 - “...P05181 54 CYP11A1 P05108 15 PPARG P37231 55 INS P01308 16 ESR1 P03372 56 SLC2A2 P11168 17 SELE P16581 57 CXCL8 P10145 18 CAT P04040 58 CRP P02741 19 MYC P01106 59 GCG P01275 20 TGFB1 P01137 60 UCP2 P55851 21 GPT P24298 61 CYP2C8 P10632...”
- Extracellular Vesicles from Human Adipose-Derived Mesenchymal Stem Cells: A Review of Common Cargos.
Alonso-Alonso, Stem cell reviews and reports 2022 - “...[ 52 , 65 ] Solute carrier family 2, facilitated glucose transporter member 2* GTR2_HUMAN P11168 SLC2A2 [ 52 ] Solute carrier family 2, facilitated glucose transporter member 3* GTR3_HUMAN P11169 SLC2A3 [ 65 ] Solute carrier family 2, facilitated glucose transporter member 5* GTR5_HUMAN P22732...”
- Halophila beccarii extract ameliorate glucose uptake in 3T3-L1 adipocyte cells and improves glucose homeostasis in streptozotocin-induced diabetic rats.
Mathakala, Heliyon 2022 - “...transporter type (GLUT) 4, sequence was retrieved from UniProt web site (http://www.uniprot.org/; UniProt Entry ID: P11168 and P14672) and subjected to BLASTp program to obtain their homologue structures from Protein Data Bank. After BLASTp, the obtained PDB IDs 5EQG, 4PYP and 4ZW9 were selected as templates...”
- Structural comparison of GLUT1 to GLUT3 reveal transport regulation mechanism in sugar porter family.
Custódio, Life science alliance 2021 - “...members of the Sugar Porter family. Alignment between human GLUT1 (UniProt P11166 ), GLUT2 (UniProt P11168 ), GLUT3 (UniProt P11169 ), GLUT4 (UniProt P14672 ), rGLUT5 (UniProt P43427 ), bGLUT5 (UniProt P58353 ), atSTP10 (UniProt Q9LT15 ), XylE (UniProt P0AGF4 ), and GlcPse (UniProt A0A0H2VG78 )....”
- Insights into Substrate and Inhibitor Selectivity among Human GLUT Transporters through Comparative Modeling and Molecular Docking
Ferreira, ACS omega 2019 - “...from a nonautomated procedure. Sequences were obtained from the UniProt database 30 (GLUT1: P11166; GLUT2: P11168; GLUT3: P11169; GLUT4: P14672; GLUT5: P22732; GLUT6: Q9UGQ3; GLUT7: Q6PXP3; GLUT8: Q9NY64; GLUT9: Q9NRM0; GLUT10: O95528; GLUT11: Q9BYW1; GLUT12: Q8TD20; GLUT13 (MYCT): Q96QE2; GLUT14: Q8TDB8). Sequence alignment was manually checked...”
- More
- Transmissible Gastroenteritis Virus Infection Enhances SGLT1 and GLUT2 Expression to Increase Glucose Uptake
Dai, PloS one 2016 - “.... 1 88% SGLT1 NM-001012297 . 1 NP_001035915 . 1 88% GLUT2 AMN88560 . 1 NP_000331 . 1 87% Glucose uptake experiments 2-[ 3 H]deoxyglucose (2-DG) uptake experiments were carried out according to the method described by Henriksen et al ., but with modifications [ 14...”
Q102R8 Glucose transporter 2 from Danio rerio
NP_001036186 solute carrier family 2, facilitated glucose transporter member 2 from Danio rerio
52% identity, 94% coverage
Q90592 Solute carrier family 2, facilitated glucose transporter member 2 from Gallus gallus
49% identity, 88% coverage
NP_997061 solute carrier family 2, facilitated glucose transporter member 2 from Gallus gallus
49% identity, 88% coverage
I3L2R4 Solute carrier family 2, facilitated glucose transporter member 4 from Homo sapiens
60% identity, 84% coverage
GTR2_RAT / P12336 Solute carrier family 2, facilitated glucose transporter member 2; Glucose transporter type 2, liver; GLUT-2 from Rattus norvegicus (Rat) (see paper)
48% identity, 91% coverage
- function: Facilitative hexose transporter that mediates the transport of glucose, fructose and galactose (PubMed:3048704). Likely mediates the bidirectional transfer of glucose across the plasma membrane of hepatocytes and is responsible for uptake of glucose by the beta cells; may comprise part of the glucose-sensing mechanism of the beta cell (PubMed:3048704). May also participate with the Na(+)/glucose cotransporter in the transcellular transport of glucose in the small intestine and kidney (By similarity). Also able to mediate the transport of dehydroascorbate (By similarity).
catalytic activity: D-glucose(out) = D-glucose(in) (RHEA:60376)
catalytic activity: D-fructose(out) = D-fructose(in) (RHEA:60372)
catalytic activity: L-dehydroascorbate(out) = L-dehydroascorbate(in) (RHEA:60380)
catalytic activity: D-galactose(in) = D-galactose(out) (RHEA:34915) - Transcriptomic and proteomic investigations identify PI3K-akt pathway targets for hyperthyroidism management in rats via polar iridoids from radix Scrophularia.
Zhang, Heliyon 2024 - “...1.5763 0.0463 0.5339 0.0238 6 F1LMF4 Fat3 Protocadherin Fat 3 1.5600 0.0006 0.6169 0.0010 7 P12336 Slc2a2 Solute carrier family 2, facilitated glucose transporter member 2 1.4963 0.0001 0.5445 0.0000 8 A0A0G2K7H6 Serpinb8 Protein Serpinb8 1.4770 0.0000 0.7561 0.0000 9 M0R979 Thbs1 Protein Thbs1 1.4022 0.0113...”
- Extracellular vesicles released by steatotic hepatocytes alter adipocyte metabolism
Mleczko, Journal of extracellular biology 2022 - “...AL4A1_RAT P0C29 1.49 3.05E02 Delta1pyrroline5carboxylate dehydrogenase, mitochondrial ACON_RAT Q9ER34 1.49 3.67E02 Aconitate hydratase, mitochondrial GTR2_RAT P12336 1.52 3.16E04 Solute carrier family 2, facilitated glucose transporter member 2 IVD_RAT P12007 1.53 2.32E03 IsovalerylCoA dehydrogenase, mitochondrial PLMN_RAT Q01177 1.53 1.10E02 Plasminogen AGT2_RAT Q64565 1.53 9.53E03 Alanineglyoxylate aminotransferase 2,...”
- Black bean peptides inhibit glucose uptake in Caco-2 adenocarcinoma cells by blocking the expression and translocation pathway of glucose transporters.
Mojica, Toxicology reports 2018 - “...acquired from the Protein Data Bank website ( www.rcsb.org/pdb/home/home.do ). The protein sequence of GLUT2 (P12336, UniProtKB database) was used for homology modeling of GLUT2 and was carried out by using template threading alignments by I-TASSER server [ 21 ]. The template structure used by I-TASSER...”
- Mutations in SLC2A2 gene reveal hGLUT2 function in pancreatic β cell development
Michau, The Journal of biological chemistry 2013 - “...(Pan troglodytes); P14246 for mouse (Mus musculus) GLUT2; P12336 for rat (Rattus norvegicus) GLUT2; Q90592 for chicken (Gallus gallus) GLUT2; Q102R8 for...”
- Clusters of conserved beta cell marker genes for assessment of beta cell phenotype.
Martens, PloS one 2011 - “...1 Q920J4 Txnl1 - 0.00120 - - Thioredoxin like protein 1 1.5 24 2 1 P12336 Slc2a2 - 0.00091 - - Solute carrier family 2 facilitated glucose transporter member 2 28.6 18 1 1 Q9R064 Gorasp2 - 0.00079 - - Golgi reassembly stacking protein 2 1.5...”
- pkaPS: prediction of protein kinase A phosphorylation sites with the simplified kinase-substrate binding model.
Neuberger, Biology direct 2007 - “...T GILDSLGRFFGSDRGAPKRGSGK Kishimoto et al . 1985 [37] -0.158 0.733 T 2 , T 4 P12336 489 VLVFTLFTFFKVPETKGK S FDEIAAEFRKKSGSAPPRKATVQ Thorens et al . 1996 [61] -0.174 0.560 T 4 , T 7 P24155 643 RFKQEGVLSPKVGMDYRT S ILRPGGSEDASTMLKQFLGRDPK Tullai et al . 2000 [69] -0.264 0.145...”
- “...[ 62 ]. As a consequence, the entry was replaced by the corresponding rat sequence P12336, with the reported phosphorylation sites located at positions 489, 501, 503 and 510. The exact localization of the PKA-dependent phosphorylation sites in the PTH/PTHrP type I receptor (P25107) was performed...”
- Major facilitator superfamily
Pao, Microbiology and molecular biology reviews : MMBR 1998 - “...P11166 P17809 P13355 P11167 P20303 S37476 P11168 P14246 P12336 P47842 P28568 P11169 P32037 P47843 Q07647 P14672 P14142 P19357 P22732 P46408 P43427 Q00712 B30310...”
GTR2_MOUSE / P14246 Solute carrier family 2, facilitated glucose transporter member 2; Glucose transporter type 2, liver; GLUT-2 from Mus musculus (Mouse) (see 3 papers)
NP_112474 solute carrier family 2, facilitated glucose transporter member 2 from Mus musculus
48% identity, 91% coverage
- function: Facilitative hexose transporter that mediates the transport of glucose, fructose and galactose. Likely mediates the bidirectional transfer of glucose across the plasma membrane of hepatocytes and is responsible for uptake of glucose by the beta cells; may comprise part of the glucose-sensing mechanism of the beta cell. May also participate with the Na(+)/glucose cotransporter in the transcellular transport of glucose in the small intestine and kidney. Also able to mediate the transport of dehydroascorbate.
catalytic activity: D-glucose(out) = D-glucose(in) (RHEA:60376)
catalytic activity: D-fructose(out) = D-fructose(in) (RHEA:60372)
catalytic activity: L-dehydroascorbate(out) = L-dehydroascorbate(in) (RHEA:60380)
catalytic activity: D-galactose(in) = D-galactose(out) (RHEA:34915) - (Re-)Viewing Role of Intracellular Glucose Beyond Extracellular Regulation of Glucose-Stimulated Insulin Secretion by Pancreatic Cells
Firdos,, ACS omega 2024 - “...1V4S /P35557 SLC2A2 solute carrier family 2, facilitated glucose transporter member 2 523 M. musculus P14246 SLC2A2 solute carrier family 2, facilitated glucose transporter member 2 524 H. sapiens P11168 RPA1 replication protein A 70kDa DNA-binding subunit 623 M. musculus Q8VEE4 RPA1 replication protein A 70kDa...”
- Proteomic Analysis of the Intestinal Resistance to Thyroid Hormone Mouse Model With Thyroid Hormone Receptor Alpha Mutations
Xi, Frontiers in endocrinology 2022 - “...Down P42225 Signal transducer and activator of transcription 1 Stat1 DQQPGTFLLR ELSAVTFPDIIR 0.24 0.56 Down P14246 Solute carrier family 2, facilitated glucose transporter member 2 Slc2a2 HVLGVPLDDR VSVIQLFTDANYR 0.67 0.74 Down P16858 Glyceraldehyde-3-phosphate dehydrogenase Gapdh IVSNASCTTNCLAPLAK LISWYDNEYGYSNR 0.58 0.73 Down P14094 Sodium/potassium-transporting ATPase subunit beta-1 Atp1b1...”
- SWATH-Based Comprehensive Determination of the Localization of Apical and Basolateral Membrane Proteins Using Mouse Liver as a Model Tissue.
Hirano, Biomedicines 2022 - “...1.95 0.03 Yes Slc9a3r1 P70441 4.74 0.03 Yes Others Ptprg Q05909 1.91 0.07 Potentially Slc2a2 P14246 3.19 0.02 Yes Actn1 Q7TPR4 5.68 0.14 Yes Lsr Q99KG5 1.90 0.01 Yes Abca8a Q8K442 3.09 0.02 Yes Utrn E9Q6R7 5.31 0.06 Yes Ptprd Q64487 1.64 0.08 Potentially Abcc6 Q9R1S7...”
- Unraveling the Proteomic Landscape of Intestinal Epithelial Cell-Derived Exosomes in Mice.
Ding, Frontiers in physiology 2022 - “...3 1258.82 0.572 0.001 Down 26 Q91WG0 Ces2c Acylcarnitine hydrolase 671.42 0.570 0.004 Down 27 P14246 Slc2a2 Solute carrier family 2, facilitated glucose transporter member 2 342.70 0.567 0.019 Down 28 P12791 Cyp2b10 Cytochrome P450 2B10 214.30 0.567 0.026 Down 29 Q08652 Rbp2 Retinol-binding protein 2...”
- “...Down 31 Q8CIW6 Slc26a6 Solute carrier family 26 member 6 639.88 0.579 0.013 Down 32 P14246 Slc2a2 Solute carrier family 2, facilitated glucose transporter member 2 342.70 0.567 0.019 Down SCHEDULE 2 Marker protein information of intestinal cell cluster. No. Accession Gene symbol Description Score Fold...”
- Anti-Inflammatory and Immune Modulatory Effects of Synbio-Glucan in an Atopic Dermatitis Mouse Model.
Kim, Nutrients 2021 - “...Q9EQ16 18 Lungkine 2.718 Cxcl15 Q9WVL7 19 VEGFC 2.509 Vegfc P97953 20 Glut2 2.441 Slc2a2 P14246 21 Endostatin 2.422 Col18a1 P39061 22 RANTES 2.364 Ccl5 P30882 23 CTACK 2.329 Ccl27 Q9Z1X0 24 LIF 2.310 Lif P09056 25 IL-28/IFN-lambda 2.298 Il28b Q8CGK6 26 TCA-3 2.284 Ccl1 P10146...”
- Comparison of the presentation of atopic dermatitis induced by trinitrochlorobenzene and house dust mite in NC/Nga mice.
Kim, Journal of veterinary science 2020 - “...P39061 8 IL-27 3.421 IL27 Q8K3I6 9 IL-22 3.314 IL22 Q9JJY9 10 Glut2 3.270 SLC2A2 P14246 11 Common gamma chain/IL-2 R gamma 3.226 IL2RG P34902 12 IL-1 R4/ST2 3.221 IL1RL1 P14719 13 ICAM-2/CD102 3.098 ICAM2 P35330 14 CRP 3.011 CRP P14847 15 bFGF 3.011 FGF2 P15655...”
- Mutations in SLC2A2 gene reveal hGLUT2 function in pancreatic β cell development
Michau, The Journal of biological chemistry 2013 - “...human GLUT2; H2QNR0 (predicted) for chimpanzee (Pan troglodytes); P14246 for mouse (Mus musculus) GLUT2; P12336 for rat (Rattus norvegicus) GLUT2; Q90592 for...”
- The identification of potential factors associated with the development of type 2 diabetes: a quantitative proteomics approach.
Lu, Molecular & cellular proteomics : MCP 2008 - More
- Sema4D deficiency enhances glucose tolerance through GLUT2 retention in hepatocytes.
Zhang, Journal of translational medicine 2024 - GeneRIF: Sema4D deficiency enhances glucose tolerance through GLUT2 retention in hepatocytes.
- Transcription factor c-Maf deletion improves streptozotocin-induced diabetic nephropathy by directly regulating Sglt2 and Glut2.
Fujino, JCI insight 2023 - GeneRIF: Transcription factor c-Maf deletion improves streptozotocin-induced diabetic nephropathy by directly regulating Sglt2 and Glut2.
- Normal β-Cell Glut2 Expression Is not Required for Regulating Glucose-Stimulated Insulin Secretion and Systemic Glucose Homeostasis in Mice.
Bathina, Biomolecules 2023 - GeneRIF: Normal beta-Cell Glut2 Expression Is not Required for Regulating Glucose-Stimulated Insulin Secretion and Systemic Glucose Homeostasis in Mice.
- Loss of function of renal Glut2 reverses hyperglycaemia and normalises body weight in mouse models of diabetes and obesity.
de, Diabetologia 2022 - GeneRIF: Loss of function of renal Glut2 reverses hyperglycaemia and normalises body weight in mouse models of diabetes and obesity.
- GLUT2 expression by glial fibrillary acidic protein-positive tanycytes is required for promoting feeding-response to fasting.
Barahona, Scientific reports 2022 - GeneRIF: GLUT2 expression by glial fibrillary acidic protein-positive tanycytes is required for promoting feeding-response to fasting.
- The phosphatidylserine flippase β-subunit Tmem30a is essential for normal insulin maturation and secretion.
Yang, Molecular therapy : the journal of the American Society of Gene Therapy 2021 - GeneRIF: The phosphatidylserine flippase beta-subunit Tmem30a is essential for normal insulin maturation and secretion.
- Activation of AMPK pathway compromises Rab11 downregulation-mediated inhibition of Schwann cell proliferation in a Glut1 and Glut3-dependent manner.
Li, Neuroscience letters 2020 (PubMed)- GeneRIF: Activation of AMPK pathway compromises Rab11 downregulation-mediated inhibition of Schwann cell proliferation in a Glut1 and Glut3-dependent manner.
- Estimating and interpreting nonlinear receptive field of sensory neural responses with deep neural network models.
Keshishian, eLife 2020 - GeneRIF: Estimating and interpreting nonlinear receptive field of sensory neural responses with deep neural network models.
- More
XP_011511389 solute carrier family 2, facilitated glucose transporter member 2 isoform X1 from Homo sapiens
50% identity, 89% coverage
U3IRP7 Solute carrier family 2 member 2 from Anas platyrhynchos platyrhynchos
49% identity, 89% coverage
GTR1_DROME / Q8IRI6 Glucose transporter type 1 from Drosophila melanogaster (Fruit fly) (see paper)
51% identity, 31% coverage
- function: Facilitative glucose transporter.
E2C2M2 Glucose transporter type 1 from Harpegnathos saltator
51% identity, 62% coverage
- A proteomic insight into the midgut proteome of Ornithodoros moubata females reveals novel information on blood digestion in argasid ticks.
Oleaga, Parasites & vectors 2017 - “...Another important protein in using glucose as an energy source is the glucose transporter 1 (E2C2M2), also identified in the transcriptome, which would be responsible for transporting blood glucose from the intestinal lumen to the inside of the enterocytes (Table 4 ). Table 4 Proteins involved...”
- “...(T) 0.13 Hydrolase activity Unfed EST_Acari A0A0B1PR88 Glucose-6-phosphate isomerase (T) 0.35 Isomerase activity Unfed mRNA_Om E2C2M2 Glucose transporter type 1 (T) 0.08 Carbohydrate transporter activity Fed mRNA_Om A0A087UZ87 ADP-dependent glucokinase (T) 0.05 Transferase activity Fed mRNA_Om Q7Q4V0 AGAP000862-PA (T) 0.24 Hydrolase activity Fed mRNA_Om B7PE53 Beta-hexosaminidase...”
NP_001261233 glucose transporter 1, isoform R from Drosophila melanogaster
49% identity, 58% coverage
GTR5_BOVIN / P58353 Solute carrier family 2, facilitated glucose transporter member 5; Fructose transporter; Glucose transporter type 5, small intestine; GLUT-5 from Bos taurus (Bovine) (see paper)
NP_001094512 solute carrier family 2, facilitated glucose transporter member 5 from Bos taurus
LOC107131287 solute carrier family 2, facilitated glucose transporter member 5 from Bos taurus
44% identity, 96% coverage
- function: Functions as a fructose transporter that has only low activity with other monosaccharides. Can mediate the uptake of deoxyglucose, but with low efficiency. Essential for fructose uptake in the small intestine. Plays a role in the regulation of salt uptake and blood pressure in response to dietary fructose. Required for the development of high blood pressure in response to high dietary fructose intake.
catalytic activity: D-fructose(out) = D-fructose(in) (RHEA:60372) - Structural comparison of GLUT1 to GLUT3 reveal transport regulation mechanism in sugar porter family.
Custódio, Life science alliance 2021 - “...), GLUT3 (UniProt P11169 ), GLUT4 (UniProt P14672 ), rGLUT5 (UniProt P43427 ), bGLUT5 (UniProt P58353 ), atSTP10 (UniProt Q9LT15 ), XylE (UniProt P0AGF4 ), and GlcPse (UniProt A0A0H2VG78 ). Conserved residues are highlighted with gray-scale. Alpha helices as found in GLUT1 are represented above the...”
- Structure and mechanism of the mammalian fructose transporter GLUT5
Nomura, Nature 2015 - “...taurus GLUT5 cloned sequence containing 1 to 473 out of 501 residues (UniProt accession number: P58353); N51A deglycosylation mutation is underlined and additional C-terminal residues retained after TEV cleavage are shown in italic (see next section for cloning details). MEPQDPVKREGRLTPVIVLATLIAAFGSSFQYGYNVAAINSPSEFMKDFY A YTYYDRVG EYMNEFYLTLLWSVTVSMFPFGGFLGSLMVGPLVNNLGRKGTLLFNNIFSIVPALLMGF SELAKSFEMIIVARVLVGICAGLSSNVVPMYLGELAPKNWRGALGVVPQLFITIGILVAQI FGLRSLLANEEGWPILLGLTGIPAVLQLLFLPFFPESPRYLLIQKKDEAAAKSALRRLRG WHDVDAEIEEILEEDRAEKAVGFISVLKLFKMRSLRWQVISIIVLMAGQQLSGVNAIYYY...”
- Structure and mechanism of the mammalian fructose transporter GLUT5.
Nomura, Nature 2015 - GeneRIF: crystal structures of GLUT5 from Rattus norvegicus and Bos taurus in open outward- and open inward-facing conformations, respectively
- Assessing genomic diversity and signatures of selection in Pinan cattle using whole-genome sequencing data
Zhang, BMC genomics 2022 - “...LOC112449293 15: 48.4848.57 0.015635 LOC781483, LOC781444, LOC781403 16: 8.928.97 0.022505 LOC789494 16: 44.3244.41 0.008253 GPR157, LOC107131287 neuronal differentiation [ 32 ] 18: 44.6044.67 0.013972 LSM14A antiviral immune response [ 33 ] 19: 27.0827.13 0.015391 NLGN2, SPEM2, LOC112442746, TMEM102, TMEM256, SPEM1, FGF11, CHRNB1 disease-related [ 34 38...”
- Genetic Diversity and Signatures of Selection for Thermal Stress in Cattle and Other Two Bos Species Adapted to Divergent Climatic Conditions
Freitas, Frontiers in genetics 2021 - “...blood coagulation F3, FGA, FGG, VWF 0.026 SCEN2INTERPRO General substrate and sugar transporter SLC2A1, SLC2A10, LOC107131287 0.047 SCEN2GOTERM Platelet activation FGA, FGG, VWF 0.04 SCEN2GOTERM Myosin complex MYO1D, MYO1E, MYO5A, MYO5C 0.041 SCEN2GOTERM Steroid hormone receptor activity RORA, RORB, HNF4A, THRA 0.040 SCEN2GOTERM Collagen C1QTNF7, COL4A3,...”
R0K3X3 Solute carrier family 2, facilitated glucose transporter member 5 (Fragment) from Anas platyrhynchos
44% identity, 93% coverage
- A comparative proteomic study of high and low semen quality seminal plasma in drakes.
Tang, Poultry science 2022 - “...PPI ) network analysis, eight potential candidate proteins were identified, including P19140 (Alpha-enolase), R0KUV7 (Calreticulin), R0K3X3 (Solute carrier family 2, facilitated glucose transporter member 5), R0L6V0 (Proteasome subunit beta), R0JKW0 (Cytochrome c), R0JMC5 (Tubulin alpha chain), R0LCK1 (Cathepsin C), and R0JUP6 (Cathepsin D), which could play...”
- “...nodes and 67 edges. The top highest degree proteins included P19140 (Alpha-enolase), R0KUV7 (Calreticulin), and R0K3X3 (Solute carrier family 2, facilitated glucose transporter member 5) ( Figure 4 B) . P19140 (Alpha-enolase) (Degree=15) showed higher degrees of connection degrees than other DEPs and was considered core...”
GTR5_RAT / P43427 Solute carrier family 2, facilitated glucose transporter member 5; Fructose transporter; Glucose transporter type 5, small intestine; GLUT-5 from Rattus norvegicus (Rat) (see 4 papers)
44% identity, 96% coverage
- function: Functions as a fructose transporter that has only low activity with other monosaccharides (PubMed:26416735, PubMed:8333543, PubMed:9820812). Can mediate the uptake of deoxyglucose, but with low efficiency (PubMed:8333543). Essential for fructose uptake in the small intestine (By similarity). Plays a role in the regulation of salt uptake and blood pressure in response to dietary fructose (By similarity). Required for the development of high blood pressure in response to high dietary fructose intake (By similarity).
catalytic activity: D-fructose(out) = D-fructose(in) (RHEA:60372) - Establishing mammalian GLUT kinetics and lipid composition influences in a reconstituted-liposome system
Suades, Nature communications 2023 - “...1-Palmitoyl-2-Oleoyl-sn-Glycero-3-Phosphatidylcholine (POPC; 37-1618-12) were purchased from Larodan. Construct design and cloning Rattus norvegicus GLUT5 (UniProt: P43427) and Plasmodium falciparum Hexose Transporter 1 (UniProt: O97467) encoding genes were cloned as described previously in 33 , 34 . hGLUT1 (Uniprot: P11166), hGLUT3 (Uniprot: P11169), and hGLUT4 (Uniprot: P14672)...”
- Determinants of sugar-induced influx in the mammalian fructose transporter GLUT5.
McComas, eLife 2023 - “...methods Protein modeling Residue numbing for rGLUT5 is based on the UNIPROT entry of rGLUT5: P43427, all generated models begin at residue E7 and end at residue V480. The starting models for rGLUT5 in each state were generated using homology modeling with MODELLER version 10.1 (...”
- “...Functional activity of rGLUT5 mutants Construct design and cloning The full-length sequence of rGLUT5 (Uniprot: P43427) was used for functional assays, with two alterations to the sequence. The deglycosylation mutation N50Y is present, and several C-terminal residues are retained after TEV cleavage. Both are underlined in...”
- Structural comparison of GLUT1 to GLUT3 reveal transport regulation mechanism in sugar porter family.
Custódio, Life science alliance 2021 - “...), GLUT2 (UniProt P11168 ), GLUT3 (UniProt P11169 ), GLUT4 (UniProt P14672 ), rGLUT5 (UniProt P43427 ), bGLUT5 (UniProt P58353 ), atSTP10 (UniProt Q9LT15 ), XylE (UniProt P0AGF4 ), and GlcPse (UniProt A0A0H2VG78 ). Conserved residues are highlighted with gray-scale. Alpha helices as found in GLUT1...”
- Structure and mechanism of the mammalian fructose transporter GLUT5
Nomura, Nature 2015 - “...novel inhibitors with therapeutic potential. METHODS Rattus norvegicus GLUT5 cloned full-length sequence (UniProt accession number: P43427); N50Y deglycosylation mutation is underlined and additional C-terminal residues retained after TEV cleavage are shown in italic (see next section for cloning details). MEKEDQEKTGKLTLVLALATFLAAFGSSFQYGYNVAAVNSPSEFMQQFY Y DTYYDRNK ENIESFTLTLLWSLTVSMFPFGGFIGSLMVGFLVNNLGRKGALLFNNIFSILPAILMGCSK IAKSFEIIIASRLLVGICAGISSNVVPMYLGELAPKNLRGALGVVPQLFITVGILVAQLFGLR SVLASEEGWPILLGLTGVPAGLQLLLLPFFPESPRYLLIQKKNESAAEKALQTLRGWKD VDMEMEEIRKEDEAEKAAGFISVWKLFRMQSLRWQLISTIVLMTGQQLSGVNAIYYYA...”
- Major facilitator superfamily
Pao, Microbiology and molecular biology reviews : MMBR 1998 - “...P32037 P47843 Q07647 P14672 P14142 P19357 P22732 P46408 P43427 Q00712 B30310 U39197 U29377 U43375 U52842 Z46381 L27651 X78855 D83045 A53153 B53153 C53153 S27263...”
NP_113929 solute carrier family 2, facilitated glucose transporter member 5 from Rattus norvegicus
44% identity, 96% coverage
- Structure and mechanism of the mammalian fructose transporter GLUT5.
Nomura, Nature 2015 - GeneRIF: crystal structures of GLUT5 from Rattus norvegicus and Bos taurus in open outward- and open inward-facing conformations, respectively
- Diet-induced epigenetic regulation in vivo of the intestinal fructose transporter Glut5 during development of rat small intestine.
Suzuki, The Biochemical journal 2011 (PubMed)- GeneRIF: investigation of influence of dietary carbohydrates on expression of Glut5 in small intestine: Glut5 mRNA increased with fructose perfusion and age, a pattern that matched that of Pol II binding and histone H3 acetylation at Glut5 promoter
- Positive regulatory control loop between gut leptin and intestinal GLUT2/GLUT5 transporters links to hepatic metabolic functions in rodents.
Sakar, PloS one 2009 - GeneRIF: regulatory control loop between gut leptin and intestinal GLUT2/GLUT5 transporters links to hepatic metabolic functions in rodents
- Dexamethasone sensitizes the neonatal intestine to fructose induction of intestinal fructose transporter (Slc2A5) function.
Douard, Endocrinology 2008 - GeneRIF: Dexamethasone sensitizes the neonatal intestine to fructose induction of intestinal fructose transporter (Slc2A5) function.
- Coordinated, diurnal hexose transporter expression in rat small bowel: implications for small bowel resection.
Houghton, Surgery 2008 - GeneRIF: Hexose transporter-mediated glucose uptake was greater in duodenum and jejunum compared with ileum.
- Fructose-induced hypertension: essential role of chloride and fructose absorbing transporters PAT1 and Glut5.
Singh, Kidney international 2008 - GeneRIF: The essential role of chloride and fructose absorbing Slc2a5 is reported.
- Developmental reprogramming of rat GLUT5 requires glucocorticoid receptor translocation to the nucleus.
Douard, The Journal of physiology 2008 - GeneRIF: The expression and metabolism of GLUT5 during the postnatal developmental process are reported.
- Triiodothyronine (T3) and fructose coordinately enhance expression of the GLUT5 gene in the small intestine of rats during weaning period.
Mochizuki, Bioscience, biotechnology, and biochemistry 2007 (PubMed)- GeneRIF: T3 and fructose coordinately enhance expression of Slc2a5 gene in the small intestine during weaning period.
- More
GTR5_MOUSE / Q9WV38 Solute carrier family 2, facilitated glucose transporter member 5; Fructose transporter; Glucose transporter type 5, small intestine; GLUT-5 from Mus musculus (Mouse) (see 5 papers)
44% identity, 89% coverage
- function: Functions as a fructose transporter that has only low activity with other monosaccharides (PubMed:12031501, PubMed:19091748). Can mediate the uptake of deoxyglucose, but with low efficiency (By similarity). Essential for fructose uptake in the small intestine (PubMed:19091748, PubMed:26071406). Plays a role in the regulation of salt uptake and blood pressure in response to dietary fructose (PubMed:19091748). Required for the development of high blood pressure in response to high dietary fructose intake (PubMed:19091748).
catalytic activity: D-fructose(out) = D-fructose(in) (RHEA:60372)
disruption phenotype: Mice fed a standard diet appear normal and healthy, and display no visible phenotype (PubMed:18417103, PubMed:19091748, PubMed:26071406). Mutant mice show reduced food intake when kept on a high-frucose diet and about 28% reduction of their body weight within seven days. They loose more weight than wild-type mice that receive similar amounts of high-fructose food (PubMed:19091748). Mutant mice show strongly decreased fructose absorption in the jejunum (PubMed:19091748, PubMed:26071406). Contrary to wild-type, mutant mice have a strongly distended colon and caecum when kept on a high-fructose diet. Their intestines look normal when they are fed a standard diet. Contrary to wild-type, mutant mice do not display increased fructose levels in blood serum when kept on a high-fructose diet. Contrary to wild-type, they do not show increased salt absorption in response to fructose, and do not develop high blood pressure in response to fructose feeding. On the contrary, the blood pressure of mutant mice is strongly decreased after five days on a high-fructose diet. Mutant mice develop hypovolemic shock and die after 7 to 10 days on high-fructose diet (PubMed:19091748). Mutant mice display no defects of cochlear morphology or any hearing defects (PubMed:18417103). - A multi-hierarchical approach reveals d-serine as a hidden substrate of sodium-coupled monocarboxylate transporters.
Wiriyasermkul, eLife 2024 - “...0.09 4 767 1.5E+07 Decreased Slc36a1/Pat1 Q8K4D3 1.2 0.08 1.0 0.12 3 103 5.4E+06 Slc2a5/Glut5 Q9WV38 1.2 0.01 0.8 0.04 2 1,140 6.5E+07 Slco4c1/Oatp-m1 Q8BGD4 1.1 0.00 0.9 0.00 9 4,011 1.5E+08 Slc22a13/Oat10 Q6A4L0 1.1 0.03 0.8 0.03 15 5,948 5.6E+08 Slc22a7/Oat2 Q91WU2 0.9 0.00 0.6...”
- Unraveling the Proteomic Landscape of Intestinal Epithelial Cell-Derived Exosomes in Mice.
Ding, Frontiers in physiology 2022 - “...cotransporter 1 785.16 0.606 0.007 Down 18 Q61391 Mme Neprilysin 3797.97 0.597 0.006 Down 19 Q9WV38 Slc2a5 Solute carrier family 2, facilitated glucose transporter member 5 56.26 0.596 0.009 Down 20 P34914 Ephx2 Bifunctional epoxide hydrolase 2 548.11 0.584 0.038 Down 21 Q8CIW6 Slc26a6 Solute carrier...”
- “...365.10 0.622 0.000 Down 29 Q8C3K6 Slc5a1 Sodium/glucose cotransporter 1 785.16 0.606 0.007 Down 30 Q9WV38 Slc2a5 Solute carrier family 2, facilitated glucose transporter member 5 56.26 0.596 0.009 Down 31 Q8CIW6 Slc26a6 Solute carrier family 26 member 6 639.88 0.579 0.013 Down 32 P14246 Slc2a2...”
- A Novel GLP1 Receptor Interacting Protein ATP6ap2 Regulates Insulin Secretion in Pancreatic Beta Cells.
Dai, The Journal of biological chemistry 2015
LOC102178379 solute carrier family 2, facilitated glucose transporter member 5 from Capra hircus
45% identity, 87% coverage
- Transcriptome analysis reveals liver metabolism programming in kids from nutritional restricted goats during mid-gestation
Yang, PeerJ 2021 - “..., COL16A1 , HRCT1 , LOC108636568 , RUNDC3A , LOC102173859 , LBR , LIPN , LOC102178379 , LRP2 , RUNDC3A , SNAP25 and ACSL4 ) mainly enriched in protein digestion and absorption, bile secretion, steroid biosynthesis, carbohydrate digestion and absorption, thyroid hormone synthesis, ABC transporters, insulin...”
FGT1_CAEEL / O44827 Facilitated glucose transporter protein 1 from Caenorhabditis elegans (see 2 papers)
40% identity, 91% coverage
- function: Facilitative glucose transporter that plays a role in glucose metabolism and regulation of longevity. May also play a role in lipid metabolism. Glucose transport activity of isoform a is competitively inhibited by mannose, galactose and fructose, suggesting ability to transport also other hexose sugars.
disruption phenotype: RNAi-mediated knockdown of the protein causes reduced 2-deoxy-D-glucose uptake, glucose oxidation and glucose conversion to triglyceride; simultaneous knockout of daf-2 or age-1 causes further reductions. The lifespan in low glucose environment is extended by 20-25% after knockdown, with 7% extension in daf-2 mutant background and no significant extension in age-1 mutant background. Fat accumulation in intestinal cells is increased. Brood size and dauer formation are not affected.
NP_493981 Facilitated glucose transporter protein 1 from Caenorhabditis elegans
40% identity, 94% coverage
A4ZYQ5 Solute carrier family 2, facilitated glucose transporter member 7 from Rattus norvegicus
41% identity, 91% coverage
GTR7_HUMAN / Q6PXP3 Solute carrier family 2, facilitated glucose transporter member 7; Glucose transporter type 7; GLUT-7; hGLUT7 from Homo sapiens (Human) (see 4 papers)
TC 2.A.1.1.37 / Q6PXP3 The glucose/fructose facilitator, Glut7 (SLC2A7) (a single mutation, I314V, results in loss of fructose transport but retention of glucose transport from Homo sapiens (Human) (see 2 papers)
41% identity, 91% coverage
- function: Probable sugar transporter (PubMed:28083649). Even if its physiological substrate is subject to discussion, it is able to transport glucose and fructose (PubMed:16186102, PubMed:28083649, PubMed:29548810). Does not transport galactose, 2-deoxy-d-glucose and xylose (PubMed:15033637).
catalytic activity: D-glucose(out) = D-glucose(in) (RHEA:60376)
catalytic activity: D-fructose(out) = D-fructose(in) (RHEA:60372) - substrates: Glucose, fructose
- Insights into Substrate and Inhibitor Selectivity among Human GLUT Transporters through Comparative Modeling and Molecular Docking
Ferreira, ACS omega 2019 - “...database 30 (GLUT1: P11166; GLUT2: P11168; GLUT3: P11169; GLUT4: P14672; GLUT5: P22732; GLUT6: Q9UGQ3; GLUT7: Q6PXP3; GLUT8: Q9NY64; GLUT9: Q9NRM0; GLUT10: O95528; GLUT11: Q9BYW1; GLUT12: Q8TD20; GLUT13 (MYCT): Q96QE2; GLUT14: Q8TDB8). Sequence alignment was manually checked in ViTO, 39 taking into account secondary structure prediction by...”
- THE CONCISE GUIDE TO PHARMACOLOGY 2017/18: Transporters
Alexander, British journal of pharmacology 2017 - “...Glucose transporter 9 Systematic nomenclature SLC2A5 SLC2A7 SLC2A9 HGNC, UniProt SLC2A5 , P22732 SLC2A7 , Q6PXP3 SLC2A9 , Q9NRM0 Common abreviation GLUT5 GLUT7 GLUT9 Substrates Dfructose (Dfructose > Dglucose) [ 71 ], Dglucose (Dfructose > Dglucose) [ 71 ] Dfructose [ 87 ], Dglucose [ 87...”
- The Concise Guide to PHARMACOLOGY 2015/16: Transporters
Alexander, British journal of pharmacology 2015 - “...SLC2A9 SLC2A11 Common abreviation GLUT5 GLUT7 GLUT9 GLUT11 HGNC, UniProt SLC2A5 , P22732 SLC2A7 , Q6PXP3 SLC2A9 , Q9NRM0 SLC2A11 , Q9BYW1 Substrates Dfructose (Dfructose > Dglucose) [ 67 ], Dglucose (Dfructose > Dglucose) [ 67 ] Dfructose [ 81 ], Dglucose [ 81 ] Dfructose...”
- Proton-coupled sugar transport in the prototypical major facilitator superfamily protein XylE
Wisedchaisri, Nature communications 2014 - “...GLUT5 (P22732); Homo sapiens facilitated glucose transporter GLUT6 (Q9UGQ3); Homo sapiens facilitated glucose transporter GLUT7 (Q6PXP3); Homo sapiens facilitated glucose transporter GLUT8 (Q9NY64); Homo sapiens facilitated glucose transporter GLUT11 (Q9BYW1); Homo sapiens facilitated glucose transporter GLUT14 (Q8TDB8). Simulation system setup The crystal of structure of XylE...”
LOAG_09566 sugar transporter from Loa loa
43% identity, 92% coverage
GTR9_MOUSE / Q3T9X0 Solute carrier family 2, facilitated glucose transporter member 9; Glucose transporter type 9; GLUT-9; Urate transporter from Mus musculus (Mouse) (see 3 papers)
40% identity, 86% coverage
- function: High-capacity urate transporter, which may play a role in the urate reabsorption by proximal tubules. May have a residual high- affinity, low-capacity glucose and fructose transporter activity. Transports urate at rates 45- to 60-fold faster than glucose. Does not transport galactose. May mediate small uptake of adenine but not of other nucleobases.
catalytic activity: urate(out) = urate(in) (RHEA:60368)
disruption phenotype: Conditional knockout mice lacking Slc2a9 in enterocytes are born at the expected Mendelian rate; they show no obvious phenotype and are fertile (PubMed:25100214). Mice however develop impaired enterocyte uric acid transport kinetics, hyperuricaemia, hyperuricosuria, spontaneous hypertension, dyslipidaemia and elevated body fat (PubMed:25100214). - SWATH-Based Comprehensive Determination of the Localization of Apical and Basolateral Membrane Proteins Using Mouse Liver as a Model Tissue.
Hirano, Biomedicines 2022 - “...O70451 2.63 0.09 Yes Farp1 F8VPU2 3.00 0.03 Yes Bsg P18572 2.50 0.01 Yes Slc2a9 Q3T9X0 2.50 0.01 Yes Ttyh2 Q3TH73 2.76 0.02 Yes Cd82 P40237 2.37 0.01 Yes Slc4a4 O88343 2.42 0.03 Yes Fam126b Q8C729 2.70 0.05 Yes Abca8b Q8K440 2.32 0.01 Yes Epb41l5 Q8BGS1...”
GTR9_HUMAN / Q9NRM0 Solute carrier family 2, facilitated glucose transporter member 9; Glucose transporter type 9; GLUT-9; Urate transporter from Homo sapiens (Human) (see 18 papers)
39% identity, 85% coverage
- function: High-capacity urate transporter, which may play a role in the urate reabsorption by proximal tubules (PubMed:18327257, PubMed:18701466, PubMed:22647630, PubMed:28083649, PubMed:36749388). May have a residual high-affinity, low-capacity glucose and fructose transporter activity (PubMed:18327257, PubMed:18701466, PubMed:18842065). Transports urate at rates 45- to 60-fold faster than glucose (PubMed:18842065). Does not transport galactose (PubMed:28083649). May mediate small uptake of adenine but not of other nucleobases (PubMed:22647630).
catalytic activity: urate(out) = urate(in) (RHEA:60368) - Defining the proteomic landscape of cultured macrophages and their polarization continuum.
Oates, Immunology and cell biology 2023 - “...1.05 0.65 P29323 EPHB2 Ephrin typeB receptor 2 1.13 0.77 Q08554 DSC1 Desmocollin1 1.24 0.66 Q9NRM0 SLC2A9 Solute carrier family 2 facilitated glucose transporter member 9 0.63 1.51 P15529 CD46 Membrane cofactor protein 1.25 1.19 FC, fold change. DISCUSSION In this study, four macrophage polarization states...”
- New SLC22A12 (URAT1) Variant Associated with Renal Hypouricemia Identified by Whole-Exome Sequencing Analysis and Bioinformatics Predictions.
Perdomo-Ramírez, Genes 2023 - “...and the mutated residue. The PDB accession numbers used for URAT1 and GLUT9 were Q96S37and Q9NRM0, respectively. Furthermore, we used the web server HOPE to analyze the structural effects of mutations on URAT1 and GLUT9 ( https://www3.cmbi.umcn.nl/hope/ ) (Accessed on: 4 September 2023) [ 39 ]....”
- Therapeutic effects and mechanisms of N-(9,10-anthraquinone-2-ylcarbonyl) xanthine oxidase inhibitors on hyperuricemia.
Gao, Frontiers in pharmacology 2022 - “...) database ( Okamoto et al., 2003 ). Amino acid sequences of GLUT9 (UniProt ID: Q9NRM0), OAT1 (UniProt ID: Q4U2R8), and OAT3 (UniProt ID: Q8TCC7) were obtained from the UniProt database ( https://www.uniprot.org/ ), and then modeled by AlphaFold Protein Structure Database ( https://alphafold.ebi.ac.uk/ ) (...”
- Insights into Substrate and Inhibitor Selectivity among Human GLUT Transporters through Comparative Modeling and Molecular Docking
Ferreira, ACS omega 2019 - “...GLUT2: P11168; GLUT3: P11169; GLUT4: P14672; GLUT5: P22732; GLUT6: Q9UGQ3; GLUT7: Q6PXP3; GLUT8: Q9NY64; GLUT9: Q9NRM0; GLUT10: O95528; GLUT11: Q9BYW1; GLUT12: Q8TD20; GLUT13 (MYCT): Q96QE2; GLUT14: Q8TDB8). Sequence alignment was manually checked in ViTO, 39 taking into account secondary structure prediction by the PSIPRED server. 47...”
- “...the number of hits, which was set to 250. Query sequences, obtained from UniProt, were Q9NRM0 for human GLUT9, O95528 for GLUT10, Q9BYW1 for human GLUT11, Q8TD20 for GLUT12, and Q96QE2 for human GLUT13. The sequences obtained were then aligned with Clustal Omega and the resulting...”
- THE CONCISE GUIDE TO PHARMACOLOGY 2017/18: Transporters
Alexander, British journal of pharmacology 2017 - “...Systematic nomenclature SLC2A5 SLC2A7 SLC2A9 HGNC, UniProt SLC2A5 , P22732 SLC2A7 , Q6PXP3 SLC2A9 , Q9NRM0 Common abreviation GLUT5 GLUT7 GLUT9 Substrates Dfructose (Dfructose > Dglucose) [ 71 ], Dglucose (Dfructose > Dglucose) [ 71 ] Dfructose [ 87 ], Dglucose [ 87 ] Dfructose [...”
- The Concise Guide to PHARMACOLOGY 2015/16: Transporters
Alexander, British journal of pharmacology 2015 - “...abreviation GLUT5 GLUT7 GLUT9 GLUT11 HGNC, UniProt SLC2A5 , P22732 SLC2A7 , Q6PXP3 SLC2A9 , Q9NRM0 SLC2A11 , Q9BYW1 Substrates Dfructose (Dfructose > Dglucose) [ 67 ], Dglucose (Dfructose > Dglucose) [ 67 ] Dfructose [ 81 ], Dglucose [ 81 ] Dfructose [ 75 ],...”
- An insulin-like modular basis for the evolution of glucose transporters (GLUT) with implications for diabetes.
Root-Bernstein, Evolutionary bioinformatics online 2007 - “...(GTR1 P11166; GTR2 P11168; GTR3 11169; GTR4 P14672; GTR5 P22732; GTR6 Q9UGQ3; GTR8 Q9NY64; GTR9 Q9NRM0; GTR10 O95528; GTR11 Q9BYW1; GTR14 Q8TDB8). A further set of similarity searches was carried out in November 2006 involving the sodium/glucose cotransporters 1, 2 and 3 (P13866, P31639, and Q9NY91),...”
TC 2.A.1.1.72 / Q9NRM0 The kidney basolateral urate efflux transporter (SLC2A9, URATv1 or GLUT9) (orthologue of 2.A.1.1.47) (Anzai et al., 2008). Human SLC2A9a and SLC2A9b isoforms mediate electrogenic transport of urate with different characteristics in the presence of hexoses from Homo sapiens (see 10 papers)
39% identity, 85% coverage
- substrates: Urate
tcdb comment: It transports hexoses as well as urate, the latter by a uniport mechanism, thus catalyzing uptake as well as efflux. The ITM2B protein Q9Y287; 266 aas and 1 TMS) inhibits urate uptake and stimulates efflux (Mandal and Mount 2019). GLUT9's transcription is regulated by a hepatocyte nuclear factor, HNF4α (Prestin et al. 2014). Residues involved in urate transport have been identified (Long et al. 2017)
9cbbA / P0ABE7,Q9NRM0 Structure of urate bound human slc2a9 transporter
39% identity, 91% coverage
- Ligand: uric acid (9cbbA)
TC 2.A.1.1.47 / Q5ERC7 The embryonic liver, kidney, and other tissue uric acid (urate) transporter, Glut9 (SLC2A9) (Wright et al. 2010). Mutations in this transporter cause severe renal hyperuricemia from Mus musculus (Mouse) (see paper)
Slc2a9 / RF|NP_001012363.2 glucose transporter 9b from Mus musculus (see paper)
40% identity, 87% coverage
- substrates: Urate
tcdb comment: It transports hexoses as well as urate, the latter by an electrogenic uniport mechanism. It's transcription is regulated by a hepatocyte nuclear factor, HNF4α (Prestin et al. 2014)
Q5RB09 Solute carrier family 2, facilitated glucose transporter member 9 from Pongo abelii
38% identity, 82% coverage
- Association of a common nonsynonymous variant in GLUT9 with serum uric acid levels in old order amish.
McArdle, Arthritis and rheumatism 2008 - “...Sequence (Val253Ile in bold) Human NP_064425 LLLEKHNEARAVKAFQTFLGKAD V SQEVEEVLAESRVQRSIRLVSVLELL Chimpanzee XP_520688.2 LLLEKHNEARAVKAFQTFLGKAD V SQEVEEVLAESRVQRSIRLVSVLELL Orangutan Q5RB09 LLLEKRNEARAVKAFQTFLGKAD V SREVEEV-AESRVQRSIRLVSVLELL Mouse NP_001012363.2 LLFEKHDEAGAMKAFQTFLGKAD V SQELEEALAESRVQRNLRLVSVLELL Dog XP_536240.2 LLFEKHDQAGAEKAFQTFLGKED V SREVEEVLAESRVQRNIQLVSVLELL Rat XP_577349.2 LLFEKHDEAGATKAFQTFLGKAD V SQELEEALAESRVQRNLRLVSVFELL Chicken XP_420789.2 LLLEKHNTSKAEKAFQTFLGKDD V SQEVEEVLAESRVQRNTKLVSVLQLL Platypus XP_001512025.1 LLFEKHDEAAATKAFQTFLGKDD V SQEIEDILAESRAQRNLRLESVPQLL Opossum XP_001371233.1...”
A9ULS7 Si:ch211-207k7.1 protein from Danio rerio
37% identity, 93% coverage
SLC2A5 / P22732 solute carrier family 2, facilitated glucose transporter member 5 from Homo sapiens (see paper)
GTR5_HUMAN / P22732 Solute carrier family 2, facilitated glucose transporter member 5; Fructose transporter; Glucose transporter type 5, small intestine; GLUT-5 from Homo sapiens (Human) (see 9 papers)
TC 2.A.1.1.13 / P22732 Fructose uniporter, GLUT5 (see 6 papers)
43% identity, 93% coverage
- function: Functions as a fructose transporter that has only low activity with other monosaccharides (PubMed:16186102, PubMed:17710649, PubMed:28083649, PubMed:29548810, PubMed:8333543). Can mediate the uptake of 2-deoxyglucose, but with low efficiency (PubMed:1695905). Essential for fructose uptake in the small intestine (By similarity). Plays a role in the regulation of salt uptake and blood pressure in response to dietary fructose (By similarity). Required for the development of high blood pressure in response to high dietary fructose intake (By similarity).
catalytic activity: D-fructose(out) = D-fructose(in) (RHEA:60372) - substrates: fructose
tcdb comment: The proteins from rat and cow have been crystalized and their structures have been determined in the open outward- and open inward-facing conformations, respectively. On the basis of comparisons of the inward-facing structures of GLUT5 and human GLUT1, a ubiquitous glucose transporter, a single point mutation proved to be enough to switch the substrate-binding preference from fructose to glucose. A comparison of the substrate-free structures of GLUT5 with occluded substrate-bound structures of E. coli XylE suggested that, in addition to a global rocker-switch-like re-orientation of the bundles, local asymmetric rearrangements of carboxy-terminal transmembrane bundle helices, TM7 and TM10, underlie a 'gated-pore' transport mechanism (Nomura et al. 2015). GLUT5 is preferentially used for fructose uptake under (near) anoxic glycolysis to avoid feedback inhibition of phosphofructokinase (Park et al. 2017). Residues involved in fructose recognition have been identified (Ebert et al. 2017) - Urinary Proteomics and Outcomes in Heart Failure With Preserved Ejection Fraction.
Carland, Journal of the American Heart Association 2024 - “...0.0317 0.45 1.58 1.261.96 0.0172 A0A075B6N7 IGHA2 0.38 1.46 1.21.77 0.045 0.4 1.50 1.231.83 0.0218 P22732 SLC2A5 0.49 0.61 0.50.75 0.0004 0.42 0.66 0.530.81 0.0286 P25705 ATP5F1A 0.45 0.64 0.520.78 0.005 0.42 0.65 0.530.81 0.0309 P05026 ATP1B1 0.45 0.64 0.520.78 0.0025 0.42 0.66 0.530.81 0.0367 Q16651...”
- Proteome and immune responses of extracellular vesicles derived from macrophages infected with the periodontal pathogen Tannerella forsythia.
Lim, Journal of extracellular vesicles 2023 - “...1 P20701 Integrin alphaL ITGAL 2.5 1 P52565 Rho GDPdissociation inhibitor 1 ARHGDIA 2.1 0.9 P22732 Solute carrier family 2, facilitated glucose transporter member 5 SLC2A5 2.3 0.8 P62993 Growth factor receptorbound protein 2 GRB2 2.3 0.8 P08582 Melanotransferrin MFI2 2.4 0.7 Q9ULI3 Protein HEG homolog...”
- GLUT5: structure, functions, diseases and potential applications.
Song, Acta biochimica et biophysica Sinica 2023 - “...), the distribution characteristics of the 12 TMs of the human GLUT5 protein (UniProt ID: P22732) along the amino acid sequence, as well as sites where posttranslational modifications occur on the polypeptide chain, were determined ( Figure 2 ). In addition, we downloaded the human GLUT5...”
- Integrative transcriptome analysis of SARS-CoV-2 human-infected cells combined with deep learning algorithms identifies two potential cellular targets for the treatment of coronavirus disease.
Gonçalves, Brazilian journal of microbiology : [publication of the Brazilian Society for Microbiology] 2023 - “...of SLC2A5 and PSMD2 isoform structures The three-dimensional models of isoform 1 of SLC2A5 (id: P22732) and PSMD2 (ID: Q13200) were generated from the AlphaFold database ( https://alphafold.ebi.ac.uk/ ) partnership between DeepMind and EMBL-EBI, which set out to solve all the main protein structures encoded by...”
- “...three-dimensional models of its isoforms (Table S1 ) derived from the alternative-splicing demonstrated in accessions P22732 and Q13200 (Uniprot ID). Even though interactions with the lipid bilayer make it particularly difficult to achieve high-quality resolution of transmembrane transporters [ 68 ], the complete structure of GLUT-5...”
- Extracellular Vesicles from Human Adipose-Derived Mesenchymal Stem Cells: A Review of Common Cargos.
Alonso-Alonso, Stem cell reviews and reports 2022 - “...P11169 SLC2A3 [ 65 ] Solute carrier family 2, facilitated glucose transporter member 5* GTR5_HUMAN P22732 SLC2A5 [ 52 , 65 ] Somatotropin* SOMA_HUMAN P01241 GH1 [ 52 ] Sonic hedgehog protein* SHH_HUMAN Q15465 SHH [ 52 ] SPARC SPRC_HUMAN P09486 SPARC [ 60 ] Sphingosine...”
- Effect of transient scrotal hyperthermia on human sperm: an iTRAQ-based proteomic analysis.
Wu, Reproductive biology and endocrinology : RB&E 2020 - “...Peptidyl-prolyl cis-trans isomerase-like 6 0.64450 26 SMCP P49901 Sperm mitochondrial-associated cysteine-rich protein 0.51795 27 SLC2A5 P22732 Solute carrier family 2, facilitated glucose transporter member 5 0.65610 28 PFN3 P60673 Profilin-3 0.58565 29 TMEM190 Q8WZ59 Transmembrane protein 190 0.60795 30 SPATA31D1 Q6ZQQ2 Spermatogenesis-associated protein 31D1 0.66080 31...”
- Quantitative proteomic analysis of urinary exosomes in kidney stone patients.
Wang, Translational andrology and urology 2020 - “...0.02 GSTA1 P08263 2.00 6.30 0.00 11.29 Glutathione peroxidase activity/epithelial cell differentiation 1.39 0.05 GTR5 P22732 8.00 12.20 0.00 78.71 Fructose binding/carbohydrate metabolic process 1.41 <0.01 VAT1 Q99536 3.00 9.20 0.00 32.12 Oxidoreductase activity/negative regulation of mitochondrial fusion 1.42 0.03 ALDOB P05062 12.00 36.30 0.00 323.31...”
- Insights into Substrate and Inhibitor Selectivity among Human GLUT Transporters through Comparative Modeling and Molecular Docking
Ferreira, ACS omega 2019 - “...obtained from the UniProt database 30 (GLUT1: P11166; GLUT2: P11168; GLUT3: P11169; GLUT4: P14672; GLUT5: P22732; GLUT6: Q9UGQ3; GLUT7: Q6PXP3; GLUT8: Q9NY64; GLUT9: Q9NRM0; GLUT10: O95528; GLUT11: Q9BYW1; GLUT12: Q8TD20; GLUT13 (MYCT): Q96QE2; GLUT14: Q8TDB8). Sequence alignment was manually checked in ViTO, 39 taking into account...”
- More
XP_014952115 solute carrier family 2, facilitated glucose transporter member 9 isoform X1 from Ovis aries
38% identity, 88% coverage
FGTH1_CAEEL / O44616 Facilitated glucose transporter homolog from Caenorhabditis elegans (see paper)
38% identity, 89% coverage
- function: Appears to have no transport activity for glucose.
K1QTP5 Solute carrier family 2, facilitated glucose transporter member 1 from Magallana gigas
35% identity, 80% coverage
XP_011539126 solute carrier family 2, facilitated glucose transporter member 7 isoform X1 from Homo sapiens
41% identity, 81% coverage
XP_019907851 solute carrier family 2, facilitated glucose transporter member 11b isoform X2 from Esox lucius
36% identity, 93% coverage
NP_001120033 solute carrier family 2 member 7 from Xenopus tropicalis
35% identity, 92% coverage
XP_063129574 solute carrier family 2, facilitated glucose transporter member 9 isoform X4 from Rattus norvegicus
38% identity, 90% coverage
GTR5_RABIT / P46408 Solute carrier family 2, facilitated glucose transporter member 5; Fructose transporter; Glucose transporter type 5, small intestine; GLUT-5 from Oryctolagus cuniculus (Rabbit) (see paper)
39% identity, 98% coverage
- function: Functions as a fructose transporter that has only low activity with other monosaccharides (PubMed:7980458). Can mediate the uptake of deoxyglucose, but with low efficiency (By similarity). Essential for fructose uptake in the small intestine. Plays a role in the regulation of salt uptake and blood pressure in response to dietary fructose. Required for the development of high blood pressure in response to high dietary fructose intake (By similarity).
catalytic activity: D-fructose(out) = D-fructose(in) (RHEA:60372) - Major facilitator superfamily
Pao, Microbiology and molecular biology reviews : MMBR 1998 - “...P11169 P32037 P47843 Q07647 P14672 P14142 P19357 P22732 P46408 P43427 Q00712 B30310 U39197 U29377 U43375 U52842 Z46381 L27651 X78855 D83045 A53153 B53153 C53153...”
Smp_046790 putative glucose transport protein from Schistosoma mansoni
38% identity, 91% coverage
Smp_105410 putative glucose transport protein from Schistosoma mansoni
38% identity, 92% coverage
- Differential Excretory/Secretory Proteome of the Adult Female and Male Stages of the Human Blood Fluke, <i>Schistosoma mansoni</i>
Kenney, Frontiers in parasitology 2022 - “...). Here, by contrast, significantly elevated abundance of GTP1 (Smp_012440, Q26579_SCHMA) and other glucose transporters (Smp_105410, G4VC44_SCHMA) was evident in the female S. mansoni , likely the result of an increased expression in the tegument. These discrepancies may in part be explained since transcriptomic analysis was...”
- Single-cell deconstruction of stem-cell-driven schistosome development
Nanes, Trends in parasitology 2021 - “...(Smp_103610); cb1.2 (Smp_067060); ctsl (Smp_343260); hmgbs (Smp_075800) Tegumental syncytial annexin b2 (Smp_077720); calpain (Smp_214190); gtp-4 (Smp_105410); npp-5 (Smp_153390); sm25 (Smp_346900); tal (Smp_045200); tsp2 (Smp_335630) progeny 1 tsp2 (Smp_335630); zfp1-1 (Smp_049580) progeny 2 onzin (Smp_101970); sm13 (Smp_195190); sm25 (Smp_346900); tsp2 (Smp_335630) Protonephdridia igsf9b (Smp_035040); sialidase (Smp_335600) Esophagus...”
- Transcriptome of the parasitic flatworm Schistosoma mansoni during intra-mammalian development
Wangwiwatsin, PLoS neglected tropical diseases 2020 - “...genes contributing to the enriched GO term carbohydrate transport encode two confirmed glucose transporters (Smp_012440, Smp_105410) [ 42 ] and a third, non-confirmed, putative glucose transporter (Smp_139150). Between days 28 and 35, the parasites become fully established in the portal system within the mesentery veins and...”
- “...GO terms for all four clusters was carbohydrate transport with two glucose transporters (Smp_012440 and Smp_105410) that have been previously characterised in S . mansoni [ 42 ]. Hypothetical protein with predicted structure matching a complement cascade regulator With four genes out of ten in cluster...”
- Single-cell atlas of the first intra-mammalian developmental stage of the human parasite Schistosoma mansoni
Diaz, Nature communications 2020 - “...(Smp_129050) N =3, 0; epsin-4 (Smp_140330) N =3, 5; fimbrin (Smp_037230) N =0, 4; gtp-4 (Smp_105410) N =0, 3; lipopolysaccharide induced (Smp_025370) N =0, 1; rab18 (Smp_169460) N =0, 4; NMDA receptor glutamate binding chain (Smp_181470) N =0, 1; cathepsin B (Smp_141610) N =5, 3; LAP...”
- Novel cholinesterase paralogs of Schistosoma mansoni have perceived roles in cholinergic signalling and drug detoxification and are essential for parasite survival
Tedla, PLoS pathogens 2019 - “...levels of each smche , as well as the glucose transporters sgtp1 (smp_012440) and sgtp4 (smp_105410), were also measured. Glucose levels were normalized according to the number of viable parasites and expressed relative to the luc group. Data is the average of 2 biological and 3...”
- Inhibition of histone methyltransferase EZH2 in Schistosoma mansoni in vitro by GSK343 reduces egg laying and decreases the expression of genes implicated in DNA replication and noncoding RNA metabolism
Pereira, PLoS neglected tropical diseases 2018 - “...63 ]. Other validated genes encode LDL receptor, FA binding protein and Glucose transport protein (Smp_105410), components of the tegument membrane. Genes encoding the gynecophoral canal protein, involved in mating, the Dnase II protein, involved in degradation of exogenous DNA for cell homeostasis, and the FGFR...”
- MiR-277/4989 regulate transcriptional landscape during juvenile to adult transition in the parasitic helminth Schistosoma mansoni
Protasio, PLoS neglected tropical diseases 2017 - “...mixture of four FITC-conjugated antisense probes targeting the following tegument-specific mRNAs: calpain (Smp_214190), gtp -4 (Smp_105410), annexin (Smp_077720), and npp-5 (Smp_153390) (ref: [ 69 73 ]). Results 2.1. Target-prediction suggests sma-miR-277/4989 are prominent post-regulatory miRNAs in developing juvenile worms In our analysis, Sylamer [ 36 ]...”
LOC113810126 solute carrier family 2, facilitated glucose transporter member 1 from Penaeus vannamei
35% identity, 87% coverage
- Structure and function analyses of the Mmd2 gene in pacific white shrimp Litopenaeus vannamei
Si, Frontiers in genetics 2023 - “...Up protein digestion, absorption and transport LOC113814621 solute carrier family 22 member 6-like 1.561611039 Up LOC113810126 solute carrier family 2, facilitated glucose transporter member 1-like 1.384393286 Up LOC113818126 glutamate receptor 3-like 5.566253426 Down LOC113809326 proteasome subunit alpha type-7-like 4.896032637 Down LOC113813297 protein transport protein Sec61 subunit...”
GTP4 / AAA19733.1 glucose transport protein from Schistosoma mansoni (see paper)
38% identity, 92% coverage
TC 2.A.1.1.43 / A0ZXK6 The monosaccharide (MST) (glucose > mannose > galactose > fructose):H+ symporter, MST1 from Geosiphon pyriformis (see paper)
38% identity, 84% coverage
- substrates: Galactose, H+, Mannose, fructose, glucose
GTR11_HUMAN / Q9BYW1 Solute carrier family 2, facilitated glucose transporter member 11; Glucose transporter type 11; GLUT-11 from Homo sapiens (Human) (see paper)
TC 2.A.1.1.44 / Q9BYW1 The hexose (glucose and fructose but not galactose) transporter (Glut11; SLC2A11) from Homo sapiens (see 4 papers)
33% identity, 96% coverage
- function: Facilitative glucose transporter.
catalytic activity: D-glucose(out) = D-glucose(in) (RHEA:60376) - substrates: Hexoses
- Insights into Substrate and Inhibitor Selectivity among Human GLUT Transporters through Comparative Modeling and Molecular Docking
Ferreira, ACS omega 2019 - “...GLUT4: P14672; GLUT5: P22732; GLUT6: Q9UGQ3; GLUT7: Q6PXP3; GLUT8: Q9NY64; GLUT9: Q9NRM0; GLUT10: O95528; GLUT11: Q9BYW1; GLUT12: Q8TD20; GLUT13 (MYCT): Q96QE2; GLUT14: Q8TDB8). Sequence alignment was manually checked in ViTO, 39 taking into account secondary structure prediction by the PSIPRED server. 47 Models were then built...”
- “...to 250. Query sequences, obtained from UniProt, were Q9NRM0 for human GLUT9, O95528 for GLUT10, Q9BYW1 for human GLUT11, Q8TD20 for GLUT12, and Q96QE2 for human GLUT13. The sequences obtained were then aligned with Clustal Omega and the resulting file was visualized and analyzed with Jalview,...”
- THE CONCISE GUIDE TO PHARMACOLOGY 2017/18: Transporters
Alexander, British journal of pharmacology 2017 - “...10 Glucose transporter 12 Systematic nomenclature SLC2A11 SLC2A6 SLC2A8 SLC2A10 SLC2A12 HGNC, UniProt SLC2A11 , Q9BYW1 SLC2A6 , Q9UGQ3 SLC2A8 , Q9NY64 SLC2A10 , O95528 SLC2A12 , Q8TD20 Common abreviation GLUT11 GLUT6 GLUT8 GLUT10 GLUT12 Substrates Dfructose [ 368 ], Dglucose [ 134 ] Dglucose [...”
- The Concise Guide to PHARMACOLOGY 2015/16: Transporters
Alexander, British journal of pharmacology 2015 - “...GLUT9 GLUT11 HGNC, UniProt SLC2A5 , P22732 SLC2A7 , Q6PXP3 SLC2A9 , Q9NRM0 SLC2A11 , Q9BYW1 Substrates Dfructose (Dfructose > Dglucose) [ 67 ], Dglucose (Dfructose > Dglucose) [ 67 ] Dfructose [ 81 ], Dglucose [ 81 ] Dfructose [ 75 ], uric acid [...”
- Proton-coupled sugar transport in the prototypical major facilitator superfamily protein XylE
Wisedchaisri, Nature communications 2014 - “...GLUT7 (Q6PXP3); Homo sapiens facilitated glucose transporter GLUT8 (Q9NY64); Homo sapiens facilitated glucose transporter GLUT11 (Q9BYW1); Homo sapiens facilitated glucose transporter GLUT14 (Q8TDB8). Simulation system setup The crystal of structure of XylE with substrate bound in the outward-facing partially occluded conformation (PDB 4GBY) was used as...”
- An insulin-like modular basis for the evolution of glucose transporters (GLUT) with implications for diabetes.
Root-Bernstein, Evolutionary bioinformatics online 2007 - “...GTR3 11169; GTR4 P14672; GTR5 P22732; GTR6 Q9UGQ3; GTR8 Q9NY64; GTR9 Q9NRM0; GTR10 O95528; GTR11 Q9BYW1; GTR14 Q8TDB8). A further set of similarity searches was carried out in November 2006 involving the sodium/glucose cotransporters 1, 2 and 3 (P13866, P31639, and Q9NY91), using as control sequences...”
- Mining protein function from text using term-based support vector machines.
Rice, BMC bioinformatics 2005 - “...see Table 4 ), while it was very poor for other two proteins (P30153 and Q9BYW1; also see Table 4 ). We believe that a plausible reason for such discrepancy was the relevance of retrieved documents: for the first two proteins, almost all collected documents were...”
- “...P30153 ( serine/threonine protein phosphatase 2A, 65 KDA regulatory subunit A, alpha isoform ) and Q9BYW1 ( solute carrier family 2, facilitated glucose transporter, member 11 ). We believe that the relevance of the retrieval sets significantly influenced the quality of predictions for the respective proteins...”
NP_110434 solute carrier family 2, facilitated glucose transporter member 11 isoform a from Homo sapiens
33% identity, 95% coverage
- Multiple myeloma exhibits novel dependence on GLUT4, GLUT8, and GLUT11: implications for glucose transporter-directed therapy.
McBrayer, Blood 2012 - GeneRIF: Critical roles for novel GLUT family members highlight a therapeutic strategy entailing selective GLUT inhibition to specifically target aberrant glucose metabolism in cancer.
- Risk of meningioma and common variation in genes related to innate immunity.
Rajaraman, Cancer epidemiology, biomarkers & prevention : a publication of the American Association for Cancer Research, cosponsored by the American Society of Preventive Oncology 2010 - GeneRIF: Observational study of gene-disease association. (HuGE Navigator)
- Polymorphisms in innate immunity genes and risk of childhood leukemia.
Han, Human immunology 2010 - GeneRIF: Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
- Common variation in genes related to innate immunity and risk of adult glioma.
Rajaraman, Cancer epidemiology, biomarkers & prevention : a publication of the American Association for Cancer Research, cosponsored by the American Society of Preventive Oncology 2009 - GeneRIF: Observational study of gene-disease association. (HuGE Navigator)
- Cloning and characterization of glucose transporter 11, a novel sugar transporter that is alternatively spliced in various tissues.
Wu, Molecular genetics and metabolism 2002 (PubMed)- GeneRIF: a novel sugar transporter that is alternatively spliced in various tissues
- Characterization of the human SLC2A11 (GLUT11) gene: alternative promoter usage, function, expression, and subcellular distribution of three isoforms, and lack of mouse orthologue.
Scheepers, Molecular membrane biology (PubMed)- GeneRIF: Different promoters and splicing generate three SLC2A11 isoforms which are expressed in a tissue specific manner but do not appear to differ in their functional characteristics.
- A highly conserved hydrophobic motif in the exofacial vestibule of fructose transporting SLC2A proteins acts as a critical determinant of their substrate selectivity.
Manolescu, Molecular membrane biology (PubMed)- GeneRIF: GLUT11 can also transport fructose, but it has the motif DSV at the same position, which appears to function in the same manner as NXI and when all three residues are replaced with NAV fructose transport lost.
TC 2.A.1.1.52 / Q26579 The glucose transport protein, GTP1 from Schistosoma mansoni (Blood fluke) (see paper)
GTP1 / AAA19731.1 glucose transport protein from Schistosoma mansoni (see paper)
Smp_012440 putative glucose transport protein from Schistosoma mansoni
36% identity, 91% coverage
- substrates: glucose
- Human tumor necrosis factor alpha affects the egg-laying dynamics and glucose metabolism of Schistosoma mansoni adult worms in vitro
Lopes-Junior, Parasites & vectors 2022 - “...of LDH (Smp_033040), Sm TNFR (Smp_168070) and glucose transporters, S. mansoni glucose transporter protein1 (SGTP1) (Smp_012440), SGTP2 (Smp_046790), SGTP3 (Smp_127200) and SGTP4 (Smp_103410), were measured. The primer efficiencies were tested, and all of them were between 90 and 110%. Smp_090920 and Smp_062630 were used as reference...”
- Differential Excretory/Secretory Proteome of the Adult Female and Male Stages of the Human Blood Fluke, <i>Schistosoma mansoni</i>
Kenney, Frontiers in parasitology 2022 - “...schistosome gender (Cai et al., 2016 ). Here, by contrast, significantly elevated abundance of GTP1 (Smp_012440, Q26579_SCHMA) and other glucose transporters (Smp_105410, G4VC44_SCHMA) was evident in the female S. mansoni , likely the result of an increased expression in the tegument. These discrepancies may in part...”
- Transcriptome of the parasitic flatworm Schistosoma mansoni during intra-mammalian development
Wangwiwatsin, PLoS neglected tropical diseases 2020 - “...The genes contributing to the enriched GO term carbohydrate transport encode two confirmed glucose transporters (Smp_012440, Smp_105410) [ 42 ] and a third, non-confirmed, putative glucose transporter (Smp_139150). Between days 28 and 35, the parasites become fully established in the portal system within the mesentery veins...”
- “...top enriched GO terms for all four clusters was carbohydrate transport with two glucose transporters (Smp_012440 and Smp_105410) that have been previously characterised in S . mansoni [ 42 ]. Hypothetical protein with predicted structure matching a complement cascade regulator With four genes out of ten...”
- Novel cholinesterase paralogs of Schistosoma mansoni have perceived roles in cholinergic signalling and drug detoxification and are essential for parasite survival
Tedla, PLoS pathogens 2019 - “...exclusion and transcript levels of each smche , as well as the glucose transporters sgtp1 (smp_012440) and sgtp4 (smp_105410), were also measured. Glucose levels were normalized according to the number of viable parasites and expressed relative to the luc group. Data is the average of 2...”
XP_021757156 plastidic glucose transporter 4-like from Chenopodium quinoa
33% identity, 84% coverage
- Salinity Effects on Guard Cell Proteome in Chenopodium quinoa
Rasouli, International journal of molecular sciences 2021 - “...channel subunit beta Potassium XP_021753247 monosaccharide-sensing protein 2-like Sugar XP_021726328 sugar carrier protein C-like Sugar XP_021757156 plastidic glucose transporter 4-like Sugar XP_021760460 sucrose transport protein-like isoform X1 Sucrose XP_021752898 chloride channel protein CLC-b-like anions XP_021739774 ATPase ASNA1 homolog anions XP_021772050 ADP, ATP carrier protein 1, mitochondrial-like...”
Q9LLE0 Hexose transporter (Fragment) from Solanum tuberosum
34% identity, 91% coverage
- Comparative Membrane-Associated Proteomics of Three Different Immune Reactions in Potato
Burra, International journal of molecular sciences 2018 - “...Q43775 Glycolate oxidase (EC 1.1.3.15) 1.01 0.18 0.67 PGSC0003DMP400009092 Glyoxisomal malate dehydrogenase 1.65 1.01 1.34 Q9LLE0 Hexose transporter 0.7 0.15 0.24 PGSC0003DMP400035078 Hydrolase, acting on ester bonds 1.91 2.36 2.58 B2D2G3 Hydroxypyruvate reductase (EC 1.1.1.81) 1.25 0.55 0.88 B9JNE9 Insertion sequence transposase protein 2.02 2.43 2.78...”
pGlcT / Q56ZZ7 glucose transporter from Arabidopsis thaliana (see 4 papers)
PLST4_ARATH / Q56ZZ7 Plastidic glucose transporter 4; AtpGlcT from Arabidopsis thaliana (Mouse-ear cress) (see paper)
TC 2.A.1.1.102 / Q56ZZ7 Plastidic glucose transporter 4 (AtpGlcT) from Arabidopsis thaliana (see 5 papers)
NP_850828 plastidic GLC translocator from Arabidopsis thaliana
AT5G16150 PGLCT (PLASTIDIC GLC TRANSLOCATOR); carbohydrate transmembrane transporter/ sugar:hydrogen symporter from Arabidopsis thaliana
34% identity, 84% coverage
- function: May be involved in the efflux of glucose towards the cytosol.
- substrates: glucose
- Do mitochondria use efflux pumps to protect their ribosomes from antibiotics?
Islam, Microbiology (Reading, England) 2023 - “...9E^121** Q9SYQ1, 0.00014 A0A286YF51, 0.0019 [ 73 ] TPO1 Polyamine transporter 1 MFS G1UAY0, 1.9E^141# Q56ZZ7, 0.00017 Q6ZMD2, 9.2E^6 [ 40 ] TPO3 Polyamine transporter 3 MFS Q9C0R8, 6.1E^98# A0A1I9LP99, 7.5E^5 Q7L0J3, 0.0047 [ 40, 73 ] *Information adapted from the Saccharomyces Genome Database (SGD). https://www.yeastgenome.org/....”
- “...MFS T2AWG3, 0.0014 Q8GYF4, 1.4E^24 B3KT41, 0.0022 [ 79 ] NCU09551 Q7S2B0 MFS G1UAY0, 2.3E^6 Q56ZZ7, 2.3E^7 Q8NBP5, 8.4E^9 [ 78 ] NCU10021 Q7S0I5 MFS Q8J2J7, 8.1E^102 Q9FMX3, 2.3E^55 Q96QE2, 2.8E^41 [ 78 ] *Information gathered from NCBI Protein BLAST, algorithm: PSI-BLAST ( https://www.ncbi.nlm.nih.gov/ ) and...”
- Microsome-associated proteome modifications of Arabidopsis seedlings grown on board the International Space Station reveal the possible effect on plants of space stresses other than microgravity
Mazars, Plant signaling & behavior 2014 - “...protein Transporters P23586 AT1G11260 0.370 sugar transporter 1 Q8LGU1 AT3G21250 0.456 multidrug resistance-associated protein 6 Q56ZZ7 AT5G16150 0.523 Plastidic glucose transporter 4 Q53XH7 AT5G62670 0.553 H(+)-ATPase 11 Q94FB9 AT4G39850 0.559 ABC transporter D family member 1 Q9SE45 AT2G38760 0.587 annexin D3 Aquaporins Q41975 AT4G17340 0.219 putative...”
- The novel chloroplast glucose transporter pGlcT2 affects adaptation to extended light periods.
Valifard, The Journal of biological chemistry 2023 - GeneRIF: The novel chloroplast glucose transporter pGlcT2 affects adaptation to extended light periods.
- Role of the plastidic glucose translocator in the export of starch degradation products from the chloroplasts in Arabidopsis thaliana.
Cho, The New phytologist 2011 (PubMed)- GeneRIF: pGlcT, together with MEX1, contributes significantly to the export of starch degradation products from chloroplasts in A. thaliana leaves and and that this starch-mediated pathway for photoassimilate export via pGlcT and MEX1 is essential for the growth and development of A. thaliana. [pGlcT]
- The novel chloroplast glucose transporter pGlcT2 affects adaptation to extended light periods
Valifard, The Journal of biological chemistry 2023 - “...of the MST-type sugar transporter family in Arabidopsis revealed that pGlcT (encoded by the gene At5g16150 ) is one of four closely related carrier isoforms representing an independent MST subgroup ( 3 ). The next homolog to pGlcT is the protein encoded by the gene At1g05030...”
- “...Alignment of pGlcT2 with other sugar transporters (VGT1: At3g03090 , pSUT: At5g59250 , and pGLCT: At5g16150 ) was done using MEGA11 software ( 74 ) based on ClustalW ( 75 ) alignment of the corresponding amino acid sequences. The alignment was visualized using GeneDoc ( 76...”
- Nucleotide Imbalance, Provoked by Downregulation of Aspartate Transcarbamoylase Impairs Cold Acclimation in Arabidopsis
Bellin, Molecules (Basel, Switzerland) 2023 - “...1.97 2.05 1.48 1.49 Mt, P adenine nucleotide AT5G66380 FOLT1 0.76 1.05 0.65 PL folate AT5G16150 pGlcT 0.44 0.87 1.03 1.20 0.34 PL hexose AT1G68570 NPF3.1 2.69 2.35 0.66 0.72 PL nitrite AT4G32400 BT1-like 2.01 1.58 0.70 0.72 PL nucleotide AT1G61800 GPT2 5.90 7.61 0.39 1.65...”
- Genome-Wide Association Study to Identify Possible Candidate Genes of Snap Bean Leaf and Pod Color
Celebioglu, Genes 2023 - “...706,796 11.61 0.36 31.60 10.9 7.76 10 9 Phvul.008G006600 AT5G65560 Phvul.008G006700 AT5G38720 Phvul.008G006800 AT2G19540 Phvul.008G007500 AT5G16150 Phvul.008G007600 AT2G39060 Phvul.008G007700 AT5G16180 Phvul.008G008400 AT1G66840 5-593 1 G/T H.2020 50,939,307 27.26 0.08 75.89 29.3 1.47 10 23 Pv5-593.01G220900 AT5G26600 Pv5-593.01G221300 AT1G56720 Pv5-593.01G221400 Pv5-593.01G221500 AT1G09430 Pv5-593.01G221600 AT3G07100 Pv5-593.01G221800 AT1G56700 Pv5-593.01G221900...”
- An expanded role for the transcription factor WRINKLED1 in the biosynthesis of triacylglycerols during seed development
Kuczynski, Frontiers in plant science 2022 - “...PGI 1 (phosphoglucose isomerase, AT4G24620) (p) +20(+) 2.90.6 0.92 0.94 ** PGLCT (plastidic glucose translocator, AT5G16150) +45() 23.94.7 1.00 0.82 * PGLM 1 (phosphoglyceromutase, AT1G22170) (p) +104(+) 1.91.3 0.67 1.00 ** PGLM 2 (phosphoglyceromutase, AT1G78050) (p) +78(+) 6.74.1 1.00 0.97 ** PK p PK- (Pyruvate kinase...”
- Genome-wide identification, expression, and association analysis of the monosaccharide transporter (MST) gene family in peanut (Arachis hypogaea L.)
Wan, 3 Biotech 2020 - “...Regulate arsenic accumulation AhMST76 AhMST43 AhMST57 PGLCT (AT5G16150) Affecting chloroplast AtPLT6/AtPMT6 (AT4G36670) Effect pollen and young xylem cells INT1...”
- Transcriptional Plasticity of Autophagy-Related Genes Correlates with the Genetic Response to Nitrate Starvation in Arabidopsis Thaliana
Bedu, Cells 2020 - “...0.079 0.022 19.4% 0.005 ** GLU1 At5g04140 6.208 1.835 6.972 2.141 12.3% 0.026 * GLT At5g16150 0.284 0.110 0.372 0.139 31.0% 0.000 *** * p < 0.05, ** p < 0.01, *** p < 0.001, ns = not statistically significant. cells-09-01021-t002_Table 2 Table 2 Averages of...”
- Pan- and core- gene association networks: Integrative approaches to understanding biological regulation
Wirojsirasak, PloS one 2019 - “...a-Glucosidase-like 3 At5g11720 AGL4 a-Glucosidase-like 4 At1g68560 AGL5 a-Glucosidase-like 5 At5g46110 TPT1 Triose phosphate translocator At5g16150 GLT1 Glucose transporter At5g17520 MEX1 Maltose exporter The consensus-based network, proposed herein as core -GAN, is generally considered a reliable network because the constituents are supported by more than one...”
- Dynamics of metabolic responses to periods of combined heat and drought in Arabidopsis thaliana under ambient and elevated atmospheric CO2
Zinta, Journal of experimental botany 2018 - “...at4g10120; ADP glucose pyrophosphorylase, EC 2.7.7.27, at5g19220), and sugar transporters (sucrose-proton symporter 1/plastidic GLC translocator, at5g16150; glucose-6-phosphate translocator, at5g46110). Elevated CO 2 dampened this effect (see Supplementary Fig. S1a ). Glycolysis-related genes were generally down-regulated under stress ( Fig. S1b ). Transcripts of raffinose synthesis genes...”
- More
BSU35830 putative carbohydrate transporter from Bacillus subtilis subsp. subtilis str. 168
32% identity, 94% coverage
- Secondary structural entropy in RNA switch (Riboswitch) identification
Manzourolajdad, BMC bioinformatics 2015 - “...-55.60 - 0.4600 123.0559998 - 0.3600 899 yxeF BSU39570 0.8090547919 200 nt 3688648 3688847 reverse BSU35830 ywtG -3786 -49.93 - 0.3300 120.9260025 - 0.3550 199 yvyI BSU35790 0.8084035516 200 nt 1668788 1668987 reverse BSU15960 ylqB -2279 -51.60 - 0.4050 122.7809982 - 0.4150 13099 rpmB BSU15820 0.8080439568...”
C0P753 Sugar transporter ERD6-like 6 from Zea mays
33% identity, 91% coverage
- Phosphoproteomic Analysis of Two Contrasting Maize Inbred Lines Provides Insights into the Mechanism of Salt-Stress Tolerance
Zhao, International journal of molecular sciences 2019 - “...in Zheng58 ( Figure 7 ). Proteins including sodium/hydrogen exchanger (A0A096Q7K1, Zm.82157), sugar transport protein (C0P753, ERD6), glutamate synthase (A0A096RAH5, Zm.24266), and one uncharacterized protein (transport activity, B4FC34, GRMZM2G082184) constituted the first group. These proteins are related to sodium transport, amino acid transport/metabolism, and sugar transport....”
TC 2.A.1.1.106 / P46333 Probable metabolite transport protein CsbC from Bacillus subtilis (strain 168) (see 3 papers)
32% identity, 90% coverage
- substrates: Metabolites
- Major facilitator superfamily
Pao, Microbiology and molecular biology reviews : MMBR 1998 - “...P09830 P45598 P37021 P21906 P15729 U29579 X86780 P09098 P31578 P54723 U66480 P46333 P42417 P37514 SP SP SP SP SP GB GB SP SP SP GB SP SP SP Ar Sulfolobus...”
E4NW64 MFS transporter, sugar porter family from Halogeometricum borinquense (strain ATCC 700274 / DSM 11551 / JCM 10706 / KCTC 4070 / PR3)
34% identity, 76% coverage
A0A1U8L877 Sugar transporter ERD6-like 6 from Gossypium hirsutum
33% identity, 93% coverage
TC 2.A.1.1.98 / Q9FRL3 Sugar transporter ERD6-like 6 from Arabidopsis thaliana (see 3 papers)
AT1G75220 integral membrane protein, putative from Arabidopsis thaliana
31% identity, 95% coverage
- substrates: Sugars
- Improving power of genome-wide association studies via transforming ordinal phenotypes into continuous phenotypes
Yang, Frontiers in plant science 2023 - “...2,3* sequence-specific DNA binding transcription factor activity AT2G18350 Glyma16g25310 # 29252235 pLARmEB 2,3* transmembrane transport AT1G75220 Glyma16g25320 # 29252235 pLARmEB 2,3* transmembrane transport AT1G75220 Glyma19g39270 46014852 FASTmrMLM 1* , pKWmEB 1* , pLARmEB 1* response to oxidative stress AT4G11290 Glyma19g39320 46014852 FASTmrMLM 1* , pKWmEB 1*...”
- Vacuolar Sugar Transporter TMT2 Plays Crucial Roles in Germination and Seedling Development in Arabidopsis
Cao, International journal of molecular sciences 2023 - “...(AT3G51490) , SAUR22 (AT5G18050) , SAUR23 (AT5G18060) , SAUR26 (AT3G03850) , SWEET2 (AT3G14770) , ERDL6 (AT1G75220) , DAO2 (AT1G14120) , PIN6 (AT1G77110) , CYP79B3 (AT2G22330) , TOR (AT1G50030) , KIN11 (AT3G29160) , E2F1 (AT5G22220) , ACTIN2 (AT3G18780) , ACTIN8 (AT1G49240) . Acknowledgments We are grateful to...”
- Responsiveness of Early Response to Dehydration Six-Like Transporter Genes to Water Deficit in Arabidopsis thaliana Leaves
Slawinski, Frontiers in plant science 2021 - “...stable during this process (Quirino et al., 2001 ). AtESL1.02/ERDL6 (early responsive to dehydration-like six At1g75220 ) is a vacuolar H + /glucose symporter involved in the export of glucose from the vacuole to cytosol (Klemens et al., 2014 ). This expression is regulated by the...”
- “...USA). Quantitative PCR Analysis The expression analysis of the 17 AtESL : AtESL1.01 (At1g19450), AtESL1.02/ERDL6 (At1g75220), AtESL2.01/ZIF2 (At2g48020), AtESL2.02 (At3g5150), and AtESL2.03 (At5g18840), AtESL3.01 (At1g54730), AtESL3.02 (At4g4750), AtESL3.03 (At4g04760), AtESL3.04 (At3g20460), AtESL3.05/ESL3 (At1g08890), AtESL3.06/ESL2 (At1g08900), AtESL3.07/ESL1 (At1g08920) , AtESL3.08/ERD6 (At1g08930) , AtESL3.10 (At3g05400), AtESL3.11 (At3g05160), AtESL3.13/SFP1...”
- Early Response to Dehydration Six-Like Transporter Family: Early Origin in Streptophytes and Evolution in Land Plants
Slawinski, Frontiers in plant science 2021 - “...into the vacuole (Remy et al., 2014 ). AtERDL6 (Early Responsive to Dehydration-Like six - At1g75220) is a tonoplastic H +g /glucose symporter involved in the export of glucose from the vacuole under the conditions that require the mobilization of vacuolar carbohydrate reserves. The expression of...”
- “...group Gene ID AtERD6-Llke x New names ESL1 B1a At1g19450 AtERD6-Like 4 ESL1.01 ESL1 B1b At1g75220 AtERD6-Like 6 ESL1.02/ERDL6 ESL2a B2 At2g48020 AtERD6-Like 7 ESL2.01/ZIF2 ESL2a B3 At3g05150 AtERD6-Like 8 ESL2.02 ESL2b B4 At5g18340 AtERD6-Like 16 ESL2.03 ESL3a B5 At1g54730 AtERD6-Like 5 ESL3.01 ESL3b B6a At4g04750...”
- Shotgun proteomics of peach fruit reveals major metabolic pathways associated to ripening
Nilo-Poyanco, BMC genomics 2021 - “...GLUCOSE-1-PHOSPHATE ADENYLYLTRANSFERASE LARGE SUBUNIT 2, CHLOROPLASTIC AT1G27680 Prupe.1G378500 0.998 2 Up_O1 SUGAR TRANSPORTER ERD6-LIKE 4-RELATED AT1G75220 Carbohydrates/Energy Metabolism Prupe.4G124500 0.998 2 Qualit_O1 Isocitrate dehydrogenase [NADP] AT1G54340 Prupe.3G288200 0.15 0 Up_O1 ISOCITRATE DEHYDROGENASE [NADP], CHLOROPLASTIC/MITOCHONDRIAL AT5G14590 Carbohydrates Metabolism/Redox Metabolism Prupe.2G091600 0.5 1 Up_O1 Malate dehydrogenase (NADP(+)) /...”
- Large-Scale Phosphoproteomic Study of Arabidopsis Membrane Proteins Reveals Early Signaling Events in Response to Cold
Kamal, International journal of molecular sciences 2020 - “...E,A * AT4G35300 TMT2 tonoplast monosaccharide transporter2 V,PM Solute transport HGS[+80]TMSR S 287 D * AT1G75220 ERDL6 Major facilitator superfamily protein V,PM Solute transport RPFIHTGS[+80]WYR S 23 D * AT2G18960 AHA1 H[+]-ATPase 1 PM Solute transport T[+80]LHGLQPKEDVNIFPEKGSYR T 881 D * AT2G18960 AHA1 H[+]-ATPase 1 PM...”
- A Genomic and Transcriptomic Overview of MATE, ABC, and MFS Transporters in Citrus sinensis Interaction with Xanthomonas citri subsp. citri
Julião, Plants (Basel, Switzerland) 2020 - “...ABC G Pistacia vera ABC G32 At2g26910 Cs3g24900 XP_006473508.3 STP Pyrus x bretschneideri ERD6-like 6 At1g75220 Limit a sugar source of Xanthomonas citri subsp. citri Cs1g24180 KDO79562.1 STP Durio zibethinus ERD6-like 6 At1g69650 Cs5g32060 XP_006479807.1 STP Pistacia vera ERD6-like 7 At2g45820...”
- Greenbug (Schizaphis graminum) herbivory significantly impacts protein and phosphorylation abundance in switchgrass (Panicum virgatum)
Zogli, Scientific reports 2020 - “...S EEEKKAEEALEAAAGDEAAVIDGAGSFK DEGs-up DPs-up Pavir.3KG261700 AT4G15530 Pyruvate orthophosphate dikinase 1 S DFEGIFR DEG-down DPs-down Pavir.3KG310400 AT1G75220 Major facilitator superfamily protein AGGAGYE S GSDHDGALQKPLLPNSGSWYR DEG-down DPs-down Pavir.3KG402302 AT1G15140 FAD/NAD(P)-binding oxidoreductase VVQLTQQFQQ S FLEQNLGEK DEG-down DPs-up Pavir.3NG065800 AT1G75240 Homeobox protein 33 VHLVGDPEHLGQLGGGMPLPEPGGPGR S P S PSR S PPPQQLR...”
- More
- Mutations in SLC2A2 gene reveal hGLUT2 function in pancreatic β cell development
Michau, The Journal of biological chemistry 2013 - “...P32465 for yeast (Saccharomyces cerevisiae) HXT1; and Q9FRL3 for plant (Arabidopsis thaliana) sugar transporter protein STP1. Molecular Biology--Human SLC2A2...”
SE0247 bicyclomycin resistance protein TcaB from Staphylococcus epidermidis ATCC 12228
32% identity, 81% coverage
GLCP_STAES / A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
SERP_RS11465 sugar porter family MFS transporter from Staphylococcus epidermidis RP62A
32% identity, 81% coverage
XNR_0140 sugar porter family MFS transporter from Streptomyces albidoflavus
33% identity, 94% coverage
- Insights into naturally minimised Streptomyces albus J1074 genome
Zaburannyi, BMC genomics 2014 - “...36 ]. Genes are present for efflux proteins for daunorubicin (XNR_2457-58, XNR_4042-43), camphor (XNR_2486-87), bicyclomycin (XNR_0140), tetracycline (XNR_3352) and one putative macrolide glycosyltransferase (XNR_4394). S. albus contains two genes for tryptophanyl-tRNA synthetase: XNR_3910 and XNR_3513, of which the latter is an ortholog of indolmycin-resistant Trp-synthetase from...”
Q93YP9 Sugar transporter ERD6-like 4 from Arabidopsis thaliana
AT1G19450 integral membrane protein, putative / sugar transporter family protein from Arabidopsis thaliana
33% identity, 93% coverage
- Identification of MAMP-Responsive Plasma Membrane-Associated Proteins in Arabidopsis thaliana Following Challenge with Different LPS Chemotypes from Xanthomonas campestris
Hussan, Pathogens (Basel, Switzerland) 2020 - “...protein F4KEA0 Hypersensitive-induced response protein 4 Q9FHM7 Ras-related protein RABG3a Q948K8 Sugar transporter ERD6-like 4 Q93YP9 Nuclear transport factor 2 (NTF2) family protein Q9FMC7 Plasma-membrane associated cation-binding protein 1 F4JUT9 V-type proton ATPase subunit G1 O82628 Patellin-3 Q56Z59 ATPase 11 Q9LV11 Calcium-transporting ATPase 10 Q9SZR1 ABC-2...”
- “...transporter 13 Q8LPL8 Putative ion channel POLLUX-like 1 Q8VZM7 Syntaxin-132 Q8VZU2 Sugar transporter ERD6-like 4 Q93YP9 Potassium transporter 7 Q9FY75 Calcium-transporting ATPase 8 Q9LF79 Novel plant SNARE 13 Q9LRP1 ATPase 11 Q9LV11 Alpha-soluble NSF attachment protein 2 Q9SPE6 Calcium-transporting ATPase 10 Q9SZR1 Probable aquaporin PIP2-6 Q9ZV07...”
- Transcriptome characteristics during cell wall formation of endosperm cellularization and embryo differentiation in Arabidopsis
Li, Frontiers in plant science 2022 - “..., SWEET11 , and SWEET15 in 3-5W were upregulated, and sucrose metabolism genes such as AT1G19450 , SFP1 , and SPS3 were also upregulated. However, their roles in seed development remain unclear. The starch and sucrose pathway was also significantly enriched using KEGG analysis in naa15...”
- Outlier analyses and genome-wide association study identify glgC and ERD6-like 4 as candidate genes for foliar water-soluble carbohydrate accumulation in Trifolium repens
Pearson, Frontiers in plant science 2022 - “...clover homologue of early responsive to dehydration ( ERD ) monosaccharide vacuole transporter, ERD6-like 4 (At1g19450), was physically associated with SNP 16_32428574, detected in both the WNZLL and FNZSL pools. ERD6 -like transporters are involved in energy-independent sugar efflux from the vacuole ( Wei etal., 2014...”
- Early Response to Dehydration Six-Like Transporter Family: Early Origin in Streptophytes and Evolution in Land Plants
Slawinski, Frontiers in plant science 2021 - “...ESL ) genes. ESL group Brassicaceae group Gene ID AtERD6-Llke x New names ESL1 B1a At1g19450 AtERD6-Like 4 ESL1.01 ESL1 B1b At1g75220 AtERD6-Like 6 ESL1.02/ERDL6 ESL2a B2 At2g48020 AtERD6-Like 7 ESL2.01/ZIF2 ESL2a B3 At3g05150 AtERD6-Like 8 ESL2.02 ESL2b B4 At5g18340 AtERD6-Like 16 ESL2.03 ESL3a B5 At1g54730...”
- Responsiveness of Early Response to Dehydration Six-Like Transporter Genes to Water Deficit in Arabidopsis thaliana Leaves
Slawinski, Frontiers in plant science 2021 - “...Madison, WI, USA). Quantitative PCR Analysis The expression analysis of the 17 AtESL : AtESL1.01 (At1g19450), AtESL1.02/ERDL6 (At1g75220), AtESL2.01/ZIF2 (At2g48020), AtESL2.02 (At3g5150), and AtESL2.03 (At5g18840), AtESL3.01 (At1g54730), AtESL3.02 (At4g4750), AtESL3.03 (At4g04760), AtESL3.04 (At3g20460), AtESL3.05/ESL3 (At1g08890), AtESL3.06/ESL2 (At1g08900), AtESL3.07/ESL1 (At1g08920) , AtESL3.08/ERD6 (At1g08930) , AtESL3.10 (At3g05400), AtESL3.11...”
- Dissecting the subcellular membrane proteome reveals enrichment of H+ (co-)transporters and vesicle trafficking proteins in acidic zones of Chara internodal cells
Pertl-Obermeyer, PloS one 2018 - “...117 at3g01280 M 34.2 transport.sugars 157 77 80 major facilitator superfamily protein 10 5 5 at1g19450 V major facilitator superfamily protein 39 19 20 at5g59250 P major facilitator superfamily protein 1 1 0 at5g64500 V oligosaccharyltransferase/magnesium transporter protein 10 6 4 at1g61790 ER plastidic glucose translocator...”
- Quantitation of Vacuolar Sugar Transporter Abundance Changes Using QconCAT Synthtetic Peptides
Pertl-Obermeyer, Frontiers in plant science 2016 - “...5 ). Thereby, in some cases, such as for high abundant proteins AVP1 (AT1G15690), ERDL4 (AT1G19450) and COPT5 (AT5G20650), the endogenous peptides (L) was in all cases more abundant than the spiked in standards (H) leading to large L/H ratios across conditions. In other cases, such...”
- “...and large increases in abundance were observed also for ERDL7 (AT2G48020) and TMT2 (AT4G35300). ERDL4 (AT1G19450) and ENT1 (AT1G70330) were the only sugar transporter for which no significant change in abundance was measured under salt stress. Under drought stress, for most proteins a mild decrease in...”
- Expression profiling of tomato pre-abscission pedicels provides insights into abscission zone properties including competence to respond to abscission signals
Nakano, BMC plant biology 2013 - “...A_96_P144011 AW030712 AT3G63200 PLP9 (PATATIN-LIKE PROTEIN 9) 1.6 0.031 2.7 0.005 Transporter/Channel Solyc02g085170 A_96_P127407 TA56865_4081 AT1G19450 integral membrane protein, putative / sugar transporter family protein 3.8 0.014 4.1 0.016 Solyc01g103030 A_96_P114407 AK325211 AT1G59740 proton-dependent oligopeptide transport (POT) family protein 1.9 0.023 2.0 0.034 Solyc10g084950 a A_96_P231269...”
- Conserved versatile master regulators in signalling pathways in response to stress in plants
Balderas-Hernández, AoB PLANTS 2013 - “...AT1G07310 837242 Calcium-dependent lipid-binding domain GDU4 817013 Glutamine dumper 4 ATERDJ2A 844334 Translocation protein SEC63 AT1G19450 8838529 Sugar transporter ERD6-like 4 CNGC18 831339 Cyclic nucleotide-gated channel 18 These results indicate the importance of SNRK as a sensor and master regulator of the energetic and metabolic status...”
- More
AFE_2312, AFE_RS10630 sugar porter family MFS transporter from Acidithiobacillus ferrooxidans ATCC 23270
32% identity, 90% coverage
- Characterize the Growth and Metabolism of <i>Acidithiobacillus ferrooxidans</i> under Electroautotrophic and Chemoautotrophic Conditions
Wang, Microorganisms 2024 - “...protein 1.66 novel0005 - MULTISPECIES: ferredoxin family protein 1.57 AFE_RS09710 AFE_RS09710 ABC-2 transporter permease 1.49 AFE_RS10630 AFE_RS10630 sugar porter family MFS transporter 1.28 AFE_RS13730 AFE_RS13730 peptide ABC transporter substrate-binding protein 1.19...”
- Enhancement Mechanism of Stibnite Dissolution Mediated by Acidithiobacillus ferrooxidans under Extremely Acidic Condition
Wang, International journal of molecular sciences 2022 - “...AFE_1652 (encoding oxidoreductase alpha subunit), AFE_1651 (encoding 3-hydroxyisobutyrate dehydrogenase family protein), AFE_1589 (encoding DNA-damage-inducible protein), AFE_2312 (encoding Major facilitator superfamily (MFS) transporter), AFE_1636 (encoding hypothetical protein). These up-regulated genes are mainly annotated as the function of metabolic process, cellular process, binding, catalytic activity, transporter activity, molecular...”
- “...transfer in the biotransformation of Sb (III) in the presence of trace iron. In addition, AFE_2312 is very similar to xylose and galactose proton symporters, which is proposed to be related to the MFS transporter superfamily contributing to the carbohydrate transporter of the outer membrane [...”
Q688W0 Os05g0567800 protein from Oryza sativa subsp. japonica
32% identity, 90% coverage
DV527_RS12535 sugar porter family MFS transporter from Staphylococcus saprophyticus
33% identity, 80% coverage
DB43_AL00090 sugar porter family MFS transporter from Parachlamydia acanthamoebae
32% identity, 90% coverage
- A Genomic and Transcriptomic Overview of MATE, ABC, and MFS Transporters in Citrus sinensis Interaction with Xanthomonas citri subsp. citri
Julião, Plants (Basel, Switzerland) 2020 - “...MAFFT version 7.4 [ 81 ], with standard parameters. The outgroup sequences AK812_OLP99436, AK812_OLP95568, and DB43_AL00090, were retrieved from HMMER Ensembl Genomes. The best-of-fit model LG+G+F [ 82 ] was estimated for both ABC and MFS datasets, while WAG+G+F [ 83 ] for the MATE dataset...”
- “...Citrus spp. identified in the citrus reference transcriptome. Numbers above the branches represent bootstrap values. DB43_AL00090 was used as outgroup ( Parachlamydia acanthamoebae , gene ywtG, putative metabolite transport protein YwtG), Figure S3: Maximum likelihood tree of MFS amino acid sequences expressed by Citrus spp. identified...”
LOC100801076 sugar transporter ERD6-like 6 from Glycine max
32% identity, 92% coverage
XP_011536149 proton myo-inositol cotransporter isoform X1 from Homo sapiens
30% identity, 76% coverage
- The genetic variants in calcium signaling related genes influence anti-tuberculosis drug induced liver injury: A prospective study.
Lyu, Medicine 2019 - GeneRIF: Our study revealed that both BDKRB2 and TENM2 genetic polymorphisms were interrogated in relation to anti-tuberculosis drug induced liver injury (ATDILI) susceptibility and some laboratory indicators in the Western Chinese Han population, shedding a new light on exploring novel biomarkers and targets for ATDILI.
- Proton myo-inositol cotransporter is a novel γ-secretase associated protein that regulates Aβ production without affecting Notch cleavage.
Teranishi, The FEBS journal 2015 (PubMed)- GeneRIF: SLC2A13 is a novel gamma-secretase associated protein that regulates amyloid beta production without affecting Notch cleavage.
- Identification of genes associated with non-small-cell lung cancer promotion and progression.
Bankovic, Lung cancer (Amsterdam, Netherlands) 2010 (PubMed)- GeneRIF: genetic alterations of TSPAN14, SLC2A13 and PHF20 could play a role in non-small-cell lung cancer promotion
- Evaluation of expression and function of the H+/myo-inositol transporter HMIT.
Di, BMC cell biology 2009 - GeneRIF: HMIT is primarily a neuronal transporter widely expressed in the rat and human brain, with particularly high levels in the hippocampus and cortex, as shown by immunohistochemistry.
- Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
Rose, Molecular medicine (Cambridge, Mass.) - GeneRIF: Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
- The Solute Carrier Family 2 Genes Are Potential Prognostic Biomarkers in Acute Myeloid Leukemia.
Lai, Technology in cancer research & treatment - GeneRIF: The Solute Carrier Family 2 Genes Are Potential Prognostic Biomarkers in Acute Myeloid Leukemia.
LOC18046355 sugar transporter ERD6-like 7 from Citrus x clementina
30% identity, 94% coverage
HAH_5129 sugar porter family MFS transporter from Haloarcula hispanica ATCC 33960
31% identity, 76% coverage
- A conserved transcription factor controls gluconeogenesis via distinct targets in hypersaline-adapted archaea with diverse metabolic capabilities
Hackley, PLoS genetics 2024 - “...4 * 92.46 yes promoter HAH_4332 gdh glucose dehydrogenase 5 * 85.71 5.96 yes promoter HAH_5129 4.72 sugar porter family MFS transporter 6 * 49.84 4.46 yes promoter promoter HAH_1365 HAH_1366 porA flavodoxin reductase family I pyruvate:ferredoxin oxidoreductase 7 * 47.56 yes promoter HAH_0887 cysK -1.36...”
- “...5 , hypergeometric test). Notably, the second largest peak is located in the promoter of HAH_5129, a sugar major facilitator superfamily (MFS) transporter (PF00083, e-value < 3.0 10 123 ), highlighting this gene as a candidate for the primary glucose transporter in Har. hispanica . Computational...”
Ot03g05590 Major facilitator superfamily domain, general substrate transporter from Ostreococcus tauri
31% identity, 91% coverage
- Microarray data can predict diurnal changes of starch content in the picoalga Ostreococcus
Sorokina, BMC systems biology 2011 - “...Ot01g03030 2.7.9.4 -glucan, water dikinase (GWD) SR1-A x Ot13g01510 R1 C Ot16g02370 Ot04g04170 Glucose transporter Ot03g05590 Glucose transporter Ot14g01870 Glucose transporter Ot08g01260 Maltose transporter MEX1 x Ot09g03160 Transcripts encoding starch metabolizing enzymes in O. tauri show distinctive diurnal patterns We used microarrays to obtain the expression...”
YB91_YEAST / P38142 Probable metabolite transport protein YBR241C from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
TC 2.A.1.1.96 / P38142 Probable metabolite transport protein YBR241C from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (see 4 papers)
YBR241C Putative transporter, member of the sugar porter family; green fluorescent protein (GFP)-fusion protein localizes to the vacuolar membrane; YBR241C is not an essential gene from Saccharomyces cerevisiae
29% identity, 92% coverage
- substrates: Metabolites
- Remodeling of yeast vacuole membrane lipidomes from the log (one phase) to stationary stage (two phases)
Reinhard, Biophysical journal 2023 (secret) - Identification of Genetic Modifiers of TDP-43: Inflammatory Activation of Astrocytes for Neuroinflammation
Kim, Cells 2021 - “...60S ribosomal protein L7-B RPL7 12 YPL101W ELP4 Q02884 Elongator complex protein 4 ELP4 13 YBR241C YBR241C P38142 Probable metabolite transport protein YBR241C SLC2A1 14 YEL024W RIP1 P08067 Cytochrome b-c1 complex subunit Rieske, mitochondrial UQCRFS1 15 YEL053C MAK10 Q02197 N-alpha-acetyltransferase 35, NatC auxiliary subunit NAA35 16...”
- Oxidative Stress Responses and Nutrient Starvation in MCHM Treated Saccharomyces cerevisiae
Ayers, G3 (Bethesda, Md.) 2020 - “...of rDNA: RRN10 Ion Transporter/Metal Homeostasis: PHO84 Miscellaneous Function: MOG1 Miscellaneous Function: XYL2 BUD30 VVS1 (YBR241C) GUA1 TVS1 (YCR061W) PRM7 YHI9 SAM1 The other major insight of the combined screen and upregulation datasets is the presence of several amino acid biosynthetic genes. Many of these genes...”
- “...and required for MCHM responses Of note in the combined datasets is the requirement of YBR241c for tolerance to MCHM ( Table 1 ). Ybr241c is a paralog of the vacuolar sorting protein, Vps73 , and is localized to the vacuolar membrane ( Matsumoto et al....”
- Vacuolar hydrolysis and efflux: current knowledge and unanswered questions
Parzych, Autophagy 2019 - “...unclear, as no vacuolar hexose exporter has been identified. Ybr241c may be worth investigating in this regard, as it is a putative transporter of the sugar...”
- Pichia pastoris regulates its gene-specific response to different carbon sources at the transcriptional, rather than the translational, level
Prielhofer, BMC genomics 2015 - “...Major facilitator superfamily, Quinate permease (Quinate transporter) - similar to S. stipitis 0.06 0.80 0.01 YBR241C Putative transporter, member of the sugar porter family 0.12 0.16 0.26 Pp HXT2 P. pastoris putative low affinity glucose transporter of the major facilitator superfamily 0.10 0.10 0.09 STL1-1 Glycerol...”
- The human synaptic vesicle protein, SV2A, functions as a galactose transporter in Saccharomyces cerevisiae
Madeo, The Journal of biological chemistry 2014 - “...HXT7 HXT6 HXT10 YDR387c HXT2 AQR1 QDR2 HXT4 HXT8 YBR241C QDR1 HXT11 STL1 HXT9 SR077 SGE1 HXT12 YDL199c TPO1 QDR3 TPO3 MCH5 TPO2 REPORT: Synaptic Vesicle...”
- Genome sequencing of four Aureobasidium pullulans varieties: biotechnological potential, stress tolerance, and description of new species
Gostinčar, BMC genomics 2014 - “...protein sorting-associated protein 73 or 1 1 1 1 3 2.A.1.1.96 Probable metabolite transport protein YBR241C or 2.A.1.1.100 Probable metabolite transport protein YFL040W 2.A.1.12 The sialate: H + symporter family 1 1 1 1 1 2.A.1.12.2 Lactate/pyruvate: H + symporter 1 1 1 1 1 2.A.2...”
- Genome-wide expression profiling of the response to short-term exposure to fluconazole in Cryptococcus neoformans serotype A
Florio, BMC microbiology 2011 - “...2.15 04617 OPT2 Small oligopeptide transporter + 2.11 05592 PMR1 Calcium-transporting ATPase + 2.06 01059 YBR241C Vacuolar membrane protein + 2.02 00904 AZR1 Aflatoxin efflux pump AFLT - 2.10 01769 AGC1 Mitochondrial inner membrane protein - 2.16 04142 FEN2 Tartrate transporter - 2.17 04567 TPO2 Drug...”
- More
- Identification of Genetic Modifiers of TDP-43: Inflammatory Activation of Astrocytes for Neuroinflammation
Kim, Cells 2021 - “...protein L7-B RPL7 12 YPL101W ELP4 Q02884 Elongator complex protein 4 ELP4 13 YBR241C YBR241C P38142 Probable metabolite transport protein YBR241C SLC2A1 14 YEL024W RIP1 P08067 Cytochrome b-c1 complex subunit Rieske, mitochondrial UQCRFS1 15 YEL053C MAK10 Q02197 N-alpha-acetyltransferase 35, NatC auxiliary subunit NAA35 16 YHR161C YAP1801...”
- Major facilitator superfamily
Pao, Microbiology and molecular biology reviews : MMBR 1998 - “...P30605 X98622 P30606 S51081 P07921 P38156 P15685 P18631 X96876 Q10710 P38142 S58778 U32274 P43562 Z72626 P40441 P47186 P10870 P39932 GB SP GB SP SP SP SP SP SP...”
LOC123092952 sugar transport protein MST4 from Triticum aestivum
30% identity, 89% coverage
- Expression Profiling of the Slow Rusting Resistance Genes Lr34/Yr18 and Lr67/Yr46 in Common Wheat (Triticum aestivum L.) and Associated miRNAs Patterns
Spychała, Genes 2023 - “...genes three very similar duplicates were identified in common wheat genome (LOC123169079, LOC123087958, LOC123152986 and LOC123092952, LOC123098224, LOC123085159, respectively); therefore, universal primers were designed, amplifying studied genes together with other similar homologs ( Table 1 ). For each primer pair (i.e., each gene), a PCR with...”
LOC123098224 sugar transport protein MST4-like from Triticum aestivum
30% identity, 89% coverage
- Expression Profiling of the Slow Rusting Resistance Genes Lr34/Yr18 and Lr67/Yr46 in Common Wheat (Triticum aestivum L.) and Associated miRNAs Patterns
Spychała, Genes 2023 - “...three very similar duplicates were identified in common wheat genome (LOC123169079, LOC123087958, LOC123152986 and LOC123092952, LOC123098224, LOC123085159, respectively); therefore, universal primers were designed, amplifying studied genes together with other similar homologs ( Table 1 ). For each primer pair (i.e., each gene), a PCR with gradient...”
LLKF_1623 D-xylose-proton symporter from Lactococcus lactis subsp. lactis KF147
30% identity, 95% coverage
BT_0794 D-xylose transporter XylE from Bacteroides thetaiotaomicron VPI-5482
BT0794 D-xylose-proton symporter (D-xylose transporter) from Bacteroides thetaiotaomicron VPI-5482
30% identity, 92% coverage
- An expanded transcriptome atlas for Bacteroides thetaiotaomicron reveals a small RNA that modulates tetracycline sensitivity
Ryan, Nature microbiology 2024 - “...indicated. i , Xylose vs. glucose. Genes belonging to the xylose utilization operon BT_0791 - BT_0794 (Ref. 13 ) are indicated. j , Maltose vs. glucose. Genes belonging to the starch utilization system ( sus ) operon BT_3704 - BT_3698 (Refs. 72 , 73 ) are...”
- Functional genetics of human gut commensal Bacteroides thetaiotaomicron reveals metabolic requirements for growth across environments
Liu, Cell reports 2021 - “...most amino acids. Genes from the xylose utilization pathway (BT0792, xylulose kinase; BT0793, xylose isomerase; BT0794, xylose transporter) were important for growth on xylose only ( Figure 1B ). This example illustrates the biological consistency of fitness assays using our mutant library. To create a gene-phenotype...”
- A Master Regulator of Bacteroides thetaiotaomicron Gut Colonization Controls Carbohydrate Utilization and an Alternative Protein Synthesis Factor
Townsend, mBio 2020 - “...glucuronate utilization genes ( BT1434 to BT1432 ) (D), xylose utilization genes ( BT0791 to BT0794 ) (E), the alanine dehydrogenase gene ( BT1554 ) (F), rnfABCDEF (G), and fusA2 ( BT2167 ) (H). Black represents the input DNA, and red represents the immunoprecipitated DNA. Data...”
- “...(arabinose utilization), BT1272 to BT1277 (fucose utilization), BT1434 to BT1432 (glucuronate utilization), and BT0791 to BT0794 (xylose utilization), as well as BT2818 to BT2825 , BT0453 to BT0449 , BT0439 to BT0443 , and BT4299 to BT4295 , which are predicted to mediate polysaccharide utilization (...”
LOC123085159 sugar transport protein MST4-like from Triticum aestivum
30% identity, 89% coverage
- Expression Profiling of the Slow Rusting Resistance Genes Lr34/Yr18 and Lr67/Yr46 in Common Wheat (Triticum aestivum L.) and Associated miRNAs Patterns
Spychała, Genes 2023 - “...very similar duplicates were identified in common wheat genome (LOC123169079, LOC123087958, LOC123152986 and LOC123092952, LOC123098224, LOC123085159, respectively); therefore, universal primers were designed, amplifying studied genes together with other similar homologs ( Table 1 ). For each primer pair (i.e., each gene), a PCR with gradient of...”
B6TZY0 Solute carrier family 2, facilitated glucose transporter member 8 from Zea mays
30% identity, 93% coverage
- Key factors identified by proteomic analysis in maize (Zea mays L.) seedlings' response to long-term exposure to different phosphate levels
Sun, Proteome science 2018 - “...0.83 K7TK04 Carbohydrate transporter/ sugar porter 4.655 0.61 A0A1D6EP34 Sugar transport protein 14 1.4 0.78 B6TZY0 Facilitated glucose transporter member 8 1.38 0.77 ABC transporters A0A1D6NEN5 ABC transporter B family member 9 1.29 1.72 0.79 B4FBM3 ABC transporter G family member 6 1.31 0.82 Other transporters...”
- “...carbohydrate transporters, C0PHL2 (monosaccharide transporter1), K7TK04 (carbohydrate transporter/sugar porter), A0A1D6EP34 (sugar transport protein 14) and B6TZY0 (facilitated glucose transporter member 8), were increased under LP condition but suppressed under HP condition in the leaves or roots, indicating that these transporters regulated sugar metabolism when maize seedlings...”
PITG_13001 glucose transporter, putative from Phytophthora infestans T30-4
30% identity, 90% coverage
XylE / b4031 D-xylose:H+ symporter from Escherichia coli K-12 substr. MG1655 (see 7 papers)
xylE / P0AGF4 D-xylose:H+ symporter from Escherichia coli (strain K12) (see 8 papers)
XYLE_ECOLI / P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
TC 2.A.1.1.3 / P0AGF4 Xylose (xylopyranose):H+ symporter of 491 aas and 12 TMSs from Escherichia coli (see 7 papers)
xylE D-xylose-proton symporter from Escherichia coli K12 (see 7 papers)
NP_418455 D-xylose:H(+) symporter from Escherichia coli str. K-12 substr. MG1655
b4031 D-xylose transporter from Escherichia coli str. K-12 substr. MG1655
EcolC_3998 sugar transporter from Escherichia coli C str. ATCC 8739
30% identity, 96% coverage
- function: Uptake of D-xylose across the boundary membrane with the concomitant transport of protons into the cell (symport system). Glucose is not transported, but can compete for xylose binding sites and can inhibit xylose transport (in vitro).
catalytic activity: D-xylose(in) + H(+)(in) = D-xylose(out) + H(+)(out) (RHEA:28959) - substrates: H+, Xylose
tcdb comment: Also transports and binds D-glucose and 6-bromo-6-deoxy-D-glucose. The 3-d structure is known in three conformers, outward occluded, inward occluded and inward open (Sun et al. 2012: Quistgaard et al. 2013). Most of the sugar-binding residues are conserved with the human Glut-1, 2, 3 and 4 homologues. The coalescence of intramolecular tunnels and cavities has been postulated to account for facilitated diffusion of sugars Quistgaard et al. 2013). Most of the sugar-binding residues are conserved with the human Glut-1, 2, 3 and 4 homologues. The coalescence of intramolecular tunnels and cavities has been postulated to account for facilitated diffusion of sugars (Cunningham and Naftalin 2014) - Utilization of AlphaFold2 to Predict MFS Protein Conformations after Selective Mutation
Xiao, International journal of molecular sciences 2022 - “...from Prediction and Experiment To date, several structures of MFS proteins (UniProt ID: P0AA76, P0AEY8, P0AGF4, P02920, Q6MLJ0, and Q9LT15) have been found in both the outward- and inward-opening conformations [ 9 , 10 , 11 , 12 , 30 , 31 , 32 , 33...”
- “...6E9O) for P0AA76, 1.01 (inward, PDB ID: 4QIQ) and 0.42 (outward, PDB ID: 4GBY) for P0AGF4, 1.12 (inward, PDB ID: 1PV6) and 0.56 (outward, PDB ID: 5GXB) for P02920, 0.71 (inward, PDB ID: 5AYO) and 0.83 (outward, PDB ID: 5AYM) for Q6MLJ0, 0.88 (inward, PDB ID:...”
- Evolutionary balance between foldability and functionality of a glucose transporter
Choi, Nature chemical biology 2022 - “...sapiens Solute carrier family 2 facilitated glucose transporter member 3 (P11169), Escherichia coli D-xylose-proton symporter (P0AGF4), Plasmodium falciparum Hexose transporter 1 (O97467), Staphylococcus epidermidis Glucose transporter (A0A0H2VG78) and Arabidopsis thaliana Sugar transport protein 10 (Q9LT15). The PDB accession number for structures for these reference proteins are...”
- “...4ZWC, 4ZW9, 4GBZ, 6RW3, 4LDS and 6H7D). Also, The following UniProt IDs were used (P11169, P0AGF4, O97467, A0A0H2VG78 and Q9LT15). Code availability A program, written in LabView, to control the magnetic tweezers apparatus has been deposited in Github ( https://github.com/tyyoonlab/Science_aaw8208 ) and is available at Zenodo...”
- Contribution of Stenotrophomonas maltophilia MfsC transporter to protection against diamide and the regulation of its expression by the diamide responsive repressor DitR
Boonyakanog, PloS one 2022 - “...LacY (P02920), LmrP (Q48658), MdfA (P0AEY8), MdtG (P25744), MhpT (P77589), NorA (P0A0J7), TetA (P02981), XylE (P0AGF4), YicM (J7R7Q1). mfsC mutant is susceptible to diamide To evaluate the physiological function of mfsB and mfsC in S . maltophilia , the mfsB and mfsC mutants were constructed and...”
- Structural comparison of GLUT1 to GLUT3 reveal transport regulation mechanism in sugar porter family.
Custódio, Life science alliance 2021 - “...), rGLUT5 (UniProt P43427 ), bGLUT5 (UniProt P58353 ), atSTP10 (UniProt Q9LT15 ), XylE (UniProt P0AGF4 ), and GlcPse (UniProt A0A0H2VG78 ). Conserved residues are highlighted with gray-scale. Alpha helices as found in GLUT1 are represented above the sequence as colored tubes. Residues highlighted in blue...”
- “...of the GLUT1 bacterial homolog. Sequence alignment between GLUT3 (UniProt P11169 ) and XylE (UniProt P0AGF4 ) of the C-domain A motif and the C-domain SP motif. Conserved residues are highlighted in bold. The residues belonging to the A motif and the SP motif are colored...”
- Proton-solute coupling mechanism of the maltose transporter from Saccharomyces cerevisiae
Henderson, Scientific reports 2017 - “...46 . Transporter sequences were found with the following UniProt accession numbers: Mal11 (P54038), XylE (P0AGF4), LacY (P02920), MelB (P02921), GLUT1 (P11166), GLUT3 (P11169). Mal11 structural modeling De novo structure prediction using evolutionary co-variation of residue pairs was performed with the EVfold server 16 , 17...”
- A Numbering System for MFS Transporter Proteins.
Lee, Frontiers in molecular biosciences 2016 - “...Into cell Arabidopsis thaliana NarU NNP P37758 Nitrate/nitrite symport Into cell E. coli XylE SP P0AGF4 Xylose/H + symport Into cell E. coli MelB Glycoside-pentoside-hexuronide: cation symporter P30878 Melibose/Na + symport Into cell Salmonella typhimurium The cluster containing each protein sequence in UniRef50 was downloaded and...”
- Proton-coupled sugar transport in the prototypical major facilitator superfamily protein XylE
Wisedchaisri, Nature communications 2014 - “...list of homologues are as follows with Uniprot accession number in parentheses: Escherichia coli XylE (P0AGF4); Lactobacillus brevis D -xylose/H + symporter XylT (O52733); Escherichia coli galactose permease GalP (P0AEP1); Escherichia coli arabinose permease AraE (P0AE24); Bacillus subtilis myo-inositol/H + transporter IolT (O34718); Arabidopsis thaliana inositol/H...”
- Reptation-induced coalescence of tunnels and cavities in Escherichia Coli XylE transporter conformers accounts for facilitated diffusion
Cunningham, The Journal of membrane biology 2014 - “...conformer structures3a, 3b, 4a, 4b and 4c, the chains were restructured using the UniProt sequence P0AGF4 (XylE_ECOLI) in SwissModel Automatic Modelling Mode at http://swissmodel.expasy.org . These newer structures were superimposable on the originals and did not alter any of the docking positions or assigned affinities of...”
- More
- Hydrogen-deuterium exchange mass spectrometry captures distinct dynamics upon substrate and inhibitor binding to a transporter.
Jia, Nature communications 2020 - GeneRIF: Hydrogen-deuterium exchange mass spectrometry captures distinct dynamics upon substrate and inhibitor binding to a transporter.
- Molecular determinants for the thermodynamic and functional divergence of uniporter GLUT1 and proton symporter XylE.
Ke, PLoS computational biology 2017 - GeneRIF: The models and subsequent experimental validation suggest that multiple residue substitutions are required to produce the thermodynamic and functional distinction between XylE and GLUT1. Despite the lack of simulation studies with substrates, these computational and biochemical characterizations provide unprecedented insight into the mechanistic difference between proton symporters and uniporters.
- Affinity and path of binding xylopyranose unto E. coli xylose permease.
Wambo, Biochemical and biophysical research communications 2017 - GeneRIF: Molecular dynamics (MD) study of an all-atom model system to elucidate the atomistic details and the free-energy landscape along the path of binding a xylopyranose from the extracellular space to the inside of the transporter protein XylE. From the MD simulations, the Gibbs free energy of binding was found to be -4.4kcal/mol in agreement with the experimental value of -4.7kcal/mol.
- pH Regulation of Electrogenic Sugar/H+ Symport in MFS Sugar Permeases.
Bazzone, PloS one 2016 - GeneRIF: studies suggest that a single carboxyl group in LacY (Glu325) may be the only side chain directly involved in H+ translocation and a carboxyl side chain with similar properties has been identified in FucP (Asp46) and XylE (Asp27), the present results imply that the pK of this residue is switched during H+/sugar symport in all three symporters.
- Conserved movement of TMS11 between occluded conformations of LacY and XylE of the major facilitator superfamily suggests a similar hinge-like mechanism.
Västermark, Proteins 2015 - GeneRIF: Studied conformational states and homology of LacY and XylE.
- Proton-coupled sugar transport in the prototypical major facilitator superfamily protein XylE.
Wisedchaisri, Nature communications 2014 - GeneRIF: The movement of XylE is described that facilitates sugar translocation across a lipid membrane and identify the likely candidate proton-coupling residues as the conserved Asp27 and Arg133.
- Reptation-induced coalescence of tunnels and cavities in Escherichia Coli XylE transporter conformers accounts for facilitated diffusion.
Cunningham, The Journal of membrane biology 2014 - GeneRIF: This current model helps to unify the apparently opposing concepts of alternate access and multisite models of ligand transport.
- High-level intracellular expression of heterologous proteins in Brevibacillus choshinensis SP3 under the control of a xylose inducible promoter
D'Urzo, Microbial cell factories 2013 - “...the Brevibacillus brevis NBRC 100599 genome. The BLAST search using the E. coli XylE (GenBank: NP_418455) as input could only identify an alpha-ketoglutarate permease (YP_002770906) with low sequence identity with E. coli XylE (20% identity) and B. megaterium XylT (18,5% identity). The BLAST search using E....”
- More
- About the dark corners in the gene function space of Escherichia coli remaining without illumination by scientific literature
Tantoso, Biology direct 2023 - “...( arsR /GF_510), b3531 ( bcsZ /GF_9943), b3717 ( cbrC /GF_3491), b4011 ( yjaA /GF_20677), b4031 ( xylE /GF_10135), b4348 ( hsdS /GF_3705), and b4351 ( mrr /GF_10255). Similarly, 32 intensively studied GFs from the softcore genome do not contain an E. coli K-12 MG1655 homologue:...”
- Generation and Characterization of Acid Tolerant Fibrobacter succinogenes S85
Wu, Scientific reports 2017 - “...(b3685) 3 2230314 Fisuc_1804 xylE sugar transporter 205 C T 217 220 96.14 Ala69Thr JW3991 (b4031) 4 2399135 Fisuc_1945 rlmM ( ygdE ) DNA alkylation repair + 331 A G 199 199 94.12 Thr111Ala JW2777 (b2806) 5 2561445 Fisuc_2074 mscL Large conductance mechanosensitive channel protein. Critical...”
- Combined, functional genomic-biochemical approach to intermediary metabolism: interaction of acivicin, a glutamine amidotransferase inhibitor, with Escherichia coli K-12
Smulski, Journal of bacteriology 2001 - “...b0998 b3519 b1421 b1610 b3453 b1183 b3495 b1521 b0422 b4031 b2605 b3073 b3103 b3877 b0058 b0105 b0119 b0163 b0233 b0286 b0288 Fold induction 2.1 4.7 4.3 2.8...”
- A novel point mutation in RpoB improves osmotolerance and succinic acid production in Escherichia coli
Xiao, BMC biotechnology 2017 - “...(EcolC_1645, EcolC_1646, and EcolC_1647), mannose PTS (ManY: EcolC_1814 and ManZ: EcolC_1813), D-xylose proton symporter XylE (EcolC_3998), and the melibiose-sodium co-transport system (EcolC_3907) were decreased 2- to 5- fold in Suc-T110 when compared to the corresponding levels in RpoBD645Y. These data demonstrated that repression effects on sugar...”
AT1G54730 sugar transporter, putative from Arabidopsis thaliana
31% identity, 90% coverage
- The Arabidopsis U1 snRNP regulates mRNA 3'-end processing
Mangilet, Nature plants 2024 - “...snRNP conducts a distinct function (telescripting) compared with the U2 snRNP. In the case of AT1G54730 , pladienolide B or herboxidiene caused an increase in mRNAs containing the 5SS, but not in mRNAs containing the 3SS. These results suggest that for some introns, inhibiting splicing efficiency,...”
- Early Response to Dehydration Six-Like Transporter Family: Early Origin in Streptophytes and Evolution in Land Plants
Slawinski, Frontiers in plant science 2021 - “...ESL2.01/ZIF2 ESL2a B3 At3g05150 AtERD6-Like 8 ESL2.02 ESL2b B4 At5g18340 AtERD6-Like 16 ESL2.03 ESL3a B5 At1g54730 AtERD6-Like 5 ESL3.01 ESL3b B6a At4g04750 AtERD6-Like 14 ESL3.02 ESL3b B6b At4g04760 AtERD6-Like 15 ESL3.03 ESL3b B7 At3g20460 AtERD6-Like 13 ESL3.04 ESL3C B8a At1g08890 AtERD6-Like 1 ESL3.0S/ESL3 ESL3C B8b At1g08900...”
- Responsiveness of Early Response to Dehydration Six-Like Transporter Genes to Water Deficit in Arabidopsis thaliana Leaves
Slawinski, Frontiers in plant science 2021 - “...17 AtESL : AtESL1.01 (At1g19450), AtESL1.02/ERDL6 (At1g75220), AtESL2.01/ZIF2 (At2g48020), AtESL2.02 (At3g5150), and AtESL2.03 (At5g18840), AtESL3.01 (At1g54730), AtESL3.02 (At4g4750), AtESL3.03 (At4g04760), AtESL3.04 (At3g20460), AtESL3.05/ESL3 (At1g08890), AtESL3.06/ESL2 (At1g08900), AtESL3.07/ESL1 (At1g08920) , AtESL3.08/ERD6 (At1g08930) , AtESL3.10 (At3g05400), AtESL3.11 (At3g05160), AtESL3.13/SFP1 (At5g27350), and AtESL3.14/SFP2 (At5g27360) of other vacuolar SUTs: AtSWEET16...”
- Transcriptomic and proteomic approach to identify differentially expressed genes and proteins in Arabidopsis thaliana mutants lacking chloroplastic 1 and cytosolic FBPases reveals several levels of metabolic regulation
Soto-Suárez, BMC plant biology 2016 - “...up-regulated in cyfbp roots, whereas two monosaccharide transporters were down-regulated in this organ (At1g34580 and At1g54730) (Additional file 1 : Table S1 and Additional file 5 : Table S4). Validation of differentially expressed genes, using QRT-PCR To validate the cfbp1 and cyfbp microarray results, we performed...”
- Phylloxera (Daktulosphaira vitifoliae Fitch) alters the carbohydrate metabolism in root galls to allowing the compatible interaction with grapevine (Vitis ssp.) roots
Griesser, Plant science : an international journal of experimental plant biology 2015 - “...hexose transporter VvTMT2 (at4g35300) 0.32 0.0084 0.7 0.7 0.7 * TC118374 GSVIVT01022034001 ERD6-like transporter Vverd6-like5 (at1g54730) 0.36 0.0010 n.d. n.d. n.d. TC112781 f GSVIVT01022026001 ERD6-like transporter Vverd6-like3 (at1g08920) 0.86 4.52E05 n.d. n.d. n.d. TC110704 GSVIVT01011047001 ERD6-like transporter Vverd6-like7 (at2g48020) 0.56 0.0001 n.d. n.d. n.d. TC123985 GSVIVT01017836001...”
- Fusarium oxysporum f.sp. ciceri race 1 induced redox state alterations are coupled to downstream defense signaling in root tissues of chickpea (Cicer arietinum L.)
Gupta, PloS one 2013 - “...TRANSPORTERS ABC transporter like protein - - TC05017 AT2G34250 Substrate transporter (carbohydrate) - - TC16724 AT1G54730 Heavy metal transporter/ detoxyfying protein (FAR1 related sequence 6: FRS6) - - TC07483 AT1G52520 Translocase (chloroplast 34) - - TC14372 AT5G05000 Polyol transporter protein PLT PLT5 TC04362 AT3G18830 B. CELLULAR...”
- SUT Sucrose and MST Monosaccharide Transporter Inventory of the Selaginella Genome
Lalonde, Frontiers in plant science 2012 - “...The alleles of XP 001776003 (pGLT) and XP 00175457 (PLT) were not found . 4 AT1G54730 and AT3G05155 are not in the phylogenetic tree . Consistent with sugar alcohols being involved in resurrection, there are both inositol and polyol transporter homologs in Selaginella . All three...”
- Isolation and functional characterization of cold-regulated promoters, by digitally identifying peach fruit cold-induced genes from a large EST dataset
Tittarelli, BMC plant biology 2009 - “...protein; At1g08820 C208 9 2 GTP-binding secretory factor SAR1A; At4g02080 C235 5 4 Sugar transporter; At1g54730 C484 11 6 Porin; At5g67500 C1526 5 4 emp24/gp25L/p24 protein; At3g22845 Transport (GO:0006810) C2062 3 2 Ripening-responsive protein; At1g47530 C2236 3 2 Ras-related GTP-binding protein; At4g35860 C2476 9 1 Bet1...”
PITG_12998 Major Facilitator Superfamily (MFS) from Phytophthora infestans T30-4
30% identity, 93% coverage
AT1G05030 hexose transporter, putative from Arabidopsis thaliana
30% identity, 85% coverage
- Genetic association analysis in sugarcane (Saccharum spp.) for sucrose accumulation in humid environments in Colombia
Saavedra-Díaz, BMC plant biology 2024 - “...and monosaccharide transporters (MSTs) [ 69 ]. For early maturity, MST2, the plastidic glucose transporter At1g05030, and SUT4 were found within the LD region of the markers 1_33380771, 2_29103764, and 4_55115204, respectively (Table 5 ). At normal maturity, the candidate genes monosaccharide-sensing protein 2 MSSP2, polyol...”
- “...maturations, close to the candidate genes MST and ERD6-like respectively. The genes MST1, MST2, GTP2, At1g05030, and PLT5, are all directly involved in the transport of monosaccharides, required compounds for various processes of plant growth, development [ 68 ], and osmotic adjustments (e.g., monosaccharide homeostasis) [...”
- The novel chloroplast glucose transporter pGlcT2 affects adaptation to extended light periods
Valifard, The Journal of biological chemistry 2023 - “...( 3 ). The next homolog to pGlcT is the protein encoded by the gene At1g05030 . In contrast to pGlcT, no report on the protein encoded by the gene At1g05030 , hereafter referred to as pGlcT2, is available. However, an in-depth characterization of pGlcT2 properties...”
- “...). The structurally closest homolog to pGlcT is the putative carrier encoded by the gene At1g05030 , which we named pGlcT2 ( Fig.S1 ). The molecular architecture of pGlcT2 demonstrates that this protein is comprised of 524 amino acids and exhibits 12 predicted transmembrane domains (TM)...”
- Comparative transcriptome analysis reveals the phosphate starvation alleviation mechanism of phosphate accumulating Pseudomonas putida in Arabidopsis thaliana
Srivastava, Scientific reports 2023 - “...) were upregulated in both RAR and HA+RAR treatments. Genes associated with carbohydrate metabolism ( At1g05030 ), jasmonic acid LOX2 ( At3g45140 ), glutathione-s-transferase ( At5g17220 ), and ethylene biosynthesis ( At4g26200 ) showed upregulation in HA and HA+RAR treatment. However, these genes were either downregulated...”
- “...0.907445 1.36474 AT1G21250 WAK1 0.320022 3.180495 1.194565 AT3G45140 jasmonic acid (JA) LOX2 1.612366 1.81294 1.884971 AT1G05030 Carbohydrate metabolism 0.174888 0.33848 0.290582 AT1G06730 Plastid nucleoside kinase 0.123424 0.08761 0.056039 AT1G53730 STRUBBELIG-receptor family 6 0.025972 0.15064 0.160056 AT1G12890 Transcription factor 0.27459 1.217637 0.556539 AT1G01260 Transcription factor 0.140424 0.24861...”
- Genome-Wide Identification and Expression Profiling of Monosaccharide Transporter Genes Associated with High Harvest Index Values in Rapeseed (Brassica napus L.)
Zhang, Genes 2020 - “...whereas the three remaining AtMST genes ( At3G05160 , At1G08890 ( AtERD6-like subfamily ), and At1G05030 ( AtpGlcT subfamily )) lacked homologs in B. napus ( Table 2 ). Detailed information about the BnMST genes is provided in Table S3 . The molecular weights (Mw) of...”
- Gene expression profiling through microarray analysis in Arabidopsis thaliana colonized by Pseudomonas putida MTCC5279, a plant growth promoting rhizobacterium
Srivastava, Plant signaling & behavior 2012 - “...traits such as carbohydrate metabolism (At1g05030, 5.71-fold), nucleoside transferase (At1g63730, 6.59-fold), kinases (At1g06730, 5.32-fold; At1g53730,...”
- Reduced expression of a gene encoding a Golgi localized monosaccharide transporter (OsGMST1) confers hypersensitivity to salt in rice (Oryza sativa)
Cao, Journal of experimental botany 2011 - “...sequence is compared with OsMST1-8, Os09g23110, OspGlcT, and OsTMT1-4 from Oryza sativa , AtSGB1, At1g67300, At1g05030, and AtpGlcT from Arabidopsis thaliana , ScRGT2 from Saccharomyces cerevisiae , HsSLC2A3 from Homo sapiens , NtpGlcT from Nicotiana tabacum, and ZmpGlcT from Zea mays . (C) OsGMST1 is a...”
- “...shows that the putative Arabidopsis paralogues to OsGMST1 are encoded by At1g67300 , SGB1 , At1g05030 , and AtpGlcT and the proteins have 67%, 65%, 44%, and 43% identity to OsGMST1, respectively. These four MST proteins are in the pGlcT subfamily ( Buttner, 2007 ). SGB1...”
- Physical Mapping in a Triplicated Genome: Mapping the Downy Mildew Resistance Locus Pp523 in Brassica oleracea L
Carlier, G3 (Bethesda, Md.) 2011 - “...Not Seq PCR C5 53O21 At1g02660 NS PCR C8a 114F8 NS At1g06590 PCR C8a 19M3 At1g05030 At1g05230 Map F C5 6D7 NS At1g02270 Map F C8a 11A22 At1g06680 NS PCR C8a 89C6 At1g05577 At1g05690 PCR C5 92O1 NS At1g02990 PCR C8a 38E20 At1g06490 NS PCR C8a...”
- The Vitis vinifera sugar transporter gene family: phylogenetic overview and macroarray expression profiling
Afoufa-Bastien, BMC plant biology 2010 - “...putative transporters could be localized in Golgi apparatus. Finally Vv25939001 forms a third group with At1g05030. Search for cis -elements putatively involved in the transcriptional regulation of sugar transporter genes We have identified a 2 kb promoter region for each of the 29 fully sequenced genes...”
4gbyA / P0AGF4 The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
31% identity, 93% coverage
- Ligand: beta-d-xylopyranose (4gbyA)
CG6484 uncharacterized protein from Drosophila melanogaster
35% identity, 83% coverage
- split-intein Gal4 provides intersectional genetic labeling that is repressible by Gal80
Ewen-Campen, Proceedings of the National Academy of Sciences of the United States of America 2023 - “...to identify two pairs of genes which mark clusters from the FCA Gut atlas: CG13321 CG6484 to label enterocyte of anterior adult midgut epithelium, and CG14275 CG5404 to label hindgut. For each gene pair, we generated two separate drug resistance knock-in vectors, with one construct resistant...”
- “...a portion of the gut, anterior to the left. ( B ) Expression pattern of CG6484 -Gal4 N-int CG13321- Gal4 C-int in the adult gut, with anterior enterocyte regions A1-A3 ( 38 ) indicated with a bracket. Anterior is up. We injected a 1:1 mixture of...”
- Heat shock proteins and small nucleolar RNAs are dysregulated in a Drosophila model for feline hypertrophic cardiomyopathy
Tallo, G3 (Bethesda, Md.) 2021 - “...categories such as carbohydrate metabolic process ( Mal-A1 and Mal-A6 ), transmembrane transport ( CG17751, CG6484, CG16727 , and Mdr50 ), oxidation-reduction process ( Cyp6a21 ) and proteolysis ( Jon25Biii and ome ). In exercised females, clusters of genes were downregulated for R820W, but upregulated for...”
- Heritable shifts in redox metabolites during mitochondrial quiescence reprogramme progeny metabolism
Hocaoglu, Nature metabolism 2021 - “...( magro, CG6295, CG17192, CG9394, GLaz, CG8834 ), carbohydrate metabolism ( Mal-A6, Amy-d, Amy-p, Mal-A1, CG6484, CG4607 ) and nutrient transport ( CG32053, CG30272, CG8083, CG15096, Ocrt, CG2187 ). In fact when we examine the top 5 gene ontology terms enriched in the list include Proteolysis/protease/zymogen(FDR<...”
- Changes in Presynaptic Gene Expression during Homeostatic Compensation at a Central Synapse
Harrell, The Journal of neuroscience : the official journal of the Society for Neuroscience 2021 - “...1.2906 3.72E-07 1.61E-04 no functional information Ugt86De 477.43 1.2370 5.25E-07 2.17E-04 UDP glycosyl transferase b CG6484 322.18 1.2398 7.35E-07 2.90E-04 glucose import CheB93b 215.37 1.7419 1.21E-06 4.56E-04 pheromone detection CG7149 1784.54 0.9488 1.49E-06 5.42E-04 phosphotransferase CG31100 1430.28 1.0624 2.34E-06 8.16E-04 glucose import CG10433 1716.02 1.0842 2.70E-06...”
- Sex Differences in Intestinal Carbohydrate Metabolism Promote Food Intake and Sperm Maturation
Hudry, Cell 2019 - “...R4 enterocyte-specific knockdown of the following digestive enzymes and sugar transporter: Amy-p/Amy-d/Mal-A1 , Mal-A1 and CG6484 . For each genetic manipulation in this and all subsequent panels, the median number of sips was arbitrarily set up at 100% for control males, and percentage of that expression...”
- “...(M) fly following R2 and R5 enterocyte-specific knockdown of the Maltase-A1 ( Mal-A1 ) and CG6484 enzymes. Downregulation of intestinal sugar genes sugar genes in R2 and R5 does not affect male food intake. (B) Adult wing size quantifications (used as a measurement of body size,...”
- Ade2 Functions in the Drosophila Fat Body To Promote Sleep
Yurgel, G3 (Bethesda, Md.) 2018 - “...692.33 1.30 25.73 39.07 FBgn0029831 33932 CG5966 828.93 179.29 649.64 0.85 29.36 29.72 FBgn0034247 60372 CG6484 1200.00 477.00 707.00 1.09 17.40 75.96 FBgn0036030 60086 CG6767 1177.00 484.00 693.00 0.83 24.40 52.88 FBgn0033385 38305 CG8055 1043.24 367.65 675.59 0.85 27.41 39.16 FBgn0034003 57404 CG8094 963.13 300.94 662.19...”
- “...a loss of over 200 min of sleep, while a knockdown of the glucose transporter CG6484 ( CG-GAL4 > CG6484-RNAi ) and CG6767 , a kinase involved in purine/pyrimidine metabolism, ( CG-GAL4 > CG6767-RNAi ) resulted in increased sleep ( Table 1 ). We chose to...”
- Transcriptional profiling of apoptosis-deficient Drosophila mutants
Obata, Genomics data 2014 - “...change>1.5, p<0.05). Probe name Gene symbol p-Value Corrected p-value Fold change Entrez gene ID A_09_P137560 CG6484 1.21E07 7.59E04 826.2603 36994 A_09_P074111 CG3397 3.84E07 0.001204653 543.77155 41454 A_09_P057606 CG30091 3.29E06 0.005706159 259.83295 246449 A_09_P022946 CG6639 7.32E06 0.009384108 156.37743 35049 A_09_P012361 Dro 9.64E06 0.010052347 84.814896 36635 A_09_P164825 CG3397...”
- Genomic changes under rapid evolution: selection for parasitoid resistance
Jalvingh, Proceedings. Biological sciences 2014 - “...2 94 -- mRpS29, ppa, robo CG10936 Dcr-2, CG6484, lack, CG11423, CG42649, CG4844, CG18431, ssp4, CG18432, CG6522, qkr54B, CG6520, veil, CG30103, Prosalpha5,...”
- More
F0UXL1 Sugar transporter protein ERD6-S from Zea mays
32% identity, 94% coverage
F9ULF8 Myo-inositol (And similar sugars) transporter,major facilitator superfamily (MFS) from Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
29% identity, 93% coverage
F6HDJ1 Major facilitator superfamily (MFS) profile domain-containing protein from Vitis vinifera
30% identity, 90% coverage
B9GTB1 Major facilitator superfamily (MFS) profile domain-containing protein from Populus trichocarpa
30% identity, 94% coverage
Smp_127200 hypothetical protein from Schistosoma mansoni
32% identity, 76% coverage
- Human tumor necrosis factor alpha affects the egg-laying dynamics and glucose metabolism of Schistosoma mansoni adult worms in vitro
Lopes-Junior, Parasites & vectors 2022 - “...TNFR (Smp_168070) and glucose transporters, S. mansoni glucose transporter protein1 (SGTP1) (Smp_012440), SGTP2 (Smp_046790), SGTP3 (Smp_127200) and SGTP4 (Smp_103410), were measured. The primer efficiencies were tested, and all of them were between 90 and 110%. Smp_090920 and Smp_062630 were used as reference genes [ 22 ]....”
- Fast evolutionary rates associated with functional loss in class I glucose transporters of Schistosoma mansoni
Cabezas-Cruz, BMC genomics 2015 - “...sequence. In the case of SGTP3, a similar strategy was adopted, based on the sequence (Smp_127200) predicted by genome annotation [ 59 ]. We carried out 5 and 3 RACE PCR using the oligonucleotides: sgtp35.1 5 CTGCCGCGCCACGTGACTTTATT 3, sgtp3 5.2, 5 TTGTTGGGATAGAAAGAAGGAAT 3, smgtp3 3.1 5...”
- Revisiting glucose uptake and metabolism in schistosomes: new molecular insights for improved schistosomiasis therapies
You, Frontiers in genetics 2014 - “...loss of function (Skelly et al., 1994 ). In silico annotation has indicated that SGTP3 (Smp_127200) is the most recently identified component considered as a potential glucose transporter in S. mansoni (Krautz-Peterson et al., 2010 ) but further functional investigation is required to confirm this observation....”
- Suppressing glucose transporter gene expression in schistosomes impairs parasite feeding and decreases survival in the mammalian host
Krautz-Peterson, PLoS pathogens 2010 - “...now be identified. The gene, which we designate SGTP3, is currently identified as hypothetical protein Smp_127200. Searches of dbEST reveal that ESTs exist for all four SGTP genes demonstrating that these genes are expressed in mammalian stage schistosomes. Because SGTP1 and SGTP4 are clearly demonstrated to...”
lpp0488 hypothetical protein from Legionella pneumophila str. Paris
30% identity, 96% coverage
NP_850483 Major facilitator superfamily protein from Arabidopsis thaliana
AT2G48020, NP_850483 sugar transporter, putative from Arabidopsis thaliana
30% identity, 93% coverage
- Intron retention in the 5'UTR of the novel ZIF2 transporter enhances translation to promote zinc tolerance in arabidopsis.
Remy, PLoS genetics 2014 - GeneRIF: Findings indicate that alternative splicing controls the levels of a Zn-responsive mRNA variant of the ZIF2 transporter to enhance plant tolerance to the metal ion. [ZIF2]
- Transcriptional landscape of cotton roots in response to salt stress at single-cell resolution
Li, Plant communications 2023 - Black sheep, dark horses, and colorful dogs: a review on the current state of the Gene Ontology with respect to iron homeostasis in Arabidopsis thaliana
Mai, Frontiers in plant science 2023 - “...compounds that are in the context of iron homeostasis. Family AGI locus identifiers (symbols) ZIF/ZIFL AT2G48020 ( ZIF1 ) At3G43790 ( ZIF2 ) AT5G13740 ( ZIFL1 ) AT5G13750 ( ZIFL2 ) MTP AT2G46800 ( MTP1 ) AT3G61940 ( MTP2 ) AT3G58810 ( MTP3 ) AT2G29410 (...”
- Response of the organellar and nuclear (post)transcriptomes of Arabidopsis to drought
Xu, Frontiers in plant science 2023 - “...AT4G20380 see above LSD1 AT2G18790 see above PHYB AT1G29900 CARBAMOYL PHOSPHATE SYNTHETASE B CARB; VEN3 AT2G48020 ZINC-INDUCED FACILITATOR 2 ZIF2 AT1G04080 Pre-mRNA processing protein PRP39A AT1G77080 FLOWERING LOCUS M; MADS domain protein; flowering regulator that is closely related to FLC; see also main text FLM AT1G09140...”
- Transcriptome analysis of Pará rubber tree (H. brasiliensis) seedlings under ethylene stimulation
Nakano, BMC plant biology 2021 - “...AT2G18480 AtPLT3 6.25 6.26 6.34 Putative monosaccharide transporter family (ERD-group=induced by early dehydration) 0 bx021636 AT2G48020 Major facilitator superfamily protein 2.01 2.93 2.45 0 bx037209 AT2G48020 Major facilitator superfamily protein 2.01 2.98 2.49 2 bx019596 AT3G05160 Major facilitator superfamily protein 1.84 2.66 1.41 Sucrose-proton symporter, SUS,...”
- Early Response to Dehydration Six-Like Transporter Family: Early Origin in Streptophytes and Evolution in Land Plants
Slawinski, Frontiers in plant science 2021 - “...names ESL1 B1a At1g19450 AtERD6-Like 4 ESL1.01 ESL1 B1b At1g75220 AtERD6-Like 6 ESL1.02/ERDL6 ESL2a B2 At2g48020 AtERD6-Like 7 ESL2.01/ZIF2 ESL2a B3 At3g05150 AtERD6-Like 8 ESL2.02 ESL2b B4 At5g18340 AtERD6-Like 16 ESL2.03 ESL3a B5 At1g54730 AtERD6-Like 5 ESL3.01 ESL3b B6a At4g04750 AtERD6-Like 14 ESL3.02 ESL3b B6b At4g04760...”
- Responsiveness of Early Response to Dehydration Six-Like Transporter Genes to Water Deficit in Arabidopsis thaliana Leaves
Slawinski, Frontiers in plant science 2021 - “...PCR Analysis The expression analysis of the 17 AtESL : AtESL1.01 (At1g19450), AtESL1.02/ERDL6 (At1g75220), AtESL2.01/ZIF2 (At2g48020), AtESL2.02 (At3g5150), and AtESL2.03 (At5g18840), AtESL3.01 (At1g54730), AtESL3.02 (At4g4750), AtESL3.03 (At4g04760), AtESL3.04 (At3g20460), AtESL3.05/ESL3 (At1g08890), AtESL3.06/ESL2 (At1g08900), AtESL3.07/ESL1 (At1g08920) , AtESL3.08/ERD6 (At1g08930) , AtESL3.10 (At3g05400), AtESL3.11 (At3g05160), AtESL3.13/SFP1 (At5g27350), and...”
- First Come, First Served: Sui Generis Features of the First Intron
Zalabák, Plants (Basel, Switzerland) 2020 - “...131 ] PIF3 (At1g09530) upstream target of HID1 Arabidopsis [ 36 ] IR secondarystructure ZIF2 (At2g48020) upstream translation enhancement Arabidopsis [ 97 ] riboswitch PSY (At5g17230) upstream translation inhibition Arabidopsis [ 111 ] riboswitch CRK10 (At4g23180) downstream putative cytokinin-binding riboswitch Arabidopsis [ 112 ] uORF PIF3...”
- Quantitation of Vacuolar Sugar Transporter Abundance Changes Using QconCAT Synthtetic Peptides
Pertl-Obermeyer, Frontiers in plant science 2016 - “...across conditions. In other cases, such as for low abundant VMA21a (AT2G31710), VMA22 (AT1G20770), ERDL7 (AT2G48020), and ERDL8 (AT3G05150), the endogenous peptides (L) were less abundant than the spiked-in standard (H) leading to low L/H ratios across conditions. FIGURE 5 Selected examples of L/H ratio of...”
- “...Among the sugar transporters, significant and large increases in abundance were observed also for ERDL7 (AT2G48020) and TMT2 (AT4G35300). ERDL4 (AT1G19450) and ENT1 (AT1G70330) were the only sugar transporter for which no significant change in abundance was measured under salt stress. Under drought stress, for most...”
- More
LOC8056880 sugar transport protein 13 from Sorghum bicolor
29% identity, 90% coverage
- Deciphering the Genetic Mechanisms of Salt Tolerance in Sorghum bicolor L.: Key Genes and SNP Associations from Comparative Transcriptomic Analyses
Jeon, Plants (Basel, Switzerland) 2023 - “...with salt tolerance were inferred, including LOC8071970 , LOC8067721 , LOC110430887 , LOC8070256 , and LOC8056880 . These genes demonstrated notable differences in nsSNPs in comparison to the wild type, suggesting their potential roles in salt tolerance. Additionally, LOC8060874 (cyanohydrin beta-glucosyltransferase) was suggested as a key...”
- “...abiotic stress such as wounding, extreme temperatures, UV-rays, oxidative stress, and drought [ 50 ]. LOC8056880 is a functional sugar transport protein 13. Six nsSNPs were detected in the mutant, which is six times higher than in the wild type. SWEETs (Sugars Will Eventually be Exported...”
SPRG_20105 hypothetical protein from Saprolegnia parasitica CBS 223.65
31% identity, 79% coverage
XP_828610 sugar transporter, putative from Trypanosoma brucei brucei TREU927
30% identity, 97% coverage
MST4_ORYSJ / Q10PW9 Sugar transport protein MST4; Monosaccharide transporter 4; OsMST4; Sugar:proton symporter MST4 from Oryza sativa subsp. japonica (Rice) (see 2 papers)
28% identity, 90% coverage
- function: Mediates active uptake of hexoses by sugar:proton symport (Probable). Can transport glucose, fructose, mannose and galactose (PubMed:17874189, PubMed:18506478). Can transport xylose and ribose (PubMed:18506478).
Q7UF68 Xylose transporter from Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
30% identity, 94% coverage
P54723 Putative metabolite transport protein YfiG from Bacillus subtilis (strain 168)
29% identity, 91% coverage
- Major facilitator superfamily
Pao, Microbiology and molecular biology reviews : MMBR 1998 - “...439 451 P09830 P45598 P37021 P21906 P15729 U29579 X86780 P09098 P31578 P54723 U66480 P46333 P42417 P37514 SP SP SP SP SP GB GB SP SP SP GB SP SP SP Ar...”
C5965_09300 sugar porter family MFS transporter from Cronobacter sakazakii
30% identity, 92% coverage
DV527_RS02780 sugar porter family MFS transporter from Staphylococcus saprophyticus
32% identity, 83% coverage
ETAE_2966 sugar transporter from Edwardsiella tarda EIB202
27% identity, 92% coverage
CTRG_06249 hypothetical protein from Candida tropicalis MYA-3404
30% identity, 85% coverage
LOC109818634 sugar transport protein 10 from Cajanus cajan
28% identity, 91% coverage
SL2A8_HUMAN / Q9NY64 Solute carrier family 2, facilitated glucose transporter member 8; Glucose transporter type 8; GLUT-8; Glucose transporter type X1 from Homo sapiens (Human) (see 2 papers)
TC 2.A.1.1.89 / Q9NY64 Solute carrier family 2, facilitated glucose transporter member 8 (Glucose transporter type 8) (GLUT-8) (Glucose transporter type X1) from Homo sapiens (see 4 papers)
NP_055395 solute carrier family 2, facilitated glucose transporter member 8 isoform 1 from Homo sapiens
34% identity, 78% coverage
- function: Insulin-regulated facilitative hexose transporter that mediates the transport of glucose and fructose (By similarity). Facilitates hepatic influx of dietary trehalose, which in turn inhibits glucose and fructose influx triggering a starvation signal and hepatic autophagy through activation of AMPK and ULK1 (PubMed:27922102). Also able to mediate the transport of dehydroascorbate.
catalytic activity: D-glucose(out) = D-glucose(in) (RHEA:60376)
catalytic activity: D-fructose(out) = D-fructose(in) (RHEA:60372)
catalytic activity: L-dehydroascorbate(out) = L-dehydroascorbate(in) (RHEA:60380)
catalytic activity: alpha,alpha-trehalose(in) = alpha,alpha-trehalose(out) (RHEA:17629)
subunit: Interacts with AP2B1. - substrates: glucose
- Humanin (HN) and glucose transporter 8 (GLUT8) in pregnancies complicated by intrauterine growth restriction.
Janzen, PloS one 2018 - GeneRIF: Humanin (HN) and glucose transporter 8 (GLUT8) in pregnancies complicated by intrauterine growth restriction
- Glucose transporter 8 immunoreactivity in astrocytic and microglial cells in subependymal areas of human brains.
Mashima, Neuroscience letters 2017 (PubMed)- GeneRIF: glucose/fructose is transported into the cytoplasm of vimentin- or GFAP-positive astrocytic and CD68- or HLA-DR-positive microglial cells located around the lateral ventricle
- Immunoreactivity of glucose transporter 8 is localized in the epithelial cells of the choroid plexus and in ependymal cells.
Murakami, Histochemistry and cell biology 2016 (PubMed)- GeneRIF: The findings support the hypothesis of the transport of intravascularGLUT8 through the epithelial cells of the choroid plexus and the ependymal cells.
- SLC2A8 (GLUT8) is a mammalian trehalose transporter required for trehalose-induced autophagy.
Mayer, Scientific reports 2016 - GeneRIF: these data suggest that cytoplasmic trehalose access is carrier-mediated, and that GLUT8 is a mammalian trehalose transporter required for hepatocyte trehalose-induced autophagy and signal transduction.
- Glucose transporter 8 (GLUT8) mediates fructose-induced de novo lipogenesis and macrosteatosis.
DeBosch, The Journal of biological chemistry 2014 - GeneRIF: GLUT8 is thus essential for hepatocyte fructose transport and fructose-induced macrosteatosis.
- Gene expression profiling of peripheral blood leukocytes shows consistent longitudinal downregulation of TOMM40 and upregulation of KIR2DL5A, PLOD1, and SLC2A8 among fast progressors in early Alzheimer's disease.
Chong, Journal of Alzheimer's disease : JAD 2013 (PubMed)- GeneRIF: SLC2A8 is upregulated in fast progressing Alzheimer's disease patients, compared to slow progressors.
- Multiple myeloma exhibits novel dependence on GLUT4, GLUT8, and GLUT11: implications for glucose transporter-directed therapy.
McBrayer, Blood 2012 - GeneRIF: Critical roles for novel GLUT family members highlight a therapeutic strategy entailing selective GLUT inhibition to specifically target aberrant glucose metabolism in cancer.
- Genetic variability of the fatty acid synthase pathway is not associated with prostate cancer risk in the European Prospective Investigation on Cancer (EPIC).
Campa, European journal of cancer (Oxford, England : 1990) 2011 (PubMed)- GeneRIF: Observational study of gene-disease association. (HuGE Navigator)
- More
- Alternative Splicing and Cleavage of GLUT8
Alexander, Molecular and cellular biology 2020 (secret) - Insights into Substrate and Inhibitor Selectivity among Human GLUT Transporters through Comparative Modeling and Molecular Docking
Ferreira, ACS omega 2019 - “...(GLUT1: P11166; GLUT2: P11168; GLUT3: P11169; GLUT4: P14672; GLUT5: P22732; GLUT6: Q9UGQ3; GLUT7: Q6PXP3; GLUT8: Q9NY64; GLUT9: Q9NRM0; GLUT10: O95528; GLUT11: Q9BYW1; GLUT12: Q8TD20; GLUT13 (MYCT): Q96QE2; GLUT14: Q8TDB8). Sequence alignment was manually checked in ViTO, 39 taking into account secondary structure prediction by the PSIPRED...”
- THE CONCISE GUIDE TO PHARMACOLOGY 2017/18: Transporters
Alexander, British journal of pharmacology 2017 - “...SLC2A11 SLC2A6 SLC2A8 SLC2A10 SLC2A12 HGNC, UniProt SLC2A11 , Q9BYW1 SLC2A6 , Q9UGQ3 SLC2A8 , Q9NY64 SLC2A10 , O95528 SLC2A12 , Q8TD20 Common abreviation GLUT11 GLUT6 GLUT8 GLUT10 GLUT12 Substrates Dfructose [ 368 ], Dglucose [ 134 ] Dglucose [ 260 ] dehydroascorbic acid [ 339...”
- The Concise Guide to PHARMACOLOGY 2015/16: Transporters
Alexander, British journal of pharmacology 2015 - “...SLC2A10 SLC2A12 Common abreviation GLUT6 GLUT8 GLUT10 GLUT12 HGNC, UniProt SLC2A6 , Q9UGQ3 SLC2A8 , Q9NY64 SLC2A10 , O95528 SLC2A12 , Q8TD20 Substrates Dglucose [ 238 ] dehydroascorbic acid [ 308 ], Dglucose [ 308 ] Dglucose [ 409 ] Protoncoupled inositol transporter Overview Protoncoupled inositol...”
- Proton-coupled sugar transport in the prototypical major facilitator superfamily protein XylE
Wisedchaisri, Nature communications 2014 - “...GLUT6 (Q9UGQ3); Homo sapiens facilitated glucose transporter GLUT7 (Q6PXP3); Homo sapiens facilitated glucose transporter GLUT8 (Q9NY64); Homo sapiens facilitated glucose transporter GLUT11 (Q9BYW1); Homo sapiens facilitated glucose transporter GLUT14 (Q8TDB8). Simulation system setup The crystal of structure of XylE with substrate bound in the outward-facing partially...”
- Extensive differences in gene expression between symbiotic and aposymbiotic cnidarians.
Lehnert, G3 (Bethesda, Md.) 2014 - “...Hit UniProt Accession No. Blast-hit E-Value 1 11 6.3 86800/1 Human facilitated glucose transporter (GLUT8) Q9NY64 9e89 2 3.7 ND 11708/1 Human facilitated glucose transporter (GLUT8) Q9NY64 1e88 3 ND 36456/1 Rabbit Na + /(glucose/ myo -inositol) transporter 2 Q28728 3e104 4 5.8 ND 45451/1 Drosophila...”
- The Concise Guide to PHARMACOLOGY 2013/14: transporters
Alexander, British journal of pharmacology 2013 - “...SLC2A6 SLC2A8 SLC2A10 SLC2A12 Common abbreviation GLUT6 GLUT8 GLUT10 GLUT12 HGNC, UniProt SLC2A6, Q9UGQ3 SLC2A8, Q9NY64 SLC2A10, O95528 SLC2A12, Q8TD20 Substrates D-glucose 101 D-glucose 102 , dehydroascorbic acid 102 D-glucose 103 Proton-coupled inositol transporter Overview Proton-coupled inositol transporters are expressed predominantly in the brain and can...”
- Expression of endoplasmic reticulum stress proteins is a candidate marker of brain metastasis in both ErbB-2+ and ErbB-2- primary breast tumors.
Sanz-Pamplona, The American journal of pathology 2011 - More
H6S33_000450 uncharacterized protein from Morchella sextelata
31% identity, 89% coverage
- Comparative Transcriptome Profiles of the Response of Mycelia of the Genus Morchella to Temperature Stress: An Examination of Potential Resistance Mechanisms
Yue, Journal of fungi (Basel, Switzerland) 2024 - “...module II were related to the catabolic process of glucose with putative MFS monosaccharide transporter (H6S33_000450), alpha/beta-hydrolase (H6S33_000895), glycoside hydrolase/deacetylase (H6S33_005331, H6S33_012593), and glyceraldehyde 3-phosphate dehydrogenase (H6S33_011274). Moreover, two cytochrome-related genes, H6S33_008973 and H6S33_007572, were identified. These results indicated that high culture temperatures accelerated the oxidative...”
- “...carbon and nitrogen sources to meet metabolic requirements [ 45 ]. The MFS monosaccharide transporter H6S33_000450 was identified among the module I genes, which is consistent with the findings of previous reports showing that major facilitator superfamily (MFS) proteins are involved mainly in energy metabolism [...”
HGT12 potential sugar sensor or transporter from Candida albicans (see 4 papers)
XP_720385 Hgt12p from Candida albicans SC5314
Q8J2J7 Putative glucose sensor protein from Candida albicans
30% identity, 87% coverage
- CharProtDB CGD description: glucose, fructose, mannose transporter; major facilitator superfamily; role in macrophage-induced hyphal growth; detected at germ tube plasma membrane by mass spectrometry; Snf3p-induced; 12 probable transmembrane segments
- The Candida albicans gene HGT12 (orf19.7094) encodes a hexose transporter.
Luo, FEMS immunology and medical microbiology 2007 (PubMed)- GeneRIF: The HGT12 gene encodes a fructose, glucose, and mannose transporter.
- GeneRIF: The C. albicans gene HGT12, which is specifically expressed during macrophage infection, encodes a protein that transports fructose, glucose and mannose.
- Do mitochondria use efflux pumps to protect their ribosomes from antibiotics?
Islam, Microbiology (Reading, England) 2023 - “...ABC O42765, 7.8E^6 A0A1P8ATY7, 6.7E^12 Q8WW24, 1.4E^14 [ 79, 112 ] HXT13, NCU01633 Q1K4S3 MFS Q8J2J7, 2.1E^85 P23586, 1.2E^52 P11168, 2.6E^48 [ 79 ] NCU04809 Q756M6 MFS T2AWG3, 0.0014 Q8GYF4, 1.4E^24 B3KT41, 0.0022 [ 79 ] NCU09551 Q7S2B0 MFS G1UAY0, 2.3E^6 Q56ZZ7, 2.3E^7 Q8NBP5, 8.4E^9 [...”
AFUA_7G00950, Afu7g00950 MFS monosaccharide transporter, putative from Aspergillus fumigatus Af293
32% identity, 81% coverage
- Broad-spectrum antimicrobial activities of a food fermentate of <i>Aspergillus oryzae</i>
Choi, Microbiology spectrum 2024 - “...AFUA_1G04780 pxa1 Putative peroxisomal ABC transporter 2.38 AFUA_1G14330 abcC Putative ABC transporter, Azole transporter 2.35 AFUA_7G00950 Putative MFS monosaccharide transporter 2.25 AFUA_2G12500 Putative MFS multidrug transporter 2.25 AFUA_3G01840 Putative MFS transporter 2.25 AFUA_6G03060 Putative MFS monosaccharide transporter 2.14 AFUA_4G03750 Putative phthalate transporter 2.05 AFUA_6G03720 Putative MFS...”
- Induction of <i>Aspergillus fumigatus</i> zinc cluster transcription factor OdrA/Mdu2 provides combined cellular responses for oxidative stress protection and multiple antifungal drug resistance
Sasse, mBio 2023 - “...Up +753 (inside the 2nd intron) Afu4g14380 Up Up 247 Afu5g06070 mdr1 Up Up 1668 Afu7g00950 Up Up 1038 Afu8g01860 Up Up 181 Afu8g06430 Up Down Not found Afu2g02690 atrR/odrD Up 811 Afu3g01910 Down Up 152 Afu3g01910 Down Up +1447 (inside the seventh exon) Afu5g14740 fleA...”
- A Novel Zn2-Cys6 Transcription Factor AtrR Plays a Key Role in an Azole Resistance Mechanism of Aspergillus fumigatus by Co-regulating cyp51A and cdr1B Expressions
Hagiwara, PLoS pathogens 2017 - “...6.46 9.32 hypothetical protein Afu5g06070 mdr1 11.9 65.9 108.2 5.53 9.09 ABC multidrug transporter Mdr1 Afu7g00950 10.3 60.5 77.7 5.87 7.54 MFS monosaccharide transporter, putative Afu8g01860 30.6 163.0 218.8 5.32 7.15 hypothetical protein DOWN in atrR and srbA Afu1g03150 erg24A 25.5 1.1 2.5 0.04 0.10 c-14...”
- Temperature during conidiation affects stress tolerance, pigmentation, and trypacidin accumulation in the conidia of the airborne pathogen Aspergillus fumigatus
Hagiwara, PloS one 2017 - “...3.1 13.69 0.99 conserved hypothetical protein AFUA_8G04920 201.1 14.9 8.2 13.49 0.55 LEA domain protein AFUA_7G00950 285.3 22.1 26.7 12.89 1.21 MFS monosaccharide transporter, putative AFUA_5G00145 101.3 8.1 2.5 12.48 0.31 conserved hypothetical protein AFUA_4G00730 3748.9 308.7 61.8 12.14 0.20 HHE domain protein AFUA_3G14750 31.9 2.6...”
- Conservation of nucleosome positions in duplicated and orthologous gene pairs
Nishida, TheScientificWorldJournal 2012 - “...AFUA_5G13130 0.490832735 YDR055W AFUA_4G06820 0.482973721 YLR104W AFUA_5G04040 0.47610876 YIL129C AFUA_6G11010 0.473123981 YDR300C AFUA_2G07570 0.469287567 YOL156W AFUA_7G00950 0.46726022 YGL201C AFUA_5G10890 0.462753539 YKR086W AFUA_1G03820 0.461061937 YPL157W AFUA_6G08610 0.460257721 YIL046W AFUA_2G14110 0.45798838 YGL048C AFUA_4G04660 0.457664607 YHR216W AFUA_2G03610 0.456902272 YDR424C AFUA_1G04850 0.455530713 YPR141C AFUA_2G14280 0.452133975 YLR427W AFUA_1G07150 0.444534443 YHL004W AFUA_1G06570...”
- “...AFUA_2G02850 0.284622252 YLR429W AFUA_2G14270 0.283845667 YDR397C AFUA_3G02340 0.283499213 YBR260C AFUA_3G06280 0.282196097 YCR087C-A AFUA_7G04700 0.281322207 YMR011W AFUA_7G00950 0.280854319 YOL148C AFUA_1G16580 0.274850272 YDR379W AFUA_1G12680 0.273041289 YJL151C AFUA_5G10590 0.272979399 YML020W AFUA_5G12090 0.266526854 YGR082W AFUA_6G11380 0.265129767 YJR113C AFUA_1G04280 0.262789584 YIL031W AFUA_5G03200 0.256820972 YDR432W AFUA_3G10100 0.255963453 YDR359C AFUA_4G07560 0.255317292 YDR233C AFUA_6G13670...”
lpg0421 D-xylose (galactose, arabinose)-proton symporter from Legionella pneumophila subsp. pneumophila str. Philadelphia 1
30% identity, 97% coverage
- Mammalian Solute Carrier (SLC)-like transporters of Legionella pneumophila
Best, Scientific reports 2018 - “...sequence from the human SLC2 and SLC5 family, we identified two putative SLC-like glucose transporters, lpg0421 (33%/50%) and lpg1653 (30%/48%) (Table 1 ). Structural modeling of these proteins was done using the Iterative Threading Assembly Refinement (I-TASSER) server, which is a bioinformatics algorithm for predicting three-dimensional...”
- “...SLCs. Amino acid identity (BLAST) Amino acid similarity (BLAST) Putative substrates Representative SLC, TM-score LstA (Lpg0421) 33% 50% Glucose and other monosaccharides SLC2a1 (0.903) LstB (Lpg1653) 30% 48% Glucose and other monosaccharides SLC2a1 (0.922) LstC (Lpg0026) 37% 56% Cationic amino acids (arginine, lysine, ornithine) SLC7a1 (0.953)...”
- Metabolism of the vacuolar pathogen Legionella and implications for virulence
Manske, Frontiers in cellular and infection microbiology 2014 - “...uptake of sugars have not been studied in molecular detail at present. The gene ywtG (lpg0421) is conserved among L. pneumophila and L. longbeachae , and annotated as a putative D-xylose (galactose, arabinose)-proton symporter (Cazalet et al., 2004 , 2010 ). However, arabinose appears to be...”
AT1G67300 hexose transporter, putative from Arabidopsis thaliana
31% identity, 91% coverage
- Evidence for dual targeting control of Arabidopsis 6-phosphogluconate dehydrogenase isoforms by N-terminal phosphorylation
Doering, Journal of experimental botany 2024 - “...phosphomimicry of a serine residue (conserved among 14-3-3 family members) promoted dimerization of Arabidopsis GRF2/GF14-omega (At1g67300) in the context -ApSWRIL- ( Gkirmak et al. , 2015 ), having potential for co-regulation. Under normal growth conditions, the crucial N-terminal S/T residues of the PGD isoforms are probably...”
- Quinoa: A Promising Crop for Resolving the Bottleneck of Cultivation in Soils Affected by Multiple Environmental Abiotic Stresses
Dehghanian, Plants (Basel, Switzerland) 2024 - “...Transmembrane domains genes: WAKL8 Wall-associated receptor kinase-like 8 (AUR62006689) (AUR62029668) At1g21890 WAT1-related protein At1g21890 (AUR62039756) At1g67300 Probable plastidic glucose transporter 2 (AUR62021463) CYP75B1 Flavonoid 3- monooxygenase (AUR62007451) psbD Photosystem II D2 protein (AUR62039871) CER1: Protein ECERIFERUM (AUR62043781) (AUR62043583) AAP6 Amino acid permease 6 (AUR62034957) SULTR1;1 Sulfate...”
- Identification of Putative Transmembrane Proteins Involved in Salinity Tolerance in Chenopodium quinoa by Integrating Physiological Data, RNAseq, and SNP Analyses
Schmöckel, Frontiers in plant science 2017 - “...Loss in 4 comparisons (Cherry Vanilla vs. Regalona, Ollague, Real and Chucapaca) 2.31 9 AUR62021463 At1g67300 Probable plastidic glucose transporter 2 Gain in 6 comparisons (Kurmi, G-205 and Cherry Vanilla vs. Regalona and Chucapaca), loss in 2 comparisons (Ames 22157 vs. Ollague and Real) 1.04 10...”
- Identification of conserved drought-adaptive genes using a cross-species meta-analysis approach
Shaar-Moshe, BMC plant biology 2015 - “...TIP/NIP loc_os03g05290 (AT2G36830, TIP1;1), loc_os06g22960 (AT3G16240, TIP2;1), loc_os10g36924 (AT4G10380, NIP5;1), loc_os06g12310 (AT5G37820, NIP4;2) Sugars loc_os02g17500 (AT1G67300, hexose transporter) loc_os07g39350, loc_os03g10090 (AT3G18830, ATPLT5), loc_os07g01560 (AT1G11260, STP1) Amino acids loc_os02g54730 (AT2G41190, amino acid transporter family protein) loc_os07g04180 (AT5G49630, AAP6) Nitrate loc_os04g40410 (AT5G50200, NRT3.1) Peptides and misc. loc_os05g32630 (AT3G05290,...”
- Phylloxera (Daktulosphaira vitifoliae Fitch) alters the carbohydrate metabolism in root galls to allowing the compatible interaction with grapevine (Vitis ssp.) roots
Griesser, Plant science : an international journal of experimental plant biology 2015 - “...q value c L2 (1dai) L2 (3dai) L2 (7dai) TC130780 GSVIVT01015361001 Plastidial glucose transporter VvGlcT2 (at1g67300) 0.17 0.0425 0.9 1.0 1.1 TC134625 f GSVIVT01003181001 Hexose transporter VvHT8 (at1g11260) 1.36 7.56E06 0.6 0.7 * 0.4 ** TC104920 GSVIVT01017937001 Hexose transporter VvHT5 (at5g26340) n.s. n.s. 0.8 0.9 2.0...”
- Reduced expression of a gene encoding a Golgi localized monosaccharide transporter (OsGMST1) confers hypersensitivity to salt in rice (Oryza sativa)
Cao, Journal of experimental botany 2011 - “...protein sequence is compared with OsMST1-8, Os09g23110, OspGlcT, and OsTMT1-4 from Oryza sativa , AtSGB1, At1g67300, At1g05030, and AtpGlcT from Arabidopsis thaliana , ScRGT2 from Saccharomyces cerevisiae , HsSLC2A3 from Homo sapiens , NtpGlcT from Nicotiana tabacum, and ZmpGlcT from Zea mays . (C) OsGMST1 is...”
- “...( Fig. 1B ) shows that the putative Arabidopsis paralogues to OsGMST1 are encoded by At1g67300 , SGB1 , At1g05030 , and AtpGlcT and the proteins have 67%, 65%, 44%, and 43% identity to OsGMST1, respectively. These four MST proteins are in the pGlcT subfamily (...”
- The Vitis vinifera sugar transporter gene family: phylogenetic overview and macroarray expression profiling
Afoufa-Bastien, BMC plant biology 2010 - “...In a similar way, the fact that Vv16716001 and Vv34389001 form a second group with At1g67300 and SGB1 indicates that these two Vitis putative transporters could be localized in Golgi apparatus. Finally Vv25939001 forms a third group with At1g05030. Search for cis -elements putatively involved in...”
A0A3R7W609 Hexose transporter 1 from Peronospora effusa
30% identity, 78% coverage
- A comparison of transporter gene expression in three species of Peronospora plant pathogens during host infection
Johnson, PloS one 2023 - “...91] no gene name found RQM16367 493 [ Pb-Pt 80] PBEL_00785 595 [ Pe-Pb 82] A0A3R7W609 262 [ Pt-Pe 92] Ptab2_015719 RMX67545 549 [ Pb-Pt 93] PBEL_05539 551 [ Pe-Pb 95] A0A3M6VKN9 551 [ Pt-Pe 97] Ptab2_017636 Others RMX64359 (CTL) 479 [ Pb-Pt 86] PBEL_00807 480...”
- “...the RQM16367 genes. GLUTs or glucose transporters should contain 12 membrane-spanning helices [ 73 ]. A0A3R7W609 was predicted to contain 11, 14, and 11 transmembrane helices whereas PBEL_00785 was predicted to contain 11, 12, and 9 transmembrane helices according to the transmembrane helix predictor programs HMMTOP...”
TC 2.A.1.1.20 / Q01440 Myoinositol:H+ symporter, MIT from Leishmania donovani (see paper)
32% identity, 83% coverage
- substrates: myo-inositol
- Predictive classification models and targets identification for betulin derivatives as Leishmania donovani inhibitors
Zhang, Journal of cheminformatics 2018 - “...%Identity Evalue Bit score Query P27890 HSP83_LEIDO Heat shock protein 83 61.76 0 568 P07900|HS90A_HUMAN Q01440 GTR1_LEIDO Membrane transporter D1 34.83 0.004 30.8 P21616|AVP_VIGRR A4ZZ93 DHYSL_LEIDO Inactive deoxyhypusine synthase 19.70 0.042 26.2 P42330|AK1C3_HUMAN P39050 TYTR_LEIDO Trypanothione reductase 64.71 0.051 27.7 P11362|FGFR1_HUMAN E9BDA8 GMPR_LEIDB GMP reductase 25.64...”
- Major facilitator superfamily
Pao, Microbiology and molecular biology reviews : MMBR 1998 - “...brucei brucei 547 558 543 567 544 528 529 527 337 Q01440 Q01441 L47540 P13865 U05588 Q09037 Q06222 Q06221 Q09039 SP SP GB SP GB SP SP SP SP Ag1 Sce Gal2...”
CC0814 major facilitator family transporter from Caulobacter crescentus CB15
32% identity, 88% coverage
- Regulation of D-xylose metabolism in Caulobacter crescentus by a LacI-type repressor
Stephens, Journal of bacteriology 2007 - “...on the top line. This region includes xylE (CC0814), which encodes a putative xylose transporter. The gene nomenclature is the nomenclature described previously...”
- “...of other members of this regulon, we examined expression of CC0814, which is located near the xyl operon but is not part of the same transcription unit (Fig....”
- Transcriptional profiling of Caulobacter crescentus during growth on complex and minimal media
Hottes, Journal of bacteriology 2004 - “...fbaA Transport CC0442, TonB-dependent receptora CC0814, major facilitator family transporterc CC0991, TonB-dependent receptora CC0999, TonB-dependent receptor,...”
- “...membrane. Xylose also induced expression of a gene (CC0814) encoding a member of the major facilitator superfamily of inner membrane proteins. The CC0814...”
PPYC1_19055 sugar porter family MFS transporter from Paenibacillus polymyxa
29% identity, 94% coverage
- Transcriptome Profiles Reveal the Growth-Promoting Mechanisms of Paenibacillus polymyxa YC0136 on Tobacco (Nicotiana tabacum L.)
Liu, Frontiers in microbiology 2020 - “...interaction. Four genes involved in ABC transport were down-regulated by 1.542.60 times. Two genes ( PPYC1_19055 and PPYC1_22815 ) involved in MFS transfer were down-regulated by 1.67 times and 4.69 times, respectively. These benefit the growth of strain YC0136 by absorbing nutrients. TABLE 5 Effects of...”
- “...transporter permease PPYC1_02025 1.54 Amino acid ABC transporter substrate-binding protein PPYC1_01710 1.58 ABC transporter permease PPYC1_19055 1.67 araE MFS transporter PPYC1_00995 1.72 PTS sugar transporter subunit IIB PPYC1_13110 2.04 znuB Metal ABC transporter permease PPYC1_13115 2.6 znuC Metal ABC transporter ATP-binding protein PPYC1_00515 3.13 smr QacE...”
X276_26120 sugar porter family MFS transporter from Clostridium beijerinckii NRRL B-598
31% identity, 95% coverage
CCNA_00857 D-xylose transporter from Caulobacter crescentus NA1000
32% identity, 92% coverage
- mutant phenotype: Specifically important for D-xylose utilization. Also see PMC2168598 and PMC344409. May also be important for lactose utilization, which is not explained.
M1D4R5 Hexose transporter from Solanum tuberosum
30% identity, 89% coverage
- Enhanced stress resilience in potato by deletion of Parakletos
Zahid, Nature communications 2024 - “...M1B1N5 Chlorophyll a-b binding protein 2.4 Q2XPW1 Histone H2B 2.3 M1CN16 Transcription factor RF2b 2.2 M1D4R5 Hexose transporter 2.1 M1C8J8 3-oxoacyl-CoA synthase 2 M1BS09 Poly(RC)-binding protein 2 M0ZNA1 Pre-mRNA-splicing factor cwc23 1.9 Functional test of candidate proteins identifies Parakletos To assess the functional significance of the...”
AFUA_2G11520 MFS monosaccharide transporter, putative from Aspergillus fumigatus Af293
30% identity, 84% coverage
- Conservation of nucleosome positions in duplicated and orthologous gene pairs
Nishida, TheScientificWorldJournal 2012 - “...AFUA_3G04200 0.653965099 YMR110C AFUA_4G13500 0.649573592 YDR479C AFUA_2G01510 0.649340576 YLR307W AFUA_4G09940 0.641152119 YLL050C AFUA_5G10570 0.636927762 YMR011W AFUA_2G11520 0.631877767 YGR149W AFUA_3G08240 0.627253467 YKL125W AFUA_1G02590 0.626251676 YDL247W AFUA_3G01700 0.621782331 YHR165C AFUA_2G03030 0.616638486 YLR355C AFUA_3G14490 0.615946987 YLR307W AFUA_3G07210 0.615345397 YNL156C AFUA_4G07680 0.605449075 YOL157C AFUA_8G07070 0.600254438 YPL196W AFUA_3G08740 0.596649007 YOL156W AFUA_2G11520...”
- “...AFUA_3G07380 0.064624439 YIR038C AFUA_2G17300 0.068756542 YDL102W AFUA_2G16600 0.088010728 YOR389W AFUA_2G01940 0.09375584 YBR244W AFUA_3G12270 0.097477745 YJL219W AFUA_2G11520 0.098366126 YPL126W AFUA_7G02610 0.101632712 YDL189W AFUA_1G09400 0.104331651 YHL016C AFUA_1G04870 0.106608293 YLR380W AFUA_4G13930 0.111437921 YPR165W AFUA_6G06900 0.117573203 YOL062C AFUA_5G07930 0.122120003 YGL248W AFUA_1G14890 0.124318908 YLR029C AFUA_1G04660 0.129375946 YMR214W AFUA_2G08300 0.130867913 YOR124C AFUA_6G12270...”
- The proteomic signature of Aspergillus fumigatus during early development
Cagas, Molecular & cellular proteomics : MCP 2011 - “...AFUA_5G10070 AFUA_4G09600 AFUA_7G01010 AFUA_2G03830 AFUA_2G09030 AFUA_2G11520 AFUA_4G01290 ORF Name fatty acid beta-oxidation N-acetylglucosamine catabolic...”
LOC102620675 sugar transport protein 13 from Citrus sinensis
30% identity, 89% coverage
- Plant volatile-triggered defense in citrus against biotic stressors
Pérez-Hedo, Frontiers in plant science 2024 - “...synthesis proteins for sugar synthesis during photosynthesis and the sugar transport proteins like STP13 ( LOC102620675 ). Genes associated with cell wall synthesis, including cellulose synthase A ( CSLG3 ) ( LOC102624770 ), expansin-B1 ( Ptrif.0004s1042 ), extensin-2 ( LOC102608242 ), extensin-3 ( LOC102627738 ), and...”
GOX1971 Galactose-proton symporter from Gluconobacter oxydans 621H
31% identity, 92% coverage
XAC1777 MFS transporter from Xanthomonas axonopodis pv. citri str. 306
30% identity, 90% coverage
Q8LBI9 Sugar transporter ERD6-like 16 from Arabidopsis thaliana
AT5G18840 sugar transporter, putative from Arabidopsis thaliana
31% identity, 92% coverage
- Identification of internal reference genes for gene expression normalization between the two sexes in dioecious white Campion
Zemp, PloS one 2014 - “...ACACCCTTTGCGTTATGTGGGAGGT 143 60.4 1.88 Q9FLG1 GARX01000000 (contig_1352.1) SL_EDL16 F: GGGGCCAATTTCACTTGATGCTGGA R: TAATCCGCCTCGGATACTGGTTGGT 118 59.5 1.85 Q8LBI9 GARX01000000 (contig_13862.1) SL_METL1 F: TCCGGTGGTTGGGTTCCTCCTAAAA R:GCCGCATGCCAGTGTCAACAAAA 116 59.5 1.77 Q94AI4 GARX01000000 (contig_15898.1) SL_REF3 F: CGCCAGGCAGAGGTGTTAAACCAGA R: TAGCAGCAGTTACGAGCCCCAACA 145 60.5 1.77 no hit GARX01000000 (contig_17318.1) SL_REF4 F: AAAGCGACGATCTTAGGGCGGTTTG R: TCCCCATGTTTGGAGAGGAACTGCT 153...”
- Responsiveness of Early Response to Dehydration Six-Like Transporter Genes to Water Deficit in Arabidopsis thaliana Leaves
Slawinski, Frontiers in plant science 2021 - “...of the 17 AtESL : AtESL1.01 (At1g19450), AtESL1.02/ERDL6 (At1g75220), AtESL2.01/ZIF2 (At2g48020), AtESL2.02 (At3g5150), and AtESL2.03 (At5g18840), AtESL3.01 (At1g54730), AtESL3.02 (At4g4750), AtESL3.03 (At4g04760), AtESL3.04 (At3g20460), AtESL3.05/ESL3 (At1g08890), AtESL3.06/ESL2 (At1g08900), AtESL3.07/ESL1 (At1g08920) , AtESL3.08/ERD6 (At1g08930) , AtESL3.10 (At3g05400), AtESL3.11 (At3g05160), AtESL3.13/SFP1 (At5g27350), and AtESL3.14/SFP2 (At5g27360) of other vacuolar...”
- AsHSP26.8a, a creeping bentgrass small heat shock protein integrates different signaling pathways to modulate plant abiotic stress response
Sun, BMC plant biology 2020 - “...Carbohydrate metabolism-related proteins AT3G09020 1.37 alpha 1,4-glycosyltransferase family protein AT5G26340 1.37 sugar transport protein 13 AT5G18840 2.66 sugar transporter ERD6-like 16 AT3G49790 1.18 Carbohydrate-binding protein Nitrogen metabolism-related proteins AT1G02920 1.26 glutathione S-transferase 7/11 AT2G02930 1.48 glutathione S-transferase F3 AT5G62480 2.05 glutathione S-transferase tau 9 AT5G02780 1.78...”
- A sweet orange mutant impaired in carotenoid biosynthesis and reduced ABA levels results in altered molecular responses along peel ripening
Romero, Scientific reports 2019 - “...TRANSPORTER 1) 1.90 2.86 0.39 aC08002F04SK_c AT2G26910 ABCG32 (ABCG TRANSPORTER 32) 1.54 1.69 0.27 aC31803D02EF_c AT5G18840 ESL16 (PUTATIVE SUGAR TRANSPORTER 16) 0.95 2.31 1.17 Lipid biosynthetic process (GO:0008610; Level 6) aC31301D12EF_c AT2G22240 IPS2 (INOSITOL-3-PHOSPHATE SYNTHASE2) 2.24 3.66 1.15 aC31810H11EF_c AT5G49555 PDS (PHYTOENE DEHYDROGENASE) 1.88 3.02 0.88...”
- Genome-Wide Transcriptome Analysis Reveals Conserved and Distinct Molecular Mechanisms of Al Resistance in Buckwheat (Fagopyrum esculentum Moench) Leaves
Chen, International journal of molecular sciences 2017 - “...1.860 comp68193_c0_seq1 1.851 comp31329_c0_seq1 1.403 AT5G61520 Major facilitator superfamily protein Carbohydrate comp27968_c0_seq1 1.499 comp29178_c0_seq1 1.403 AT5G18840 Major facilitator superfamily protein Carbohydrate comp7291_c0_seq1 1.167 comp23114_c0_seq1 1.510 comp98352_c0_seq1 1.678 AT1G51340 MATE efflux family protein Citrate comp11267_c0_seq1 2.039 comp96590_c0_seq1 1.764 comp88250_c0_seq1 1.705 comp81877_c0_seq1 1.967 AT3G21090 ABCG15 Cutin comp56152_c0_seq1 2.033...”
- Phylloxera (Daktulosphaira vitifoliae Fitch) alters the carbohydrate metabolism in root galls to allowing the compatible interaction with grapevine (Vitis ssp.) roots
Griesser, Plant science : an international journal of experimental plant biology 2015 - “...GSVIVT01011047001 ERD6-like transporter Vverd6-like7 (at2g48020) 0.56 0.0001 n.d. n.d. n.d. TC123985 GSVIVT01017836001 ERD6-like transporter Vverd6-like16 (at5g18840) 1.36 3.39E06 1.6 1.0 0.9 TC126484 GSVIVT01022022001 ERD6-like transporter Vverd6-like8 (at3g05150) 0.77 1.23E05 n.d. n.d. n.d. TC115303 GSVIVT01010741001 Inositol transporter VvINT1 (at2g43330) 0.65 0.0004 1.0 0.7 0.8 TC113429 GSVIVT01021530001 Inositol...”
- Cytological investigations of the Arabidopsis thaliana elo1 mutant give new insights into leaf lateral growth and Elongator function
Falcone, Annals of botany 2007 - “...synthase (At4g02280), sucrose transporter (At1g71890), sugar transporter (At5g18840) and actin (At3g60830). The primers were designed using the Beacon designer...”
- “...synthase (At4g02280), sucrose transporter (At1g71890) and sugar transporter (At5g18840), with a function in sucrose metabolism was analysed by qPCR in Ler and...”
- The monosaccharide transporter gene family in land plants is ancient and shows differential subfamily expression and expansion across lineages
Johnson, BMC evolutionary biology 2006 - “...representation in the database and best match homologs in early lineages, three ( AtSTP7 , At5g18840 , and AtINT2 ) have microarray expression profiles consistent with broad expression and two ( At3g51490 and AtPLT4 ) appear to have limited expression, including expression in pollen. The broadly...”
- Phosphoinositide 5-phosphate and phosphoinositide 4-phosphate trigger distinct specific responses of Arabidopsis genes: genome-wide expression analyses
Alvarez-Venegas, Plant signaling & behavior 2006 - “...249955_at -2.02 1.53 sugar transporter, putative AT5G18840 253667_at -1.79 1.59 peroxidase, putative two-component responsive regulator/ response regulator 5...”
HXT1_TOXGO / Q8MUM2 Hexose transporter 1; Glucose transporter 1; TgGT1 from Toxoplasma gondii (see 2 papers)
TGME49_214320 facilitative glucose transporter GT1 from Toxoplasma gondii ME49
29% identity, 84% coverage
- function: Sodium-independent facilitative hexose transporter (By similarity). Can transport D-glucose and D-mannose with high affinity, and D-fructose and D-galactose with low affinity (PubMed:12238947, PubMed:19617561). Can transport D-xylose and D-glucosamine (By similarity).
catalytic activity: D-glucose(out) = D-glucose(in) (RHEA:60376)
catalytic activity: D-fructose(out) = D-fructose(in) (RHEA:60372)
catalytic activity: D-galactose(in) = D-galactose(out) (RHEA:34915)
catalytic activity: D-mannose(out) = D-mannose(in) (RHEA:78391)
catalytic activity: D-glucosamine(out) = D-glucosamine(in) (RHEA:78423)
catalytic activity: D-xylose(out) = D-xylose(in) (RHEA:78427)
subunit: Homodimer.
disruption phenotype: Reduced growth rates (PubMed:19617561). Attenuated glucose uptake (PubMed:19617561). Reduced parasite motility in minimal media that does not contain glucose (PubMed:19617561). No significant effects on parasite motility in minimal media supplemented with glutamine (PubMed:19617561). No significant effects on virulence in mice (PubMed:19617561). - Multiple pathways for glucose phosphate transport and utilization support growth of Cryptosporidium parvum
Xu, Nature communications 2024 - “...in C. parvum , Plasmodium falciparum hexose transporter PfHT1 (PF3D7_0204700), Toxoplasma gondii glucose transporter TgGT1 (TGME49_214320) and sugar transporters TgST1-3 (TGME49_257120, TGME49_272500, TGME49_201260) were extracted from VEuPathDB ( https://veupathdb.org/veupathdb/app/ ). MUSCLE was used to align the concatenated sequences and phylogenetic trees based on maximum likelihood were...”
- An Uninvited Seat at the Dinner Table: How Apicomplexan Parasites Scavenge Nutrients from the Host
Piro, Microorganisms 2021 - “...PPM PfHT1 PF3D7_0204700 MSF Sugar Transporters 12 Sugar 504 [ 62 , 63 ] TgGT1 TGME49_214320 MSF Sugar Transporters 12 Sugar 568 [ 62 , 63 ] TgST1 TGME49_257120 MSF Sugar Transporters 12 Sugar 601 [ 62 ] TgST2 TGME49_272500 MSF Sugar Transporters 12 Sugar 689...”
- Comparative studies of Toxoplasma gondii transcriptomes: insights into stage conversion based on gene expression profiling and alternative splicing
Chen, Parasites & vectors 2018 - “...might play a core role in this process. Research on the facilitative glucose transporter (TgGT1, TGME49_214320) in tachyzoites, which is the major hexose transporter on the parasites plasma membrane, has shown that it is not essential for the in vitro survival and in vivo virulence of...”
XYLT_LEVBR / O52733 D-xylose transporter; D-xylose-proton symporter from Levilactobacillus brevis (Lactobacillus brevis) (see paper)
TC 2.A.1.1.41 / O52733 The D-xylose:H+ symporter, XylT (Km=220 μM; inhibited competitively by 6-deoxyglucose (Ki=220 μM), but not by other sugars tested) from Lactobacillus brevis
29% identity, 95% coverage
- function: Uptake of D-xylose across the boundary membrane with the concomitant transport of protons into the cell (symport system). Transport is driven by the proton motive force generated by either malolactic fermentation or by the metabolism of D-glucose.
- substrates: Xylose
- Proton-coupled sugar transport in the prototypical major facilitator superfamily protein XylE.
Wisedchaisri, Nature communications 2014 - “...accession number in parentheses: Escherichia coli XylE (P0AGF4); Lactobacillus brevis D -xylose/H + symporter XylT (O52733); Escherichia coli galactose permease GalP (P0AEP1); Escherichia coli arabinose permease AraE (P0AE24); Bacillus subtilis myo-inositol/H + transporter IolT (O34718); Arabidopsis thaliana inositol/H + symporter INT1 (Q8VZR6); Arabidopsis thaliana hexose/H +...”
Q6CCJ1 YALI0C08943p from Yarrowia lipolytica (strain CLIB 122 / E 150)
31% identity, 93% coverage
Sb02g024060 No description from Sorghum bicolor
31% identity, 81% coverage
- A major locus for chloride accumulation on chromosome 5A in bread wheat
Genc, PloS one 2014 - “...Sb02g023620 Traes_5AL_B64648FE6 Potassium transporter family (HKT23-like) Bradi4g29440 LOC_Os09g21340/Os09g0381100 Sb02g023720 WHE1104_A05_B10ZS;WHE0807_A06_B11ZS; Traes_5AL_3E0C865DF Nucleobase-ascorbate transporter Bradi4g29650 LOC_Os09g23110/Os09g0394500 Sb02g024060 Traes_5AL_01A13992D;Traes_5AL_B8B668113 ABC transporter Bradi4g29720 LOC_Os09g23300/Os09g0396900 Sb02g024130 WHE1787_E02_I03ZS; Traes_5AL_F80B422BA Vacuolar iron transporter 1 (VIT1) Bradi4g29810 LOC_Os09g23640/Os09g0401100 - Traes_5AL_678EA44B2 ABC transporter a according to MSU Rice Genome Annotation Project release 7, Ensembl...”
FVEG_07757 hypothetical protein from Fusarium verticillioides 7600
29% identity, 86% coverage
- Involvement of FST1 from Fusarium verticillioides in virulence and transport of inositol
Niu, Molecular plant pathology 2017 (secret) - Transcriptome changes in Fusarium verticillioides caused by mutation in the transporter-like gene FST1
Niu, BMC microbiology 2015 - “...yeast ITR1p sequence identified eight genes with high sequence similarity (FVEG_01519, FVEG_01638, FVEG_02081, FVEG_03992, FVEG_06504, FVEG_07757, FVEG_11293, and FVEG_12687). The sequence of FST1 was not identified by the search. Among the eight identified genes, expression was significantly down-regulated in fst1 for FVEG_06504 (named ITR1 ) (19-fold)...”
IOLT_BACSU / O34718 Major myo-inositol transporter IolT from Bacillus subtilis (strain 168) (see paper)
TC 2.A.1.1.26 / O34718 Major myoinositol:H+ symporter, IolT from Bacillus subtilis (see 3 papers)
30% identity, 95% coverage
- function: Major myo-inositol uptake transporter.
- substrates: myo-inositol
- Proton-coupled sugar transport in the prototypical major facilitator superfamily protein XylE
Wisedchaisri, Nature communications 2014 - “...permease GalP (P0AEP1); Escherichia coli arabinose permease AraE (P0AE24); Bacillus subtilis myo-inositol/H + transporter IolT (O34718); Arabidopsis thaliana inositol/H + symporter INT1 (Q8VZR6); Arabidopsis thaliana hexose/H + symporter STP1 (P23586); Parachlorella kessleri hexose/H + symporter HUP1 (P15686); Homo sapiens facilitated glucose transporter GLUT12 (Q8TD20); Homo sapiens...”
LOC4332901 sugar transporter ERD6-like 16 from Oryza sativa Japonica Group
29% identity, 88% coverage
- Genome-wide dynamic network analysis reveals a critical transition state of flower development in Arabidopsis
Zhang, BMC plant biology 2019 - “...TPR-like domain containing protein. LOC4339280 1.36 up-regulated Cyclin-like F-box domain containing protein (F-box protein At5g46170) LOC4332901 1.32 up-regulated Sugar transporter-like protein LOC4324342 1.32 up-regulated Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein LOC4351030 1.32 up-regulated Hypothetical protein LOC4341957 1.31 up-regulated Macrophage migration inhibitory factor family...”
SNF3 glucose sensor from Candida albicans (see paper)
XP_723173 glucose sensor from Candida albicans SC5314
30% identity, 60% coverage
- CharProtDB CGD description: glucose and galactose sensor; fermentation, filamentation, virulence roles; in 20-member C. albicans glucose transporter family, extended C terminus; high-glucose repressed; induced in macrophage, repressed in biofilm
- Comparative genomics of the white-rot fungi, Phanerochaete carnosa and P. chrysosporium, to elucidate the genetic basis of the distinct wood types they colonize
Suzuki, BMC genomics 2012 - “...of corresponding sequences are: AnHyp1 (XP_682442.1), AnHyp2 (XP_660070.1), AnMstA (CAC80843), Ao_BAE58341.1 (BAE58341.1), CaHgt1 (CAA76406), CaHgt4 (XP_723173), CaHgt11 (XP_719597), CiGxf1 (AJ937350), CiGxs1 (AJ875406), GzHyp1 (EAA74528), HpGcr1 (AAR88143), KlHgt1 (XP_451484), KlRag1 (XP_453656), KlRag4 (CAA75114), Lb_EDR07962 (EDR07962), NcHyp1 (XP_328858), NcHxt3 (CAD21508), NcNCU00801(EAA34565.1), NcNCU08114 (XP_963873.1), NcRco3 (CAE76420), Pp_115604 (EED81359), Ps_ABN65648.2...”
- Catabolite repression of Aox in Pichia pastoris is dependent on hexose transporter PpHxt1 and pexophagy
Zhang, Applied and environmental microbiology 2010 - “...for HpGcr1, CAI44932 for CiGxs1, EU476007 for HpHxs1, XP_723173 for CaHgt4, CAA75114 for KlRag4, NP_010087 for ScSnf3, and NP_010143 for ScRgt2. cerevisiae and...”
- Identification of hexose transporter-like sensor HXS1 and functional hexose transporter HXT1 in the methylotrophic yeast Hansenula polymorpha
Stasyk, Eukaryotic cell 2008 - “...are as follows: AnMSTA, AAL89822; CaHgt4, XP_723173; CaHgt12, XP_888662; CiGxs1, CAI44932; CiGxf1, CAI77652; HpGcr1, AAR88143; HpHxt1, EU476006; HpHxs1,...”
LOC105679181 facilitated trehalose transporter Tret1 from Linepithema humile
31% identity, 82% coverage
- Social environment affects the transcriptomic response to bacteria in ant queens
Viljakainen, Ecology and evolution 2018 - “...Uncharacterized LOC105676242 (LOC105676242) 2.63 3.00E23 6.44E20 LOC105670707 Uncharacterized transmembrane protein DDB_G0289901like (LOC105670707) 2.17 5.77E45 6.19E41 LOC105679181 Facilitated trehalose transporter Tret1 (LOC105679181) 1.87 1.22E09 6.87E07 LOC105672089 Lipid storage droplets surfacebinding protein 2like (LOC105672089) 1.87 1.94E09 1.04E06 LOC105671866 Serine protease gdlike (LOC105671866) 1.70 4.82E11 3.44E08 LOC105672123 Uncharacterized LOC105672123...”
TRET1_APILI / A9ZSY2 Facilitated trehalose transporter Tret1; AmTRET1 from Apis mellifera ligustica (Common honeybee) (Italian honeybee) (see paper)
31% identity, 93% coverage
- function: Moderate-capacity facilitative transporter for trehalose. Does not transport maltose, sucrose or lactose. Mediates the bidirectional transfer of trehalose. Responsible for the transport of trehalose synthesized in the fat body and the incorporation of trehalose into other tissues that require a carbon source, thereby regulating trehalose levels in the hemolymph.
TC 2.A.1.1.64 / B1PM37 The hexose sensor, Hxs1 (believed to be non-transporting) from Pichia angusta (Yeast) (Hansenula polymorpha) (see paper)
28% identity, 70% coverage
SS1G_07132 hypothetical protein from Sclerotinia sclerotiorum 1980 UF-70
27% identity, 84% coverage
B8AQU8 Major facilitator superfamily (MFS) profile domain-containing protein from Oryza sativa subsp. indica
28% identity, 88% coverage
AT1G08900 carbohydrate transmembrane transporter from Arabidopsis thaliana
32% identity, 93% coverage
- Early Response to Dehydration Six-Like Transporter Family: Early Origin in Streptophytes and Evolution in Land Plants
Slawinski, Frontiers in plant science 2021 - “...ESL3.03 ESL3b B7 At3g20460 AtERD6-Like 13 ESL3.04 ESL3C B8a At1g08890 AtERD6-Like 1 ESL3.0S/ESL3 ESL3C B8b At1g08900 AtERD6-Like 2 ESL3.06/ESL2 ESL3C B9a At1g08920 AtERD6-Like 3 ESL3.07/ESL1 ESL3C B9b At1g08930 AtERD6 ESL3.08/ERD6 ESL3C B10a At3g05400 AtERD6-Like 12 ESL3.09 ESL3C B10b At3g05155 AtERD6-Like 9 ESL3.10 ESL3C B11a At3g05160 AtERD6-Like...”
- Responsiveness of Early Response to Dehydration Six-Like Transporter Genes to Water Deficit in Arabidopsis thaliana Leaves
Slawinski, Frontiers in plant science 2021 - “...(At3g5150), and AtESL2.03 (At5g18840), AtESL3.01 (At1g54730), AtESL3.02 (At4g4750), AtESL3.03 (At4g04760), AtESL3.04 (At3g20460), AtESL3.05/ESL3 (At1g08890), AtESL3.06/ESL2 (At1g08900), AtESL3.07/ESL1 (At1g08920) , AtESL3.08/ERD6 (At1g08930) , AtESL3.10 (At3g05400), AtESL3.11 (At3g05160), AtESL3.13/SFP1 (At5g27350), and AtESL3.14/SFP2 (At5g27360) of other vacuolar SUTs: AtSWEET16 (At3g16690), AtSWEET17 (At4g15920), AtTMT1 (At1g20840), AtTMT2 (At4g35300), AtSUC4 (At1g09960), and...”
- Transcriptomic Analysis of Soil-Grown Arabidopsis thaliana Roots and Shoots in Response to a Drought Stress
Rasheed, Frontiers in plant science 2016 - “...were members of diverse gene families such as major facilitator super family (MFS) transporters [ AT1G08900, AT1G30560, AT1G33440, AT1G72140, AT1G80530, AT2G26690, AT2G34355, AT3G20460, AT3G45680, AT3G47960, AT4G19450, STP8 (AT5G26250), AT5G27350 , and AT5G62680 ], MATE efflux transporters ( AT1G71140, AT5G17700, AT5G19700 , and AT5G38030 ), microRNA genes...”
- Transcriptomic profiling during the post-harvest of heat-treated Dixiland Prunus persica fruits: common and distinct response to heat and cold
Lauxmann, PloS one 2012 - “...At1g68990 O7 JK845815 XM_002315378 Predicted protein, mRNA ( P. trichocarpa ). Major facilitator superfamily protein. At1g08900 O8 JK845816 XM_003592710 ABC transporter G family member ( M. truncatula). ABC-2 type transporter family protein. At2g37360 Expression pattern: 001010 O9 JK845817 AF319166 1-aminocyclopropane 1-carboxylic acid oxidase, mRNA ( P....”
Q6BTD8 DEHA2D01474p from Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
27% identity, 88% coverage
K9H0P1 MFS monosaccharide transporter, putative from Penicillium digitatum (strain Pd1 / CECT 20795)
28% identity, 84% coverage
NP_001268207 hexose transporter from Vitis vinifera
Q3L7K6 Hexose transporter from Vitis vinifera
29% identity, 86% coverage
- Involvement of abscisic acid in the coordinated regulation of a stress-inducible hexose transporter (VvHT5) and a cell wall invertase in grapevine in response to biotrophic fungal infection.
Hayes, Plant physiology 2010 - GeneRIF: central role for abscisic acid in the regulation of VvcwINV and VvHT5 expression during the transition from source to sink in response to infection by biotrophic pathogens
- cDNA-AFLP analysis of plant and pathogen genes expressed in grapevine infected with Plasmopara viticola
Polesani, BMC genomics 2008 - “...1393 CG TT TC58567 103 - Apocytochrome f precursor (Q68RZ3) 4.92E-10 Transport 1614 TT CA Q3L7K6 185 + Hexose transporter 6.26E-08 * 680 CA GT TC52346 231 - Transporter-like protein (Q9LSH7) 3.88E-47 249 TA AC TC66367 107 - 14-3-3 protein (Q93XW1) 1.13E-16 1534 CC GG TC57372...”
- “...pathogens. In this context, the increased level of two genes with similarity to hexose transporters (Q3L7K6 and TC66367) is also worth noting. Carbohydrate accumulation may inhibit the Calvin cycle, which also limits photosynthesis [ 46 , 47 ]. Several genes encoding enzymes in the Calvin cycle...”
- Molecular analysis of post-harvest withering in grape by AFLP transcriptional profiling
Zamboni, Journal of experimental botany 2008 - “...CB006657 4.90E-08 Chloroplast outer membrane protein Q56WJ7 3.00E-10 Copper-transporting P-type ATPase TC64839 4.10E-11 Hexose transporter Q3L7K6 9.00E-12 Major facilitator superfamily MFS 1 TC61509 8.98E-27 Secretion protein HlyD TC60298 9.43E-39 Secretory carrier-associated membrane protein 1 TC52744 5.01E-05 Sucrose transporter-like protein TC51830 3.18E-22 Metabolic process Dopamine -mono-oxygenase N-terminal...”
- “...et al. , 2007 ). Carbohydrate transport and metabolism Our AFLP-TP experiment showed that VvHT5 (Q3L7K6), which encodes a hexose transporter (HT) located in the plasma membrane ( Hayes et al. , 2007 ), is up-regulated late in the withering process ( Table 3 ). This...”
Pc22g09740 uncharacterized protein from Penicillium rubens
30% identity, 84% coverage
SL2A8_RAT / Q9JJZ1 Solute carrier family 2, facilitated glucose transporter member 8; Glucose transporter type 8; GLUT-8; Glucose transporter type X1 from Rattus norvegicus (Rat) (see 3 papers)
33% identity, 78% coverage
- function: Insulin-regulated facilitative hexose transporter that mediates the transport of glucose and fructose (PubMed:10671487). Facilitates hepatic influx of dietary trehalose, which in turn inhibits glucose and fructose influx triggering a starvation signal and hepatic autophagy through activation of AMPK and ULK1. Also able to mediate the transport of dehydroascorbate (PubMed:23396969).
catalytic activity: D-glucose(out) = D-glucose(in) (RHEA:60376)
catalytic activity: D-fructose(out) = D-fructose(in) (RHEA:60372)
catalytic activity: L-dehydroascorbate(out) = L-dehydroascorbate(in) (RHEA:60380)
catalytic activity: alpha,alpha-trehalose(in) = alpha,alpha-trehalose(out) (RHEA:17629)
subunit: Interacts with AP2B1. - Alternative Splicing and Cleavage of GLUT8
Alexander, Molecular and cellular biology 2020 (secret)
NCU02582, XP_965713 RCO3 from Neurospora crassa OR74A
29% identity, 78% coverage
- Revisiting 2-Deoxyglucose Resistance in Neurospora crassa: Insights into Transcriptional Regulation of Hexose Transporters, Sugar Metabolism and Possible Modulation by Mating Type
Pandey, 2023 - Deletion of the col-26 Transcription Factor Gene and a Point Mutation in the exo-1 F-Box Protein Gene Confer Sorbose Resistance in Neurospora crassa
Hirai, Journal of fungi (Basel, Switzerland) 2022 - “...A NCU07788 mat A ; col -26:: Hyg r 11031 FGSC a sor -4 a NCU02582 mat a ; sor -4:: Hyg r 17928 FGSC a sor -4(DS(r)) A NCU02582 mat A ; sor -4(DS(r)) 1741 FGSC a hxk -2 a NCU00575 mat a ; hxk...”
- Glucose sensing and light regulation: A mutation in the glucose sensor RCO-3 modifies photoadaptation in Neurospora crassa.
Olmedo, Fungal biology 2018 (PubMed)- GeneRIF: The mutation in rco-3 modifies the transcriptional response to light of several genes and leads to changes in photoadaptation without significantly changing the amount and regulation of WC-1.
- Transcriptional comparison of the filamentous fungus Neurospora crassa growing on three major monosaccharides D-glucose, D-xylose and L-arabinose
Li, Biotechnology for biofuels 2014 - “...sugar transporters: NCU00821 ( Xyp29 , D-xylose-specific transporter), NCU08114 ( cdt-2 , cellodextrin transport) and NCU02582 ( rco-3 , glucose transporter) [ 9 , 31 , 32 ], and 10 putative sugar transporters, which will be discussed later. In addition, 50 of 300 CAZy genes were...”
- “...High affinity glucose transporter 23.68 38.96 16.02 NCU01868 MFS maltose permease malp 0.41 2.42 0.54 NCU02582 Rco3 9.65 42.90 12.30 NCU04310 Sugar transporter 9.68 26.59 12.88 NCU05350 Sugar transporter 0.37 10.25 0.55 NCU05585 MFS quinate transporter 1.01 47.89 1.52 NCU06026 Quinate permease 5.99 37.83 13.25 NCU06358...”
- Deciphering transcriptional regulatory mechanisms associated with hemicellulose degradation in Neurospora crassa
Sun, Eukaryotic cell 2012 - “...transporter genes (NCU00988, NCU01132, NCU02188, NCU02238, NCU02582, NCU05853, NCU06138, NCU06305, NCU06358, NCU08114, and NCU09027). In addition, 6...”
XOO_2760 MFS transporter from Xanthomonas oryzae pv. oryzae MAFF 311018
30% identity, 90% coverage
Fisuc_1804 sugar transporter from Fibrobacter succinogenes subsp. succinogenes S85
29% identity, 90% coverage
- Generation and Characterization of Acid Tolerant Fibrobacter succinogenes S85
Wu, Scientific reports 2017 - “...six variations are single nucleotide substitutions, resulting in six residue changes in five genes, Fisuc_0527, Fisuc_1804, Fisuc_1945, Fisuc_2074 and Fisuc_2957, encoding SufD, XylE, RlmM, MscL and DosC, respectively. Table 2 Sequence variations between the acid tolerant strain and wild type of F . succinogenes S85. Number...”
- “...100 Frameshift. Stop codon at the 18th codon after the shift. JW3662 (b3685) 3 2230314 Fisuc_1804 xylE sugar transporter 205 C T 217 220 96.14 Ala69Thr JW3991 (b4031) 4 2399135 Fisuc_1945 rlmM ( ygdE ) DNA alkylation repair + 331 A G 199 199 94.12 Thr111Ala...”
- Evaluating Models of Cellulose Degradation by Fibrobacter succinogenes S85
Burnet, PloS one 2015 - “...and III secretion systems had higher expression in the cellulose compared to the glucose cultures. Fisuc_1804, an annotated sugar transporter, was found to have higher expression in the cellulose cultures, relative to glucose ( Fig 3 ). 10.1371/journal.pone.0143809.g001 Fig 1 Expression of fibro-slime genes in F...”
TC 2.A.1.1.46 / Q9JIF3 The blastocyst/testis glucose transporter, Glut8 (Doege et al., 2000) (insulin stimulated in blastocysts) from Mus musculus (Mouse) (see 5 papers)
Slc2a8 solute carrier family 2, facilitated glucose transporter member 8 from Mus musculus
33% identity, 78% coverage
SL2A8_MOUSE / Q9JIF3 Solute carrier family 2, facilitated glucose transporter member 8; Glucose transporter type 8; GLUT-8; Glucose transporter type X1 from Mus musculus (Mouse) (see 6 papers)
NP_062361 solute carrier family 2, facilitated glucose transporter member 8 isoform 1 from Mus musculus
33% identity, 78% coverage
- function: Insulin-regulated facilitative hexose transporter that mediates the transport of glucose and fructose (PubMed:10821868, PubMed:10860996, PubMed:23396969). Facilitates hepatic influx of dietary trehalose, which in turn inhibits glucose and fructose influx triggering a starvation signal and hepatic autophagy through activation of AMPK and ULK1 (PubMed:27922102). Also able to mediate the transport of dehydroascorbate (PubMed:23396969).
catalytic activity: D-glucose(out) = D-glucose(in) (RHEA:60376)
catalytic activity: D-fructose(out) = D-fructose(in) (RHEA:60372)
catalytic activity: L-dehydroascorbate(out) = L-dehydroascorbate(in) (RHEA:60380)
catalytic activity: alpha,alpha-trehalose(in) = alpha,alpha-trehalose(out) (RHEA:17629)
subunit: Interacts with AP2B1 (PubMed:16723738). Also able to mediate the transport of dehydroascorbate (PubMed:23396969). - SWATH-Based Comprehensive Determination of the Localization of Apical and Basolateral Membrane Proteins Using Mouse Liver as a Model Tissue.
Hirano, Biomedicines 2022 - “...Q9DBM0 0.520 0.007 Yes Eno1 P17182 0.684 0.003 Yes Tm7sf3 Q9CRG1 0.662 0.012 Yes Slc2a8 Q9JIF3 0.524 0.017 Yes Lnpep Q8C129 0.690 0.005 Yes Slc46a1 Q6PEM8 0.530 0.005 Yes Park7 Q99LX0 0.702 0.006 Yes Abcb6 Q9DC29 0.532 0.001 Yes Pi4k2b Q8CBQ5 0.723 0.023 Potentially Abcc2 Q8VI47...”
- Alternative Splicing and Cleavage of GLUT8
Alexander, Molecular and cellular biology 2020 (secret) - Lysosomal localization of GLUT8 in the testis--the EXXXLL motif of GLUT8 is sufficient for its intracellular sorting via AP1- and AP2-mediated interaction.
Diril, The FEBS journal 2009 - “...so far unexplored substrate transport across intracellular membranes. Structured digital abstract MINT-7035377 : GLUT8 (uniprotkb: Q9JIF3 ) physically interacts ( MI:0915 ) with AP2 (uniprotkb: P62944 ) by pull down ( MI:0096 ) MINT-7035218 : GLUT8 (uniprotkb: Q9JIF3 ) physically interacts ( MI:0915 ) with AP1...”
- “...with AP1 (uniprotkb: P22892 ) by pull down ( MI:0096 ) MINT-7035235 : GLUT8 (uniprotkb: Q9JIF3 ) physically interacts ( MI:0915 ) with AP1 (uniprotkb: Q8R525 ) by pull down ( MI:0096 ) MINT-7035360 : GLUT8 (uniprotkb: Q9JIF3 ) physically interacts ( MI:0915 ) with AP2...”
- Crosstalk between TM4SF5 and GLUT8 regulates fructose metabolism in hepatic steatosis.
Lee, Molecular metabolism 2022 - GeneRIF: Crosstalk between TM4SF5 and GLUT8 regulates fructose metabolism in hepatic steatosis.
- Cell-specific expression of functional glucose transporter 8 in mammary gland.
Mardones, Biochemical and biophysical research communications 2021 (PubMed)- GeneRIF: Cell-specific expression of functional glucose transporter 8 in mammary gland.
- Adiponectin stimulates glucose uptake in mouse blastocysts and embryonic carcinoma cells.
Burkuš, Reproduction (Cambridge, England) 2020 (PubMed)- GeneRIF: Adiponectin stimulates glucose uptake in mouse blastocysts and embryonic carcinoma cells.
- GLUT1 and GLUT8 support lactose synthesis in Golgi of murine mammary epithelial cells.
Villagrán, Journal of physiology and biochemistry 2019 (PubMed)- GeneRIF: The spatial-temporal synchrony between expression of GLUT8/GLUT1 and alveolar cell proliferation, and its localization in cis-Golgi associated to lactose synthase complex, suggest that both transporters are involved in glucose uptake into this organelle, supporting lactose synthesis.
- Trehalose intake and exercise upregulate a glucose transporter, GLUT8, in the brain.
Narita, Biochemical and biophysical research communications 2019 (PubMed)- GeneRIF: trehalose and GLUT8 coordinately contribute to energy supply in the brain.
- Dysregulation of insulin-sensitive glucose transporters during insulin resistance-induced atrial fibrillation.
Maria, Biochimica et biophysica acta. Molecular basis of disease 2018 (PubMed)- GeneRIF: Insulin-stimulated translocation of GLUT4 and GLUT8 was down-regulated in the atria of insulin resistance animals, as well as their total protein expression.
- Enhanced Hepatic PPARα Activity Links GLUT8 Deficiency to Augmented Peripheral Fasting Responses in Male Mice.
Mayer, Endocrinology 2018 - GeneRIF: Data demonstrate that hepatocyte GLUT8 regulates adaptive fasting in part through regulation of the PPARalpha signaling cascade. Moreover, the ketotic and thermic responses to fasting are differentially encoded within the GLUT8-PPARalpha communication axis.
- Neonatal hypothyroidism affects testicular glucose homeostasis through increased oxidative stress in prepubertal mice: effects on GLUT3, GLUT8 and Cx43.
Sarkar, Andrology 2017 (PubMed)- GeneRIF: Neonatal hypothyroridism downregulates the expressions of GLUT3 and GLUT8 in the testis of perpubertal mice.
- More
TC 2.A.1.1.50 / Q94AZ2 The glucose/fructose:H+ symporter, STP13 (sugar transport protein 13). Expressed in vascular tissues and induced during programmed cell death from Arabidopsis thaliana (Mouse-ear cress) (see 6 papers)
STP13 / RF|NP_198006.1 sugar transport protein 13 from Arabidopsis thaliana (see paper)
NP_198006 Major facilitator superfamily protein from Arabidopsis thaliana
AT5G26340 MSS1; carbohydrate transmembrane transporter/ hexose:hydrogen symporter/ high-affinity hydrogen:glucose symporter/ sugar:hydrogen symporter from Arabidopsis thaliana
29% identity, 87% coverage
- substrates: H+, fructose, glucose
tcdb comment: Used to combat bacterial infection by competing with them for sugars by phosphorylation of STP13 by the BAK1 receptor kinase (Yamada et al. 2016) - Transcriptional activation of SUGAR TRANSPORT PROTEIN 13 mediates biotic and abiotic stress signaling.
Lee, Plant signaling & behavior 2021 - GeneRIF: Transcriptional activation of SUGAR TRANSPORT PROTEIN 13 mediates biotic and abiotic stress signaling.
- Regulation of sugar transporter activity for antibacterial defense in Arabidopsis.
Yamada, Science (New York, N.Y.) 2016 (PubMed)- GeneRIF: Stimulation of STP13 activity suppresses bacterial effector delivery, thereby reducing bacterial virulence.
- Expression of Arabidopsis sugar transport protein STP13 differentially affects glucose transport activity and basal resistance to Botrytis cinerea.
Lemonnier, Plant molecular biology 2014 (PubMed)- GeneRIF: This study showed that STP13-deficient plants exhibited an enhanced susceptibility to B. cinerea and a reduced rate of glucose uptake.
- Monosaccharide absorption activity of Arabidopsis roots depends on expression profiles of transporter genes under high salinity conditions.
Yamada, The Journal of biological chemistry 2011 - GeneRIF: The results indicate that STP13 can reabsorb the monosaccharides that are released by damaged cells under high salinity conditions.
- Over-expression of STP13, a hexose transporter, improves plant growth and nitrogen use in Arabidopsis thaliana seedlings.
Schofield, Plant, cell & environment 2009 (PubMed)- GeneRIF: Transgenic seedlings over-expressing STP13 had increased rates of glucose uptake, higher endogenous sucrose levels, accumulated more total C and biomass per plant, and and had higher levels of expression of the nitrate transporter NRT2.2.
- Differential Gene Expression Reveals Candidate Genes for Drought Stress Response in Abies alba (Pinaceae)
Behringer, PloS one 2015 - “...Q0DKW8 O . sativa subsp . japonica 5.63 STP13 - Sugar transport protein 13 - Q94AZ2 A . thaliana 5.52 RHA2A - E3 ubiquitin-protein ligase RHA2A a Q9ZT50 A . thaliana 5.36 GOLS1 - Galactinol synthase 1 - Q947G8 Solanum lycopersicum 4.94 LEA14-A a - LEA...”
- A comprehensive resource of drought- and salinity- responsive ESTs for gene discovery and marker development in chickpea (Cicer arietinum L.)
Varshney, BMC genomics 2009 - “...42 ]. The presence of protective compound such as 'sugar transport protein 13' (UniProt ID: Q94AZ2) during water stress conditions [ 43 ] in this cluster suggests a protective reaction to osmotic stress in sensitive genotypes as compared with tolerant genotypes. Similarly, the occurrence of 'glycine-rich...”
- Phaseolus vulgaris STP13.1 is an H+-coupled monosaccharide transporter, present in source leaves and seed coats, with higher substrate affinity at depolarized potentials
Pegler, Plant direct 2024 - “...as the mean standard error. Figure S1: Amino acid sequence alignment of AtSTP10 (At3g19940), AtSTP13 (At5G26340) BvSTP13 (Bevul.3G139500), MdSTP13a (MD13G1189100), MtSTP13.1 (Medtr5g006070), MtSTP13.2 (Medtr1g104780), PvSTP13.1 (Phvul.002G046800), PvSTP13.2 (Phvul.007G055100) and TaSTP13 (Traes_4DL_CFC191A06). Amino acid residues encased in a red box indicate residues participating in AtSTP10 binding of...”
- Comparison of the Effects of UV-C Light in the Form of Flash or Continuous Exposure: A Transcriptomic Analysis on <i>Arabidopsis thaliana</i> L
Jazayeri, International journal of molecular sciences 2024 - “...SURVIVAL 1 1.55 2.97 10 3 AT5G10380 RING1 RING/U-box superfamily protein 1.28 6.18 10 5 AT5G26340 MSS1 Major facilitator superfamily protein 1.20 4.13 10 3 AT5G50260 CEP1 Cysteine endopeptidase 1 1.99 7.10 10 3 ijms-25-13718-t005_Table 5 Table 5 The DEGs assigned to HSPs, HSFs, and their...”
- Identification and expression profiling of proline metabolizing genes in Arabidopsis thaliana and Oryza sativa to reveal their stress-specific transcript alteration
Arabia, Physiology and molecular biology of plants : an international journal of functional plant biology 2021 - “...F-box family protein (At2g27310), STP13 (At5g26340), alpha/betaHydrolases (At2g39420), kinase (At1g74360), Thioredoxin superfamily protein (At1g28480) Chl...”
- Membrane nanodomains and transport functions in plant
Martinière, Plant physiology 2021 - “...cell cultures Yoshida et al., 2013 Sugar Sugar transporter protein (STP) AT1G11260 (STP1); AT3G19930 (STP4); AT5G26340 (STP13) Whole plant/suspension cell cultures/leaves Minami et al., 2009 ; Keinath et al., 2010 ; Demir et al., 2013 Sugar (continued) Sucrose transporter (SUT) AT1G22710 (SUT1) Leaves Demir et al.,...”
- Leaf nodule endosymbiotic Burkholderia confer targeted allelopathy to their Psychotria hosts
Georgiou, Scientific reports 2021 - “...(AT2G36190), cwinv5 (AT3G13784), cwinv6 (AT5G11920), cinv1-4 (AT1G35580), cinv1-8 ( AT1G35580), cinv2 (AT4G09510), stp1-1 (AT1G11260), stp13-1 (AT5G26340) and the double mutants stp1 stp13 and stp1 stp4 were kindly provided by Diana Santelia (ETH Zurich, Switzerland); prc1 (AT5G64740) , cev1 (AT5G05170) and rsw1 (AT4G32410) were obtained from Clara...”
- Transcriptome analysis of Rafflesia cantleyi flower stages reveals insights into the regulation of senescence
Mohd-Elias, Scientific reports 2021 - “...Target of rapamycin (TOR) AT1G50030 Promote UN013404 ABC transporter AT5G06530 Unclear UN004449 Sugar transporter 14 AT5G26340 Unclear UN026074 Nitrate transporter AT1G32450 Unclear UN015723 Polyamine transporter AT1G31830 Unclear Redox regulation UN004263 Catalase (CAT) AT1G20630 Unclear UN012078 Superoxide dismutase (SOD) AT3G56350 Unclear UN037470 L-Ascorbate oxidase (ASO) AT1G76160 Unclear...”
- Transcriptome analysis of Pará rubber tree (H. brasiliensis) seedlings under ethylene stimulation
Nakano, BMC plant biology 2021 - “...bx012963 AT5G61520 AtSTP3 2.52 1.96 0.72 0 bx006914 AT5G26250 AtSTP8 1.85 0.26 2.76 1 bx027564 AT5G26340 AtSTP13 5.35 5.31 2.58 2 bx055460 AT1G77210 AtSTP14 3.04 3.23 2.81 H+-Symporter family for polyols and monosaccharides (plasma membrane) 0 bx046600 AT2G18480 AtPLT3 6.25 6.26 6.34 Putative monosaccharide transporter family...”
- Dynamic Development of White Lupin Rootlets Along a Cluster Root
Le, Frontiers in plant science 2021 - “...(HKT1) Potassium Profile 5 Lalb_Chr09g0332731 AT4G23700 Cation/H + exchanger 17 (CHX17) Sodium Profile 5 Lalb_Chr05g0210921 AT5G26340 Sugar transport protein 13 (STP13) Sugar Profile 6 Lalb_Chr06g0160591 AT5G26340 Sugar transport protein 13 (STP13) Sugar Profile 5 Lalb_Chr20g0123111 AT1G22150 Sulfate transporter 1;3 (Sultr1;3) Sulfate Profile 4 Lalb_Chr01g0018841 AT2G16850 Plasma...”
- More
STP10_ARATH / Q9LT15 Sugar transport protein 10; AtSTP10; D-glucose-H(+) symport protein STP10; D-glucose-proton symporter STP10; Hexose transporter 10 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
TC 2.A.1.1.124 / Q9LT15 The high affinity sugar:H+ symporter (sugar uptake) porter of 514 aas and 12 TMSs, STP10. It transports glucose, galactose and mannose, and is therefore a hexose transporter (Rottmann et al. 2016). The 2.4 from Arabidopsis thaliana
NP_188628 Major facilitator superfamily protein from Arabidopsis thaliana
AT3G19940 sugar transporter, putative from Arabidopsis thaliana
27% identity, 90% coverage
- function: Hexose-H(+) symporter that catalyzes the high-affinity uptake of glucose, galactose and mannose (PubMed:26893494). Proton-coupled symporter responsible for the uptake of glucose from the apoplast into the cells (Probable).
catalytic activity: D-glucose(out) + H(+)(out) = D-glucose(in) + H(+)(in) (RHEA:69556)
catalytic activity: D-mannose(out) + H(+)(out) = D-mannose(in) + H(+)(in) (RHEA:69560)
catalytic activity: D-galactose(in) + H(+)(in) = D-galactose(out) + H(+)(out) (RHEA:29019)
disruption phenotype: No visible phenotype under normal growth conditions. - substrates: Galactose, Hexoses, Mannose, glucose
tcdb comment: Å structure with glucose bound has been solved, explaining high affinity sugar recognition (Paulsen et al. 2019). The results suggest a proton donor/acceptor pair that links sugar transport to proton translocation. It contains a Lid domain, conserved in all sugar transport proteins, that locks the mobile transmembrane domains through a disulfide bridge, and creates a protected environment which allows efficient coupling of the proton gradient to drive sugar uptake (Paulsen et al. 2019) - Evolutionary balance between foldability and functionality of a glucose transporter
Choi, Nature chemical biology 2022 - “...transporter 1 (O97467), Staphylococcus epidermidis Glucose transporter (A0A0H2VG78) and Arabidopsis thaliana Sugar transport protein 10 (Q9LT15). The PDB accession number for structures for these reference proteins are 4ZWC (P11169), 4GBZ (P0AGF4), 6RW3 (O97467), 4LDS (A0A0H2VG78) and 6H7D (Q9LT15). Since the sequences are divergent and therefore difficult...”
- “...4LDS and 6H7D). Also, The following UniProt IDs were used (P11169, P0AGF4, O97467, A0A0H2VG78 and Q9LT15). Code availability A program, written in LabView, to control the magnetic tweezers apparatus has been deposited in Github ( https://github.com/tyyoonlab/Science_aaw8208 ) and is available at Zenodo (doi:10.5281/zenodo.3528913). Codes for analyzing...”
- Utilization of AlphaFold2 to Predict MFS Protein Conformations after Selective Mutation.
Xiao, International journal of molecular sciences 2022 - “...To date, several structures of MFS proteins (UniProt ID: P0AA76, P0AEY8, P0AGF4, P02920, Q6MLJ0, and Q9LT15) have been found in both the outward- and inward-opening conformations [ 9 , 10 , 11 , 12 , 30 , 31 , 32 , 33 , 34 , 35...”
- “...5AYM) for Q6MLJ0, 0.88 (inward, PDB ID: 7AAR) and 0.75 (outward, PDB ID: 7AAQ) for Q9LT15, and 0.39 (inward, PDB ID: 4ZP0) and 1.95 (outward, PDB ID: 6GV1) for P0AEY8. Most of these predicted structures, including mutants, have approximately 1 or less deviation from the experimentally...”
- Structural comparison of GLUT1 to GLUT3 reveal transport regulation mechanism in sugar porter family
Custódio, Life science alliance 2021 - “...), GLUT4 (UniProt P14672 ), rGLUT5 (UniProt P43427 ), bGLUT5 (UniProt P58353 ), atSTP10 (UniProt Q9LT15 ), XylE (UniProt P0AGF4 ), and GlcPse (UniProt A0A0H2VG78 ). Conserved residues are highlighted with gray-scale. Alpha helices as found in GLUT1 are represented above the sequence as colored tubes....”
- SLC22A14 is a mitochondrial riboflavin transporter required for sperm oxidative phosphorylation and male fertility.
Kuang, Cell reports 2021 - “...etal., 2019 ) revealed that both the human SLC22A14 and the A.thaliana STP10 (UniProt entry Q9LT15) belonged to the Major facilitator, sugar transporter-like protein family (IPR005828), strengthening our confidence that the correct template had been chosen. Finally, quality of the models was assessed using MolProbity (...”
- Crystal structure of the plant symporter STP10 illuminates sugar uptake mechanism in monosaccharide transporter superfamily
Paulsen, Nature communications 2019 - “...plant life. Methods Protein purification The gene encoding the Arabidopsis thaliana protein STP10 (Accession number Q9LT15 [ https://www.uniprot.org/uniprot/Q9LT15 ]) was introduced into an expression construct based on p423_GAL1 40 with a C-terminal purification tag containing a thrombin cleavage site and a deca-histidine tag. The primers used...”
- Molecular mechanism of sugar transport in plants unveiled by structures of glucose/H+ symporter STP10.
Bavnhøj, Nature plants 2021 (PubMed)- GeneRIF: Molecular mechanism of sugar transport in plants unveiled by structures of glucose/H(+) symporter STP10.
- STP10 encodes a high-affinity monosaccharide transporter and is induced under low-glucose conditions in pollen tubes of Arabidopsis.
Rottmann, Journal of experimental botany 2016 - GeneRIF: A high-affinity glucose uptake system is induced in growing pollen tubes under low glucose conditions and that this regulation may occur through the hexokinase pathway. [AtSTP10]
- Phaseolus vulgaris STP13.1 is an H+-coupled monosaccharide transporter, present in source leaves and seed coats, with higher substrate affinity at depolarized potentials
Pegler, Plant direct 2024 - “...is presented as the mean standard error. Figure S1: Amino acid sequence alignment of AtSTP10 (At3g19940), AtSTP13 (At5G26340) BvSTP13 (Bevul.3G139500), MdSTP13a (MD13G1189100), MtSTP13.1 (Medtr5g006070), MtSTP13.2 (Medtr1g104780), PvSTP13.1 (Phvul.002G046800), PvSTP13.2 (Phvul.007G055100) and TaSTP13 (Traes_4DL_CFC191A06). Amino acid residues encased in a red box indicate residues participating in AtSTP10...”
- Calmodulin-Domain Protein Kinase PiCDPK1 Interacts with the 14-3-3-like Protein NtGF14 to Modulate Pollen Tube Growth
Scheible, Plants (Basel, Switzerland) 2024 - “...Epsin family of endocytic proteins Accessory proteins that facilitate vesicle biogenesis [ 41 ] A0A1S4AFS9 AT3G19940 Sugar Transport Protein 10 Sugar Transport Protein Glucose uptake in growing pollen tubes [ 42 ] A0A1S4AKF1 AT1G16010 Magnesium Transporter 2 Transmembrane magnesium transporter Tonoplast-targeted transporter for vacuolar accumulation of...”
- Exploring the genic resources underlying metabolites through mGWAS and mQTL in wheat: From large-scale gene identification and pathway elucidation to crop improvement
Chen, Plant communications 2021 - “...behind the accumulation of the metabolite sucrose ( Chen etal., 2020 ). Their orthologin Arabidopsis AT3G19940 , which is also known as STP10 , encodes a high-affinity hexose transporter ( Rottmann etal., 2016 ). These examples thus collectively demonstrate that the approach enables us to identify...”
- Plant glucose transporter structure and function
Geiger, Pflugers Archiv : European journal of physiology 2020 - “...developed pollen grain Plasma membrane Glucose, galactose, arabinose High [ 122 , 131 ] AtSTP10 At3g19940 Germinating pollen and growing pollen Plasma membrane Glucose, galactose, mannose, High [ 109 , 122 , 124 ] AtSTP11 At5g23270 Fully mature pollen and growing pollen tubes Plasma membrane Glucose,...”
- Metabolite-based genome-wide association study enables dissection of the flavonoid decoration pathway of wheat kernels
Chen, Plant biotechnology journal 2020 - “...respectively. The top hit of these candidates ( TraesCS4B01G371700 and TraesCS4D01G365800 ) in Arabidopsis ( AT3G19940 , also known as SPT10 ) encodes a highaffinity hexose transporter carrying glucose and other monosaccharides (Paulsen et al. , 2019 ; Rottmann et al. , 2016 ). Similarly, for...”
- Genome-Wide Identification and Expression Profiling of Sugar Transporter Protein (STP) Family Genes in Cabbage (Brassica oleracea var. capitata L.) Reveals their Involvement in Clubroot Disease Responses
Zhang, Genes 2019 - “...Bol014014 Scaffold000180 MF2 1551 516 56.15 6.89 33.77 101.67 0.54 cell membrane tPCK2 F AtSTP10 AT3G19940 1545 514 BoSTP10 Bol000549 Scaffold000531 MF1 1536 511 56.16 8.60 30.51 97.50 0.48 cell membrane tPCK7 Q AtSTP11 AT5G23270 1545 514 BoSTP11 Bol017091 C06 LF 1569 522 57.17 5.79 33.58...”
- Transcriptomic and proteomic approach to identify differentially expressed genes and proteins in Arabidopsis thaliana mutants lacking chloroplastic 1 and cytosolic FBPases reveals several levels of metabolic regulation
Soto-Suárez, BMC plant biology 2016 - “...: Table S4). Sugar transporter 2 (At1g07340) and three sugar transporter family proteins (At3g05155, At4g04760, At3g19940) were up-regulated in cyfbp rosettes, and only a mannitol transporter (At2g20780) was down-regulated. Finally, a carbohydrate transmembrane transporter (At1g08930) and two UDP-galactose transporters (At4g23010 and At3g59360) were up-regulated in cyfbp...”
- STP10 encodes a high-affinity monosaccharide transporter and is induced under low-glucose conditions in pollen tubes of Arabidopsis
Rottmann, Journal of experimental botany 2016 - “...microarray data furthermore indicate a rather high expression of the so far uncharacterized STP10 ( At3g19940 ) in pollen tubes. In the present paper, we describe the detailed characterization of the Arabidopsis monosaccharide transporter gene STP10 , which is expressed in pollen tubes and also in...”
- More
Npun_R5323 sugar transporter from Nostoc punctiforme
31% identity, 90% coverage
LOC112741105 sugar transporter ERD6-like 16 from Arachis hypogaea
29% identity, 92% coverage
- Transcriptomic Analysis Provides Insights into the Differential Effects of Aluminum on Peanut (Arachis hypogaea L.)
Bao, Genes 2022 - “...R 5-GAGGCGGAGGAGGAGTAGTTCTG-3 AhMYB14 LOC112722417 F 5-AACCTGCACCGTGTCTGATGTTG-3 R 5-AAGCCGAATGTCTTGATGGAGTCTG-3 AhMYB44 LOC112766377 F 5-GACCCGTTGACTGCGTTGACTC-3 R 5-CTCACTTCCCTGGCAATCACATCC-3 AhERD6 LOC112741105 F 5-ACAGCATTGGGAGCAATACTGATGG-3 R 5-CAGCCTACGAAAGTGCCACTAGC-3 AhNCED1 LOC112703460 F 5-TGGAAGGAAGACACAGTTCGCATAC-3 R 5-CTTCGCCGCTGGACAGATCAAC-3 Ahactin LOC112787680 F 5-AAGCTGGCTTACATTGCCCT-3 R 5-TGACCTGTCCATCAGGCAAC-3 genes-13-01830-t002_Table 2 Table 2 Sequencing statistics. Sample Clean Reads Clean Bases GC Content %...”
F7308_1395 sugar porter family MFS transporter from Francisella salina
29% identity, 90% coverage
- Genetic diversity within the genus Francisella as revealed by comparative analyses of the genomes of two North American isolates from environmental sources
Siddaramappa, BMC genomics 2012 - “...213 aa, 37%, 4e-34 F7308_1394 (471 aa) Glucuronate isomerase (UxaC) Sde_1272, 471 aa, 51%, 3e-140 F7308_1395 (463 aa) D-xylose-proton symporter (XylT) CBUD_1731, 463 aa, 43%, 3e-91 F7308_1396 (325 aa) Inositol oxygenase 56727 Miox, 285 aa, 37%, 3e-47 Lactose metabolism 4 Fphi_0309 (655 aa) Beta-galactosidase BMD_1886, 651...”
7aaqA / Q9LT15 Sugar/h+ symporter stp10 in outward occluded conformation (see paper)
27% identity, 94% coverage
- Ligand: beta-d-glucopyranose (7aaqA)
An02g03540 uncharacterized protein from Aspergillus niger
31% identity, 84% coverage
- The antifungal peptide AnAFP from Aspergillus niger promotes nutrient mobilization through autophagic recycling during asexual development
Starke, Frontiers in microbiology 2024 - “...An12g04180 Aspartate transporter agtA -1.99 1.1E-02 An15g07190 Zinc transporter, endoplasmic reticulum membrane zrfA -2.25 6.5E-04 An02g03540 Hig-affinity hexose/H+ symporter mstE -2.28 7.2E-05 An02g14410 Ammonium transporter meaA -2.9 4.1E-02 An08g05670 Nitrate transporter crnA -3.88 6.8E-03 An07g06240 MFS transporter, ferric triacetylfusarinine C transport mirD -5.28 1.8E-02 An08g03200 Ammonium...”
- ERV14 receptor impacts mycelial growth via its interactions with cell wall synthase and transporters in Aspergillus niger
Zheng, Frontiers in microbiology 2023 - “...of proteome and the Y2H screening. Family Protein accession Gene ID Description MFS family CAK47634 An02g03540 Fructose transmembrane transporter CAK97262 An15g03940 Monosaccharide transporter CAK37108 An01g07860 Sulfate transmembrane transporter ABC family CAK43073 An17g01770 ATPase-coupled transmembrane transporter F-ATPase family CAK37765 An02g08020 H + -transporting ATPase lipid-binding protein P-ATPase...”
- Evaluation of Aspergillus niger Six Constitutive Strong Promoters by Fluorescent-Auxotrophic Selection Coupled with Flow Cytometry: A Case for Citric Acid Production
Lu, Journal of fungi (Basel, Switzerland) 2022 - “...genes in starch hydrolysis, glucose uptake, and glycolysis, such as amyA (An12g06930), glaA (An03g06550), mstC (An02g03540), mstG (An05g01290), mstH (An15g03940), pfkB (An07g02100), and ppcA (An11g02550) ( Table 2 ). As to intracellular citrate transportation, mitochondrial citrate/malate carrier protein CtpA (An11g11230) was also synergistically upregulated ( Table...”
- “...2.79 6.12 2.19 An12g06930 amyA Amylase 2.03 3.76 1.85 An03g06550 glaA Glucoamylase 2.83 6.49 2.29 An02g03540 mstC Low affinity glucose transporter 1.25 1.58 1.26 An05g01290 mstG High affinity glucose transporter 1.25 1.39 1.11 An15g03940 mstH High affinity glucose transporter 2.73 5.75 2.11 An04g06910 amyR Transcription factor...”
- Novel Treatment Approach for Aspergilloses by Targeting Germination
Verburg, Journal of fungi (Basel, Switzerland) 2022 - “...triggering breaking of dormancy. Negatively regulated by AtfA. A. fumigatus [ 97 ] CreA (An02g03830), (An02g03540) Fermentation/ Glycolysis: creA is a catabolite repressor. [ 174 ] FleA Recognizes and binds receptors, plays a role in attachment/adhesion to epithelial cells, as well as recognition by hosts immune...”
- RCO-3 and COL-26 form an external-to-internal module that regulates the dual-affinity glucose transport system in Neurospora crassa
Li, Biotechnology for biofuels 2021 - “...the WT strain [ 87 ]. In A. niger , the A. nidulans MstE ortholog An02g03540 showed a high expression level on glucose and maltose, and its expression in a amyR mutant was significantly downregulated [ 90 ]. To test the hypothesis that the dual-affinity glucose...”
- In Silico Analysis of Putative Sugar Transporter Genes in Aspergillus niger Using Phylogeny and Comparative Transcriptomics
Peng, Frontiers in microbiology 2018 - “...on the tested carbon sources. For instance, the low-affinity D -glucose transporter encoding gene mstC (An02g03540) and high-affinity D -glucose transporter encoding gene mstG (An05g01290) were higher expressed on hexose substrates than other monosaccharides. The D -galacturonic acid transporter encoding genes gatA (An14g04280) ( Sloothaak et...”
- Metabolic activity in dormant conidia of Aspergillus niger and developmental changes during conidial outgrowth
Novodvorska, Fungal genetics and biology : FG & B 2016 - “...genes encoding putative glucose/hexose transporters ( Pel et al., 2007 ) transcription of 5 genes (An02g03540, An15g03940, An05g01290, An16g08940, An02g01270) was highly upregulated at T1. The most upregulated was the homolog of A. nidulans mstE , (An02g03540) encoding a low affinity glucose transporter. Transcription of mstA...”
- “...Verified/putative function An11g04810 3.1 94.8 Alternative oxidase, aox1 An01g09290 85.1 17.6 Neutral trehalase, treB a An02g03540 15.8 489.9 Low affinity glucose transporter, mstE An15g03940 4.0 336.7 Monosaccharide transporter An05g01290 2.8 324.2 Monosaccharide transporter An16g08940 5.1 118.8 Monosaccharide transporter An02g01270 1.6 25.8 Monosaccharide transporter An12g07450 1.6 9.5...”
- Trancriptional landscape of Aspergillus niger at breaking of conidial dormancy revealed by RNA-sequencing
Novodvorska, BMC genomics 2013 - “...phosphoglycerate kinase 19.01 32.17 15.68 2.05 An02g03830 creA , catabolite repressor 2.57 4.43 30.22 6.82 An02g03540 hexose transport protein 42.48 33.08 523.81 15.83 GABA shunt An10g00090 glutamate dehydrogenase 89.12 246.31 3.87 63.64 An15g04770 glutamate decarboxylase 63.83 62.34 2.3 27.10 An08g08840 glutamate decarboxylase 5.74 16.85 3.14 5.36...”
- More
TC 2.A.1.1.58 / Q8J0U9 Low affinity glucose:H+ symporter, MstC from Aspergillus niger
32% identity, 77% coverage
Cbei_0109 sugar transporter from Clostridium beijerincki NCIMB 8052
30% identity, 95% coverage
- CRISPR-Cas technology a new era in genomic engineering
Parsaeimehr, Biotechnology reports (Amsterdam, Netherlands) 2022 - “...the solvent production in C. beijerinckii the genes ctfAB, cbei_3833/3834, and xylR, cbei_2385, and xylT, cbei_0109 responsible for the organic acids re-assimilation and pentose utilization, were edited using the introduced CRISPR-Cas system. As a result, the genome engineered Clostridia was able to decompose 83.2g/L of deshelled...”
- Enhanced solvent production by metabolic engineering of a twin-clostridial consortium
Wen, Metabolic engineering 2017 (PubMed)- “...and pentose utilization (xylR, cbei_2385 and xylT, cbei_0109) were engineered in C. beijerinckii to enhance solvent production. The engineered twin-clostridia...”
- “...by inactivating xylR ( cbei_2385 )and overexpressing xylT ( cbei_0109 ) to promote pentose utilization. Fig. 1 Fig. 2 A CRISPRi system was adapted to repress...”
- Reconstruction of xylose utilization pathway and regulons in Firmicutes
Gu, BMC genomics 2010 - “...related protein Clostridium , C. saccharolyticus XylB CAC2612 Xylulokinase Xylulokinase (with CAC1344) Bacilli, Clostridia XylT Cbei_0109 Xylose H + -symporter Sugar transporter Clostridium , Lactobacillales XylR CAC3673 Xylose regulator XylR regulator (with CAC0933 ) Bacilli, Clostridia XynT CAC3451 Xyloside Na + (H + ) - symporter...”
ERD6_ARATH / O04036 Sugar transporter ERD6; Early-responsive to dehydration protein 6; Sugar transporter-like protein 1 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
TC 2.A.1.1.97 / O04036 Sugar transporter ERD6 (Early-responsive to dehydration protein 6) (Sugar transporter-like protein 1) from Arabidopsis thaliana (see 5 papers)
AT1G08930 ERD6 (EARLY RESPONSE TO DEHYDRATION 6); carbohydrate transmembrane transporter/ sugar transmembrane transporter/ sugar:hydrogen symporter from Arabidopsis thaliana
29% identity, 93% coverage
- function: Sugar transporter.
- substrates: Sugars
- How the Ectopic Expression of the Barley <i>F-Box</i> Gene <i>HvFBX158</i> Enhances Drought Resistance in <i>Arabidopsis thaliana</i>
Wen, International journal of molecular sciences 2025 - “...The expression levels of drought-tolerant genes increased in the OE lines. Drought-responsive genes, such as AT1G08930 ( ERD6 ), have been hypothesized to function as sugar transporters that actively respond to water scarcity [ 28 ]. Late embryogenesis abundant (LEA) proteins have been recognized for their...”
- RNA N6-adenine methylation dynamics impact Hyaloperonospora arabidopsidis resistance in Arabidopsis
Furci, Plant physiology 2024 (no snippet) - Characteristics analysis of Early Responsive to Dehydration genes in Arabidopsis thaliana (AtERD)
Wu, Plant signaling & behavior 2023 - “...AT3G30775 PDH1; PRO1; PRODH; 2751 6.41 54.9558 inner mitochondrial membrane 22 , 23 AtERD 6 AT1G08930 F7G19_19 2742 8.87 54.35499 cytoplasm 24 , 25 AtERD 7 AT2G17840 T13L16_14 2742 5.30 49.00035 LDs and the cytosol 26 , 27 AtERD 8 AT5G56030 HSP81.2; HSP90.2; MDA7.7; 2727 4.95...”
- Early Response to Dehydration Six-Like Transporter Family: Early Origin in Streptophytes and Evolution in Land Plants
Slawinski, Frontiers in plant science 2021 - “...and their biological functions remain largely unknown. The first ESL gene, named as ERD6 ( At1g08930 ), has been identified by using a differential screening of the complementary DNA (cDNA) library from Arabidopsis thaliana plants exposed to dehydration stress (Kiyosue et al., 1994 ). AtERD6 expression...”
- “...ESL3.0S/ESL3 ESL3C B8b At1g08900 AtERD6-Like 2 ESL3.06/ESL2 ESL3C B9a At1g08920 AtERD6-Like 3 ESL3.07/ESL1 ESL3C B9b At1g08930 AtERD6 ESL3.08/ERD6 ESL3C B10a At3g05400 AtERD6-Like 12 ESL3.09 ESL3C B10b At3g05155 AtERD6-Like 9 ESL3.10 ESL3C B11a At3g05160 AtERD6-Like 10 ESL3.11 ESL3C B11a At3g05165 At3g05165 ESL3.12 ESL3C B11b At5g27350 AtERD6-Like 17...”
- Responsiveness of Early Response to Dehydration Six-Like Transporter Genes to Water Deficit in Arabidopsis thaliana Leaves
Slawinski, Frontiers in plant science 2021 - “...(Slawinski et al., 2021 ). Because the identification of the first ESL gene ( ESL3.08/ERD6 At1g08930 ) via differential screening of a complementary DNA (cDNA) library prepared with A. thaliana plants exposed to dehydration (Kiyosue et al., 1994 ), only few ESL genes have been characterized....”
- “...(At1g54730), AtESL3.02 (At4g4750), AtESL3.03 (At4g04760), AtESL3.04 (At3g20460), AtESL3.05/ESL3 (At1g08890), AtESL3.06/ESL2 (At1g08900), AtESL3.07/ESL1 (At1g08920) , AtESL3.08/ERD6 (At1g08930) , AtESL3.10 (At3g05400), AtESL3.11 (At3g05160), AtESL3.13/SFP1 (At5g27350), and AtESL3.14/SFP2 (At5g27360) of other vacuolar SUTs: AtSWEET16 (At3g16690), AtSWEET17 (At4g15920), AtTMT1 (At1g20840), AtTMT2 (At4g35300), AtSUC4 (At1g09960), and AtVGT2 (At5g17010), and of vacuolar...”
- Large-Scale Phosphoproteomic Study of Arabidopsis Membrane Proteins Reveals Early Signaling Events in Response to Cold
Kamal, International journal of molecular sciences 2020 - “...SWEET12 bidirectional sugar transporter SWEET12 -like protein PM Solute transport LGTLTS[+80]PEPVAITVVR S 248 A * AT1G08930 ERD6 Major facilitator superfamily protein ER,PM Solute transport SLS[+80]IRER S 17 A * AT3G18830 PLT5 polyol/monosaccharide transporter 5 PM Solute transport TVPNPEVEIGS[+80]NKQWKEGDTQSS S 527 D * AT1G20840 TMT1 tonoplast monosaccharide...”
- EFFECTOR OF TRANSCRIPTION factors are novel plant-specific regulators associated with genomic DNA methylation in Arabidopsis
Tedeschi, The New phytologist 2019 - “...backgr FT, PEBP family protein AT5G48850 3.153 SMP coding region Tetratricopeptide repeat (TPR)like superfamily protein AT1G08930 3.229 vDMR 3 region Major facilitator superfamily protein AT1G53480 3.371 vDMR coding mto 1 responding down 1 AT4G20370 3.573 vDMR promotor TSF, PEBP family protein AT2G09187 3.851 hDMR243 Athila6 transposable...”
- “...family AT4G15690 2.722 No methylation Thioredoxin superfamily protein AT5G56780 2.835 SMP, DMR1890 Effector of transcription2 AT1G08930 2.871 vDMR 3 Major facilitator superfamily protein AT1G07050 2.874 No methylation CCT motif family protein AT5G65080 2.936 SMP 3 Kbox region, MADSbox transcription factor family protein AT4G20370 3.160 TSF, PEBP...”
- Root Hair Single Cell Type Specific Profiles of Gene Expression and Alternative Polyadenylation Under Cadmium Stress
Cao, Frontiers in plant science 2019 - “...cells after 72 h of Cd stress, reduced PAC usage at 3 UTR of ERD6 (AT1G08930) was detected, whereas an increased PAC usage at CDS was found in ERD14 (AT1G76180, log2FC = 4.34, p value = 0.0001) was noticed. Specifically, we detected differential poly(A) site usage...”
- More
INT1_ARATH / Q8VZR6 Inositol transporter 1 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
TC 2.A.1.1.66 / Q8VZR6 The tonoplast H+:Inositol symporter 1, Int1 (mediates efflux from the tonoplast to the cytoplasm (Schneider et al., 2008) (most similar to 2.A.1.1.63 and 2.A.1.1.62) from Arabidopsis thaliana (Mouse-ear cress) (see 4 papers)
int1 / CAJ00303.1 inositol transporter 1 from Arabidopsis thaliana (see paper)
NP_850393 inositol transporter 1 from Arabidopsis thaliana
AT2G43330 INT1 (INOSITOL TRANSPORTER 1); carbohydrate transmembrane transporter/ myo-inositol:hydrogen symporter/ sugar:hydrogen symporter from Arabidopsis thaliana
28% identity, 94% coverage
- function: Vacuolar inositol-proton symporter involved in the release of myo-inositol from vacuoles. Not involved in glucose or fructose transport.
disruption phenotype: Reduced root length at low concentrations of myo- inositol. - substrates: myo-inositol
- Routes to the tonoplast: the sorting of tonoplast transporters in Arabidopsis mesophyll protoplasts.
Wolfenstetter, The Plant cell 2012 - GeneRIF: INT1 is correctly localized to the tonoplast, while sorting of the vacuolar sucrose transporter SUC4 is blocked in cis-Golgi stacks.
- Functional and physiological characterization of Arabidopsis INOSITOL TRANSPORTER1, a novel tonoplast-localized transporter for myo-inositol.
Schneider, The Plant cell 2008 - GeneRIF: molecular, physiological, and functional studies demonstrate that INT1 is a tonoplast-localized H(+)/inositol symporter that mediates the efflux of inositol that is generated during the degradation of inositol-containing compounds in the vacuolar lumen
- ITN1, a novel gene encoding an ankyrin-repeat protein that affects the ABA-mediated production of reactive oxygen species and is involved in salt-stress tolerance in Arabidopsis thaliana.
Sakamoto, The Plant journal : for cell and molecular biology 2008 (PubMed)- GeneRIF: Mutation in INT1 impairs abscisic acid signaling which leads to the reduction of reactive oxygen species accumulation under salt-stress conditions.
- Proton-coupled sugar transport in the prototypical major facilitator superfamily protein XylE
Wisedchaisri, Nature communications 2014 - “...AraE (P0AE24); Bacillus subtilis myo-inositol/H + transporter IolT (O34718); Arabidopsis thaliana inositol/H + symporter INT1 (Q8VZR6); Arabidopsis thaliana hexose/H + symporter STP1 (P23586); Parachlorella kessleri hexose/H + symporter HUP1 (P15686); Homo sapiens facilitated glucose transporter GLUT12 (Q8TD20); Homo sapiens H + /myo-inositol transporter GLUT13 (HMIT) (Q96QE2);...”
- Symplasmic phloem loading and subcellular transport in storage roots are key factors for carbon allocation in cassava
Rüscher, Plant physiology 2024 - “...to the work described in this paper: SUS1 Gramene: AT5G20830 SUS1 Araport: AT5G20830 INT1 Gramene: AT2G43330 INT1 Araport: AT2G43330 phloem AmiGo: PO:0005417 myo-inositol CHEBI: CHEBI:17268 SUS3 Gramene: AT4G02280 SUS3 Araport: AT4G02280 EDTA Gramene: Ethylenediamine tetraacetic acid EDTA Araport: Ethylenediamine tetraacetic acid metabolite CHEBI: CHEBI:25212 TPT Gramene:...”
- Physiological Importance of Molybdate Transporter Family 1 in Feeding the Molybdenum Cofactor Biosynthesis Pathway in Arabidopsis thaliana
Minner-Meinen, Molecules (Basel, Switzerland) 2022 - “...entry vectors. Plasma membrane localised At PIP2a (AT3G53420) [ 62 ] and tonoplast localised INT1 (AT2G43330) [ 63 ] served as negative controls. Cytosolic NSP3 (AT3G16390) [ 79 ] was used as an abundance control [ 28 ]. Fragments of CDS from these controls flanked by...”
- Genome-wide identification, expression, and association analysis of the monosaccharide transporter (MST) gene family in peanut (Arachis hypogaea L.)
Wan, 3 Biotech 2020 - “...Effect pollen and young xylem cells INT1 (AT2G43330) Impacts cell elongation AhMST57 PGLCT (AT5G16150) Affecting chloroplast AtSTP11, was a new member...”
- The Tonoplastic Inositol Transporter INT1 From Arabidopsis thaliana Impacts Cell Elongation in a Sucrose-Dependent Way
Strobl, Frontiers in plant science 2018 - “...Santa Clara, United States) and a GCMS-QP2010S-EI GC/MS-system (Shimadzu, Kyoto, Japan). Accession Numbers INT1 : At2g43330; IMPL1 : At1g31190; MIPS1 : At4g39800; MIOX2 : At2g19800; PI4K : At1g49340; PI4K 1 : At5g64070; PI4K 2 : At5g0935; PIN2 : At5g57090; PIP5K2 : At1g77740; PIP5K9 : At3g09920; PLC2...”
- A Conserved Carbon Starvation Response Underlies Bud Dormancy in Woody and Herbaceous Species
Tarancón, Frontiers in plant science 2017 - “...TRANSPORTER SWEET11 I At1g01720 ATAF1 II At5g23660 SUCROSE EFFLUX TRANSPORTER SWEET12 I At1g69490 NAP I-II-III-IV At2g43330 INOSITOL TRANSPORTER 1 II At5g39610 ORE1 I-II-III At1g22710 SUCROSE TRANSPORTER 1 (SUT1/SUC2) I At5g51070 SAG15 III At1g11260 STP1 I-lll At3g10985 SAG20 III-IV At5g61520 STP3 I At4g02380 SAG21 III At1g77210 STP14...”
- RNA-Seq and Gene Network Analysis Uncover Activation of an ABA-Dependent Signalosome During the Cork Oak Root Response to Drought
Magalhães, Frontiers in plant science 2015 - “...Xyloglucan endotransglycosylase 6 QSDrought_07044 Up AT5G57550 XTH25 Xyloglucan endotransglucosylase/hydrolase 25 Sugar:hydrogen symporter activity QSDrought_00469 Up AT2G43330 ATINT1 ATINT1 INT1 inositol transporter 1 QSDrought_00694 Up AT3G18830 ATPLT5 ATPLT5 ATPMT5 PMT5 polyol/monosaccharide transporter 5 QSDrought_01264 Down AT1G11260 STP1 ATSTP1 STP1 sugar transporter 1 QSDrought_02773 Up AT1G30220 ATINT2 ATINT2...”
- Phylloxera (Daktulosphaira vitifoliae Fitch) alters the carbohydrate metabolism in root galls to allowing the compatible interaction with grapevine (Vitis ssp.) roots
Griesser, Plant science : an international journal of experimental plant biology 2015 - “...GSVIVT01022022001 ERD6-like transporter Vverd6-like8 (at3g05150) 0.77 1.23E05 n.d. n.d. n.d. TC115303 GSVIVT01010741001 Inositol transporter VvINT1 (at2g43330) 0.65 0.0004 1.0 0.7 0.8 TC113429 GSVIVT01021530001 Inositol transporter VvINT2 (at1g30220) 0.71 0.0113 0.9 * 1.1 1.5 ** TC104946 GSVIVT01034886001 Sucrose transporter VvSUC27 (at1g22710) n.s. n.s. 0.7 ** 0.9 1.8...”
- Pre-symptomatic transcriptome changes during cold storage of chilling sensitive and resistant peach cultivars to elucidate chilling injury mechanisms
Pons, BMC genomics 2015 - “...Carbohydrate transport PPN025D11 SLT1 protein AT3G12570 FYD Sugar partioning and homeostasis PPN078G04 Putative membrane transporter AT2G43330 INT1 Sugar partioning and homeostasis Cooper transport PPN025H09 Putative copper-transporting ATPase 3 AT1G63440 HMA5 ion channel PPN023C11 Mechanosensitive ion channel AT5G10490 MSL2 Mg transport PPN001H12 MRS2-5 AT2G03620 MGT3 oligopepetide transport...”
- More
SCLAV_4529 sugar porter family MFS transporter from Streptomyces clavuligerus
31% identity, 92% coverage
CA_C1345 sugar porter family MFS transporter from Clostridium acetobutylicum ATCC 824
CAC1345 D-xylose-proton symporter from Clostridium acetobutylicum ATCC 824
29% identity, 93% coverage
- Alleviation of Carbon Catabolite Repression through araR and xylR Inactivation in Clostridium acetobutylicum DSM 792
Delarouzée, Applied and environmental microbiology 2023 (secret) - Harnessing lignocellulosic biomass for butanol production through clostridia for sustainable waste management: recent advances and perspectives
Palaniswamy, Frontiers in bioengineering and biotechnology 2023 - “...inactivating araR ( Clocel_1253 ) and xylR ( Clocel_0594 ) along with overexpressing xylT ( CA_C1345 ). The resulting strain could produce 4.96g/L of butanol from alkali-extracted corn cobs ( Wen et al., 2020 ). The bacterium C. tyrobutyricum ATCC 25755 was engineered by overexpressing the...”
- Production of butanol from lignocellulosic biomass: recent advances, challenges, and prospects
Guo, RSC advances 2022 - “...carbon flux from butyrate and acetate toward butyryl-CoA. Xylose metabolism was engineered by overexpressing xylT (CA_C1345) and inactivating xylR (Clocel_0594) and araR (Clocel_1253), and final production of butanol was increased to 4.96 g L 1 directly from alkali-extracted corncobs. 161 4.3 A strategy for engineering physiological...”
- Metabolic Engineering of Clostridium cellulovorans to Improve Butanol Production by Consolidated Bioprocessing
Wen, ACS synthetic biology 2020 (PubMed)- “...engineering was implemented by inactivating xylR (Clocel_0594) and araR (Clocel_1253), as well as overexpressing xylT (CA_C1345), which is expected to supply additional carbon and reducing power for CoA and butanol synthesis pathways. The final engineered strain produced 4.96 g/L of n-butanol from alkali extracted corn cobs...”
- Valorisation of xylose to renewable fuels and chemicals, an essential step in augmenting the commercial viability of lignocellulosic biorefineries
Narisetty, Sustainable energy & fuels 2021 - “...Along with XI, XK ( XylB , CAC2612), a xylose proton symporter ( XylT , CAC1345), and a transcriptional regulator ( XylR , CAC3673) were also sequenced and characterized. The C. acetobutylicum strains are well known to utilize a broad range of monosaccharides, disaccharides, starches, and...”
- Biochemical routes for uptake and conversion of xylose by microorganisms
Zhao, Biotechnology for biofuels 2020 - “...are not detected in the chromosome of C. acetobutylicum , and only several genes (CAC1339, CAC1345, CAC1530, CAC3422 and CAC3451) encoding sugar-proton symporters are identified [ 20 , 21 ]. These above symporter genes are distributed in the different parts of the chromosome, and located relatively...”
- Sugar uptake by the solventogenic clostridia
Mitchell, World journal of microbiology & biotechnology 2016 - “...C. acetobutylicum and C. beijerinckii. Three symporters in C. acetobutylicum , encoded by cac1339 , cac1345 and cac3451 , have been shown to be induced under conditions in which xylose is being used as a substrate (Grimmler et al. 2010 ; Servinsky et al. 2010 )....”
- “...al. 2012 ). It is therefore possible that the putative transporters encoded by cac1339 and cac1345 ( xylT ) are involved in uptake of both pentose sugars, but this has yet to be examined. Furthermore, expression of genes cac1529 and cac1530 encoding, respectively, a putative arabinosidase...”
- Bacterial xylanases: biology to biotechnology
Chakdar, 3 Biotech 2016 - “..., the xylose utilization pathway also includes a xylulokinase (XylB, CAC2612), a xylose proton-symporter (XylT, CAC1345), and a transcriptional regulator (XylR, CAC3673). xyn D and xyn T along with xyl genes are under transcriptional control of XylR. Bacteria are endowed with varying xylanolytic activity with distinct...”
- Ribulokinase and transcriptional regulation of arabinose metabolism in Clostridium acetobutylicum
Zhang, Journal of bacteriology 2012 - “...and CAC1346), araD (CAC1341), and araE (CAC1339 and CAC1345) genes in the araR-inactivated mutant were elevated more than 17-fold compared to that of the...”
- “...for two putative arabinose protonsymporters (CAC1339 and CAC1345), which are considered to be responsible for arabinose uptake. Our previous genetic mutagenesis...”
- Pleiotropic functions of catabolite control protein CcpA in Butanol-producing Clostridium acetobutylicum
Ren, BMC genomics 2012 - “...product Change fold (824ccpA/824WT) Middle exponential phase (M) Stationary phase (S) Microarray qRT-PCR* Microarray qRT-PCR* CAC1345 xylT l -arabinose-proton symporter 71.6 92.522.55 147.39 326.54176.86 CAC2612 xylB Xylulose kinase 26.9 20.44.00 17.9 21.210.02 CAC1348 tkt1 Transketolase 5.6 4.420.23 7.9 6.40.21 CAC1941 abrB1941 Stationary/sporulation gene regulator 5.1 89.177.31...”
- “...most of the genes necessary for l -arabinose uptake and metabolism, including araE1/araE2 (CAC1339 and CAC1345, encoding l -arabinose-proton symporter), araA1/araA2 (CAC1342 and CAC1346, encoding l -arabinose isomerase), araK (CAC1344, encoding ribulokinase) [ 44 ], araD (CAC1341, encoding l -ribulose-5-phosphate 4-epimerase), epi (CAC1349, encoding aldose 1-epimerase)...”
- Confirmation and elimination of xylose metabolism bottlenecks in glucose phosphoenolpyruvate-dependent phosphotransferase system-deficient Clostridium acetobutylicum for simultaneous utilization of glucose, xylose, and arabinose
Xiao, Applied and environmental microbiology 2011 - “...overcome by co-overexpression of the D-xylose proton-symporter (cac1345), D-xylose isomerase (cac2610), and xylulokinase (cac2612). As a result, an engineered...”
- “...promoter Derived from pIMP1-Pthl, with xylT gene (cac1345) expressing cassette added Derived from pIMP1-Pthl, with xylA gene (cac2610) expressing cassette added...”
- Reconstruction of xylose utilization pathway and regulons in Firmicutes
Gu, BMC genomics 2010 - “...acetobutylicum the xylose utilization pathway also includes a xylulokinase (XylB, CAC2612), a xylose proton-symporter (XylT, CAC1345), and a transcriptional regulator (XylR, CAC3673). The predicted functions of these genes in C. acetobutylicum were experimentally confirmed through a combination of genetic and biochemical techniques. We conclusively showed that...”
- “...of Bacilli/Clostridia have been annotated as xylose proton-symporter in the public databases ( e.g . CAC1345 of C. acetobutylicum ). In this study XylT was tentatively identified in more species such as C. beijerinckii . This functional assignment is supported by the conserved co-localization on the...”
An11g05280 uncharacterized protein from Aspergillus niger
27% identity, 85% coverage
AL01_02185 sugar porter family MFS transporter from Bombella intestini
33% identity, 77% coverage
AT1G08890 sugar transporter family protein from Arabidopsis thaliana
30% identity, 94% coverage
- Responsiveness of Early Response to Dehydration Six-Like Transporter Genes to Water Deficit in Arabidopsis thaliana Leaves
Slawinski, Frontiers in plant science 2021 - “...(At2g48020), AtESL2.02 (At3g5150), and AtESL2.03 (At5g18840), AtESL3.01 (At1g54730), AtESL3.02 (At4g4750), AtESL3.03 (At4g04760), AtESL3.04 (At3g20460), AtESL3.05/ESL3 (At1g08890), AtESL3.06/ESL2 (At1g08900), AtESL3.07/ESL1 (At1g08920) , AtESL3.08/ERD6 (At1g08930) , AtESL3.10 (At3g05400), AtESL3.11 (At3g05160), AtESL3.13/SFP1 (At5g27350), and AtESL3.14/SFP2 (At5g27360) of other vacuolar SUTs: AtSWEET16 (At3g16690), AtSWEET17 (At4g15920), AtTMT1 (At1g20840), AtTMT2 (At4g35300), AtSUC4...”
- Early Response to Dehydration Six-Like Transporter Family: Early Origin in Streptophytes and Evolution in Land Plants
Slawinski, Frontiers in plant science 2021 - “...ESL3.02 ESL3b B6b At4g04760 AtERD6-Like 15 ESL3.03 ESL3b B7 At3g20460 AtERD6-Like 13 ESL3.04 ESL3C B8a At1g08890 AtERD6-Like 1 ESL3.0S/ESL3 ESL3C B8b At1g08900 AtERD6-Like 2 ESL3.06/ESL2 ESL3C B9a At1g08920 AtERD6-Like 3 ESL3.07/ESL1 ESL3C B9b At1g08930 AtERD6 ESL3.08/ERD6 ESL3C B10a At3g05400 AtERD6-Like 12 ESL3.09 ESL3C B10b At3g05155 AtERD6-Like...”
- Genome-Wide Identification and Expression Profiling of Monosaccharide Transporter Genes Associated with High Harvest Index Values in Rapeseed (Brassica napus L.)
Zhang, Genes 2020 - “...AtMST genes matched the BnMST genes, whereas the three remaining AtMST genes ( At3G05160 , At1G08890 ( AtERD6-like subfamily ), and At1G05030 ( AtpGlcT subfamily )) lacked homologs in B. napus ( Table 2 ). Detailed information about the BnMST genes is provided in Table S3...”
- CBF-dependent and CBF-independent regulatory pathways contribute to the differences in freezing tolerance and cold-regulated gene expression of two Arabidopsis ecotypes locally adapted to sites in Sweden and Italy
Park, PloS one 2018 - “...69.5 92.6 AT3G05660 AtRLP33 79.9 70 95.0 AT4G12470 AZI1|azelaic acid induced 1 77.5 65.4 70.3 AT1G08890 Major facilitator superfamily protein 74.6 82 87.5 AT1G51090 Heavy metal transport/detoxification 74.3 60.6 89.2 AT5G15960 KIN1 74.2 95.1 91.7 AT5G17460 unknown protein 72.8 76.3 84.5 AT1G46768 RAP2.1 71.5 75.5 88.1...”
LOC18046354 sugar transporter ERD6-like 7 from Citrus x clementina
29% identity, 90% coverage
- Transcriptome analysis of Harumi tangor fruits: Insights into interstock-mediated fruit quality
Liao, Frontiers in plant science 2022 - “...). Genes encoding cytochrome P450 reductase ( ATR2 , LOC18055638), the sugar transporter ERD6-like 7 (LOC18046354), l -ascorbate peroxidase 3 ( APX3 , LOC18035392), tryptophan aminotransferase-related protein 3 (LOC18043155), uridine nucleosidase 1 ( URH1 , LOC18038155), tryptophan synthase chain ( TSA1 , LOC18046349), and NADH dehydrogenase...”
Tanf_07060 D-xylose transporter XylE from Tannerella forsythia
29% identity, 92% coverage
LOC104891046 sugar transporter ERD6-like 5 from Beta vulgaris subsp. vulgaris
29% identity, 94% coverage
GOX0649 Sugar-proton symporter from Gluconobacter oxydans 621H
28% identity, 92% coverage
TC 2.A.1.1.36 / Q400D8 The low affinity, glucose-inducible glucose transporter, MstE from Emericella nidulans (Aspergillus nidulans) (see paper)
mstE low affinity glucose transporter MstE from Emericella nidulans (see paper)
31% identity, 79% coverage
- substrates: glucose
- CharProtDB Description: Low affinity glucose transporter of the major facilitator superfamily (MFS); Source:AspGD
ESL1_ARATH / Q94KE0 Sugar transporter ESL1; Protein EARLY-RESPONSIVE TO DEHYDRATION 6-LIKE 1; ERD six-like 1; Sugar transporter ERD6-like 3; Sugar transporter-like protein 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 93% coverage
- function: Sugar transporter. Transports monosaccharides across the vacuolar membrane independently from a proton gradient. May function coordinately with the vacuolar invertase to regulate osmotic pressure by affecting the accumulation of sugar in the cells under abiotic stress conditions.
disruption phenotype: No effect on the root lengths compared to those of wild-type plant under high salinity conditions. - Proteome-Wide Analysis of Heat-Stress in Pinus radiata Somatic Embryos Reveals a Combined Response of Sugar Metabolism and Translational Regulation Mechanisms.
Castander-Olarieta, Frontiers in plant science 2021 - “...2.27 Ribulose bisphosphate carboxylase/oxygenase activase A Q40073 0.68 0.52 0.77 0.02 2.35 Sugar transporter ESL1 Q94KE0 1.19 1.77 1.49 0.021 1.85 Casein kinase II subunit alpha-2 Q9AR27 0.63 0.71 1.13 0.021 1.67 Protein translation factor SUI1 homolog Q9SM41 1.02 1.23 1.21 0.021 1.96 Probable RNA-binding protein...”
NP_708708 MFS family galactose:proton symporter from Shigella flexneri 2a str. 301
29% identity, 92% coverage
M1AVD3 Mannitol transporter from Solanum tuberosum
29% identity, 87% coverage
- Automated identification of reference genes based on RNA-seq data
Carmona, Biomedical engineering online 2017 - “...Calcium-dependent protein kinase 4 Solanum tuberosum rp11_olive_008079 239 204 197 343 275 263 19.34 253.5 M1AVD3 Uncharacterized protein Solanum tuberosum rp11_olive_008883 128 119 144 187 108 118 19.51 134 Q9LZI2 UDP-glucuronic acid decarboxylase 2 Arabidopsis thaliana rp11_olive_035033 178 166 224 177 285 199 19.76 204.8 P62201...”
D9T18_05400 sugar porter family MFS transporter from Pseudoalteromonas agarivorans
30% identity, 92% coverage
- Pan-Genomic and Transcriptomic Analyses of Marine Pseudoalteromonas agarivorans Hao 2018 Revealed Its Genomic and Metabolic Features
Jv, Marine drugs 2022 - “...shown in Table 2 , the expression levels of genes encoding sugar transporters (D9T18_18920 and D9T18_05400) at 2 h were higher than those at 24 h. Monosaccharides need to be converted into corresponding nucleotide sugars before they can be used to synthesize EPS. Upon analysis of...”
- “...Annotation Locus Tag 2 h_RPKM 24 h_RPKM glucose/galactose MFS transporter D9T18_18920 210.32 90.40 MFS transporter D9T18_05400 150.59 42.61 marinedrugs-20-00248-t003_Table 3 Table 3 Gene expression related to nucleotide sugar synthesis. Annotation Locus Tag 2 h_RPKM 24 h_RPKM UDP-glucuronate-epimerase D9T18_02060 188.19 45.88 dTDP-4-dehydrorhamnose 3,5-epimerase D9T18_02110 657.00 66.08 dTDP-4-dehydrorhamnose...”
CH1034_220103 sugar porter family MFS transporter from Klebsiella pneumoniae
30% identity, 93% coverage
ATEG_03527 uncharacterized protein from Aspergillus terreus NIH2624
30% identity, 79% coverage
- Transcriptome Profiling-Based Analysis of Carbohydrate-Active Enzymes in Aspergillus terreus Involved in Plant Biomass Degradation
Corrêa, Frontiers in bioengineering and biotechnology 2020 - “...during the 48 h incubation period, namely ATEG_07791, ATEG_03475, ATEG_07105, ATEG_04988, ATEG_01556, ATEG_07124, ATEG_08653, ATEG_07144, ATEG_03527, ATEG_02489, ATEG_07114, ATEG_04070, ATEG_07053, ATEG_04137, ATEG_03190, and ATEG_05008. RT-qPCR Validation of in silico RNA-Seq Transcriptome Data Expression profiles for selected A. terreus CAZyme-encoding and other genes significantly up-regulated on SB...”
Afu2g05190 MFS monosaccharide transporter, putative from Aspergillus fumigatus Af293
27% identity, 84% coverage
- Evolutionary Analysis of Sequence Divergence and Diversity of Duplicate Genes in Aspergillus fumigatus
Yang, Evolutionary bioinformatics online 2012 - “...1.43 [0.77, 2.58] Afu1g16080 2.53 [0.27, 3.04] Afu5g14990 2.78 [2.06, 0.45] Afu5g00280 2.43 [0.27, 2.94] Afu2g05190 0.61 [1.22, 2.18] Afu7g01690 2.41 [0.35, 3.07] Afu8g05220 2.61 [2.09, 0.65] Afu3g00670 2.39 [0.59, 3.44] Afu5g13060 2.60 [2.05, 0.60] Afu6g12820 2.37 [2.06, 6.42] Afu2g12200 0.65 [1.79, 1.77] Afu6g02420 2.35 [2.02,...”
Q8T0T6 GH09052p from Drosophila melanogaster
32% identity, 80% coverage
- Comparative proteomics analysis of dietary restriction in Drosophila
Gao, PloS one 2020 - “...5.83E-01 2.01E-02 8.26E-01 1.40E-05 FBgn0012042 Q95NP8 multi-organism process - - -1.15E+00 2.00E-04 -7.63E-01 3.03E-04 FBgn0037386 Q8T0T6 intrinsic to membrane - - -9.05E-01 1.10E-03 -4.19E-01 4.88E-02 FBgn0035542 A8JNK7 RNA processing - - 1.04E+00 6.75E-03 4.17E-01 2.73E-02 4. Discussion In this study, LC-MS/MS was used to determine the...”
BBA_03013 hexose transporter from Beauveria bassiana ARSEF 2860
28% identity, 84% coverage
- Nuclear Ssr4 Is Required for the In Vitro and In Vivo Asexual Cycles and Global Gene Activity of Beauveria bassiana
Shao, mSystems 2020 - “...the pentose phosphate pathway and the Calvin cycle ( 38 ), six hexose transporters (BBA_05766, BBA_03013, BBA_00397, BBA_09477, BBA8728, and BBA5674) critical for glucose uptake ( 39 ), and most of the glycosyl hydrolases (BBA_03946, BBA_05847, BBA_09379, and BBA_08796) involved in the hydrolysis of glycosidic bonds,...”
An05g01290 uncharacterized protein from Aspergillus niger
30% identity, 84% coverage
- Evaluation of Aspergillus niger Six Constitutive Strong Promoters by Fluorescent-Auxotrophic Selection Coupled with Flow Cytometry: A Case for Citric Acid Production
Lu, Journal of fungi (Basel, Switzerland) 2022 - “...starch hydrolysis, glucose uptake, and glycolysis, such as amyA (An12g06930), glaA (An03g06550), mstC (An02g03540), mstG (An05g01290), mstH (An15g03940), pfkB (An07g02100), and ppcA (An11g02550) ( Table 2 ). As to intracellular citrate transportation, mitochondrial citrate/malate carrier protein CtpA (An11g11230) was also synergistically upregulated ( Table 2 )....”
- “...An03g06550 glaA Glucoamylase 2.83 6.49 2.29 An02g03540 mstC Low affinity glucose transporter 1.25 1.58 1.26 An05g01290 mstG High affinity glucose transporter 1.25 1.39 1.11 An15g03940 mstH High affinity glucose transporter 2.73 5.75 2.11 An04g06910 amyR Transcription factor 2.35 2.59 1.10 An08g02260 pgkA Phosphoglycerate kinase 1.32 1.37...”
- In Silico Analysis of Putative Sugar Transporter Genes in Aspergillus niger Using Phylogeny and Comparative Transcriptomics
Peng, Frontiers in microbiology 2018 - “...D -glucose transporter encoding gene mstC (An02g03540) and high-affinity D -glucose transporter encoding gene mstG (An05g01290) were higher expressed on hexose substrates than other monosaccharides. The D -galacturonic acid transporter encoding genes gatA (An14g04280) ( Sloothaak et al., 2014 ) and the D -xylose transporter encoding...”
- Metabolic activity in dormant conidia of Aspergillus niger and developmental changes during conidial outgrowth
Novodvorska, Fungal genetics and biology : FG & B 2016 - “...putative glucose/hexose transporters ( Pel et al., 2007 ) transcription of 5 genes (An02g03540, An15g03940, An05g01290, An16g08940, An02g01270) was highly upregulated at T1. The most upregulated was the homolog of A. nidulans mstE , (An02g03540) encoding a low affinity glucose transporter. Transcription of mstA encoding a...”
- “...lower transcript levels in the sorbic acid condition than in the control sample, apart from An05g01290. Glucokinase (An12g08610) is a high affinity glucose phosphorylating enzyme necessary for the activation of intracellular glucose and it plays an important role in the germination process especially in low glucose...”
Lreu_0479 sugar porter family MFS transporter from Limosilactobacillus reuteri subsp. reuteri
Lreu_0479 sugar transporter from Lactobacillus reuteri DSM 20016
29% identity, 95% coverage
STP9_ARATH / Q9SX48 Sugar transport protein 9; Hexose transporter 9 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
stp9 / CAC69072.1 STP9 protein from Arabidopsis thaliana (see paper)
AT1G50310 STP9 (SUGAR TRANSPORTER 9); carbohydrate transmembrane transporter/ sugar:hydrogen symporter from Arabidopsis thaliana
27% identity, 89% coverage
- function: Mediates an active uptake of hexoses, probably by sugar/hydrogen symport. Mostly transports glucose, and barely galactose, xylose and mannose.
- Exploration of Sugar and Starch Metabolic Pathway Crucial for Pollen Fertility in Rice
Lee, International journal of molecular sciences 2022 - “...the hexose transporters resulted in male sterility. A T-DNA insertion mutant of Arabidopsis AtSTP9 ( At1g50310 ), a monosaccharide transporter that is expressed specifically in pollen, was not male-sterile [ 20 ]. A group of SWEET efflux transporters is also involved in the capability of transporting...”
- Rho GTPase ROP1 Interactome Analysis Reveals Novel ROP1-Associated Pathways for Pollen Tube Polar Growth in Arabidopsis
Li, International journal of molecular sciences 2020 - “...transporters were found for transmembrane trafficking of nutrients and energy, such as STP4&STP9 (AT3G19930 and AT1G50310) for sucrose and AT1G71680 for amino acids. 3.4. ROP1 Signaling and Endocytosis Exocytosis of secretory vesicles is critical for pollen tube expansion by supplying membrane, cell wall components, and other...”
- Plant glucose transporter structure and function
Geiger, Pflugers Archiv : European journal of physiology 2020 - “...and ovules Plasma membrane Glucose, galactose, mannose, arabinose High [ 122 , 123 ] AtSTP9 At1g50310 Fully developed pollen grain Plasma membrane Glucose, galactose, arabinose High [ 122 , 131 ] AtSTP10 At3g19940 Germinating pollen and growing pollen Plasma membrane Glucose, galactose, mannose, High [ 109...”
- Genome-Wide Identification and Expression Profiling of Sugar Transporter Protein (STP) Family Genes in Cabbage (Brassica oleracea var. capitata L.) Reveals their Involvement in Clubroot Disease Responses
Zhang, Genes 2019 - “...Bol000550 Scaffold000531 MF1 1545 514 56.99 8.99 38.20 102.80 0.56 cell membrane tPCK1 C AtSTP9 AT1G50310 1554 517 BoSTP9a Bol010165 C07 LF 1551 516 56.27 6.89 32.15 99.01 0.53 cell membrane BoSTP9b Bol014014 Scaffold000180 MF2 1551 516 56.15 6.89 33.77 101.67 0.54 cell membrane tPCK2 F...”
- Modulation of Auxin Levels in Pollen Grains Affects Stamen Development and Anther Dehiscence in Arabidopsis
Salinas-Grenet, International journal of molecular sciences 2018 - “...STP2 , At1g07340), intermediate pollen promoter 1 (from the sugar transporter 9 gene, STP9 , At1g50310), intermediate pollen promoter 2 (from the pollen-specific gene 2 gene, PSG2 , At1g28550), and late pollen promoter (from the phosphatase and tensin homolog deleted on chromosome 10 gene, PTEN1 ,...”
- Analysis of miRNAs and their targets during adventitious shoot organogenesis of Acacia crassicarpa
Liu, PloS one 2014 - “...superfamily protein MIR2592 AT4G11040 3 Protein phosphatase 2C family protein MIR2916 AT1G15780 3 unknown protein AT1G50310 3 sugar transporter 9 AT1G65875 3 pseudogene AT1G66120 3 AMP-dependent synthetase and ligase family protein AT4G00450 3 RNA polymerase II transcription mediators AT5G66710 3 Protein kinase superfamily protein MIR4414 AT2G04860...”
- The pectin lyases in Arabidopsis thaliana: evolution, selection and expression profiles
Cao, PloS one 2012 - “...AT1G23460 had 36 ( Table S3 ). Some of these interacting genes include AtSTP9 ( AT1G50310 ), IRT1 ( AT5G43370 ), AT3G09820 ( ADK1 , adenosine kinase 1), LOS2 ( AT2G36530 ), and flagellin-sensitive 2 ( FLS2 , AT5G46330 ). AtSTP9 encodes a member of sugar...”
- Proline is required for male gametophyte development in Arabidopsis
Mattioli, BMC plant biology 2012 - “...is high at tricellular stage and low in mature pollen [ 35 ] and AtSTP9 (AT1G50310), whose gene product can only be detected by immunofluorescence microscopy after the onset of germination [ 36 ]. In addition, as above stated, high levels of expression of either P5CS1...”
- More
b2943 galactose:H+ symporter (galP) from Escherichia coli BW25113
GalP / b2943 galactose:H+ symporter from Escherichia coli K-12 substr. MG1655 (see 6 papers)
GalP / P0AEP1 galactose:H+ symporter from Escherichia coli (strain K12) (see 7 papers)
GALP_ECOLI / P0AEP1 Galactose-proton symporter; Galactose transporter from Escherichia coli (strain K12) (see paper)
TC 2.A.1.1.1 / P0AEP1 Galactose:H+ symporter, GalP. Also transports glucose, xylose, fucose (6-deoxygalactose), 2-deoxygalactose and 2-deoxyglucose) (Henderson and Giddens 1977; from Escherichia coli (strain K12)
b2943 D-galactose transporter from Escherichia coli str. K-12 substr. MG1655
NP_417418 galactose:H(+) symporter from Escherichia coli str. K-12 substr. MG1655
DK885_04375, ETEC_3133 galactose/proton symporter from Escherichia coli ETEC H10407
29% identity, 92% coverage
- mutant phenotype: A characterized E. coli protein, see EcoCyc. Not sure why SEED has it as transporting arabinose. .
- function: Uptake of galactose across the boundary membrane with the concomitant transport of protons into the cell (symport system)
- substrates: D-galactose, Galactose
tcdb comment: Henderson et al. 1977; Hernández-Montalvo et al., 2001). Relative substrate affinities of wild-type and mutant forms of the E. coli sugar transporter GalP have been determined by solid-state NMR (Patching et al., 2008). GalP may exist as a trimer with each subunit having a sugar transporting channel (Zheng et al. 2010) - Automated characterization and analysis of expression compatibility between regulatory sequences and metabolic genes in Escherichia coli
Wen, Synthetic and systems biotechnology 2024 - “...b2388 glk Glucokinase b2913 serA Phosphoglycerate dehydrogenase b2914 rpiA Ribose-5-phosphate isomerase A b2935 tktA Transketolase b2943 galP Galactose/H+ symporter b3041 ribB 3,4-Dihydroxy-2-butanone-4-phosphate synthase b3916 pfkA 6-Phosphofructokinase 1 b3919 tpiA Triose-phosphate isomerase b4025 pgi Glucose-6-phosphate isomerase b3956 ppc Phosphoenolpyruvate carboxylase b4090 rpiB Ribose-5-phosphate isomerase b3386 rpe Ribulose...”
- “...wide range of fluorescence intensities with different regulatory sequences. However, the fluorescence levels of genes b2943 (encoding a galactose:H + symporter) and b3952 (encoding a pyruvate formate lyase activating enzyme) remained relatively low. This may be due to these genes being subject to relatively strict regulation....”
- Systems Biology Approach to Bioremediation of Nitroaromatics: Constraint-Based Analysis of 2,4,6-Trinitrotoluene Biotransformation by Escherichia coli
Iman, Molecules (Basel, Switzerland) 2017 - “...GLCt2pp D-glucose transport in via proton symport (periplasm) glc-D[p] + h[p] -> glc-D[c] + h[c] b2943 NH4tpp Ammonia reversible transport (periplasm) nh4[p] <=> nh4[c] (b0451 or s0001) TPI Triose-phosphate isomerase dhap[c] <=> g3p[c] b3919 GLYCDx Glycerol dehydrogenase glyc[c] + nad[c] -> dha[c] + h[c] + nadh[c]...”
- Combinatorial strategies for improving multiple-stress resistance in industrially relevant Escherichia coli strains
Lennen, Applied and environmental microbiology 2014 - “...Description Fold change b0463 b0121 b2095 b4240 b3415 b2664 b2943 ECD_01942 b2028 b4114 b2845 b2663 acrA speE gatZ treB gntT csiR galP vioA ugd eptA yqeG gabP...”
- Transcription, translation, and the evolution of specialists and generalists
Zhong, Molecular biology and evolution 2009 - “...in Ancestors TD2 and TD10 b-Number b0719 b0879 b1639 b2943 b3287 b3306 b3508 SE, standard error. log2 LU/MG SE Gene Function 0.45 0.51 0.66 0.52 0.36 0.66...”
- Physiological studies of Escherichia coli strain MG1655: growth defects and apparent cross-regulation of gene expression
Soupene, Journal of bacteriology 2003 - “...resulted in higher levels of expression of: galP (b2943), which codes for a low-affinity galactose transporter; the mglBAC operon (b2150 to b2148), which codes...”
- “...12 10 2.1 2.9 6.4 3.6 1.5 1.4 b2151 galS 1.3 3.3 b2943 galP 2.8 3.9 b2150 b2149 b2148 mglB mglA mglC 3.6 2.6 0.8 13 7.3 4.9 b4120 b4119 b4118 melB melA melR 1.0...”
- Escherichia coli gene expression responsive to levels of the response regulator EvgA
Masuda, Journal of bacteriology 2002 - “...b0553 nmpC b2167 b2168 b2169 fruA fruK fruB b2943 galP Mean Outer membrane porin protein; locus of qsr prophage PTS system, fructose-specific transport protein...”
- Kinetic analysis of the inhibition of the drug efflux protein AcrB using surface plasmon resonance.
Mowla, Biochimica et biophysica acta. Biomembranes 2018 (PubMed) - The prototypical H+/galactose symporter GalP assembles into functional trimers.
Zheng, Journal of molecular biology 2010 - GeneRIF: Each monomer in the trimer forms its own channel, but an additional cavity (10 approximately 15 A in diameter) is apparent at the 3-fold axis of the oligomer.
- Unfolding free energy of a two-domain transmembrane sugar transport protein.
Findlay, Proceedings of the National Academy of Sciences of the United States of America 2010 - GeneRIF: Unfolding free energy of a two-domain transmembrane sugar transport protein, GalP.
- Repression of galP, the galactose transporter in Escherichia coli, requires the specific regulator of N-acetylglucosamine metabolism.
El, Molecular microbiology 2009 (PubMed)- GeneRIF: galP is repressed by a combination of NagC, GalR and GalS.
- Relative substrate affinities of wild-type and mutant forms of the Escherichia coli sugar transporter GalP determined by solid-state NMR.
Patching, Molecular membrane biology 2008 (PubMed)- GeneRIF: effects of the galP mutations W56F, W239F, R316W, T336Y and W434F on glucose binding
- Contribution of Stenotrophomonas maltophilia MfsC transporter to protection against diamide and the regulation of its expression by the diamide responsive repressor DitR
Boonyakanog, PloS one 2022 - “...AraE (P0AE24), Bcr (P28246), Blt (P39843), Bmr (P33449), CmlA (Q83V15), EmrD (P31442), EmrD-3 (C3LUT7), GalP (P0AEP1), LacY (P02920), LmrP (Q48658), MdfA (P0AEY8), MdtG (P25744), MhpT (P77589), NorA (P0A0J7), TetA (P02981), XylE (P0AGF4), YicM (J7R7Q1). mfsC mutant is susceptible to diamide To evaluate the physiological function of...”
- Proton-coupled sugar transport in the prototypical major facilitator superfamily protein XylE
Wisedchaisri, Nature communications 2014 - “...XylE (P0AGF4); Lactobacillus brevis D -xylose/H + symporter XylT (O52733); Escherichia coli galactose permease GalP (P0AEP1); Escherichia coli arabinose permease AraE (P0AE24); Bacillus subtilis myo-inositol/H + transporter IolT (O34718); Arabidopsis thaliana inositol/H + symporter INT1 (Q8VZR6); Arabidopsis thaliana hexose/H + symporter STP1 (P23586); Parachlorella kessleri hexose/H...”
- A Novel SXT/R391 Integrative and Conjugative Element Carries Two Copies of the blaNDM-1 Gene in Proteus mirabilis
He, mSphere 2021 - “...encoding 4-oxalomesaconate tautomerase (DK885_16125), bifunctional aldehyde dehydrogenase (DK885_12690), hydrogenase-4 component J (DK885_06720), and galactose-proton symporter (DK885_04375) was noticeable, whereas genes for multidrug resistance protein (MdtL), guanine/hypoxanthine permease (GhxQ), and cold shock protein (CspB) were expressed at lower levels in XH1814. We also compared gene expression levels...”
- The molecular basis for control of ETEC enterotoxin expression in response to environment and host
Haycocks, PLoS pathogens 2015 - “...) ( ygfI ) 3382158 TGTGA TCTACAA CAC G ETEC_3126 cmtB 3390811 TGTGA TTTGCT TCACA ETEC_3133 galP 3408173 TGTGA TGTGGA T A ACA ETEC_3154 nupG 3442697 TGTGA TGATTG TC G CA ETEC_3186 ETEC-specific 3558573 A GTGA TTTGGC TCACA ETEC_3291 ygiS 3580767 A GTGA CTTGCA TCACA (...”
XP_025453682 general substrate transporter from Aspergillus niger CBS 101883
30% identity, 84% coverage
AT2G20780 mannitol transporter, putative from Arabidopsis thaliana
30% identity, 89% coverage
- Transcriptomic and proteomic approach to identify differentially expressed genes and proteins in Arabidopsis thaliana mutants lacking chloroplastic 1 and cytosolic FBPases reveals several levels of metabolic regulation
Soto-Suárez, BMC plant biology 2016 - “...family proteins (At3g05155, At4g04760, At3g19940) were up-regulated in cyfbp rosettes, and only a mannitol transporter (At2g20780) was down-regulated. Finally, a carbohydrate transmembrane transporter (At1g08930) and two UDP-galactose transporters (At4g23010 and At3g59360) were up-regulated in cyfbp roots, whereas two monosaccharide transporters were down-regulated in this organ (At1g34580...”
- Identification of miRNAs and Their Targets in the Liverwort Marchantia polymorpha by Integrating RNA-Seq and Degradome Analyses
Lin, Plant & cell physiology 2016 - “...LW9386 NA AT1G48380 HYPOCOTYL 7 LW28862 NA EFJ23241 NA LW798 NA AT2G27290 NA LW8919 NA AT2G20780 Carbohydrate transmembrane transporter activity LW3390 NA AT1G55350 DEFECTIVE KERNEL 1 LW2282 NA AT4G38160 PIGMENT DEFECTIVE 191 LW3379 NA AT1G75200 Radical SAM domain-containing protein LW769 NA AT5G47390 MYB HYPOCOTYL ELONGATION-RELATED Mpo-miR11698.1...”
- A meta-analysis reveals the commonalities and differences in Arabidopsis thaliana response to different viral pathogens
Rodrigo, PloS one 2012 - “...performed in Col-0. Only seven genes ( At1g14970 , At1g50250 , At1g78170 , At2g16700 , At2g20780 , At3g45860 , and At4g12520 ) had expression levels that were significantly affected by the host ecotype (Mann-Whitney test). However, if a correction for multiple testing (FDR procedure; adjusted P...”
- The Vitis vinifera sugar transporter gene family: phylogenetic overview and macroarray expression profiling
Afoufa-Bastien, BMC plant biology 2010 - “...(AtINT3), At4g16480 (AtINT4), At3g03090 (AtVGT1), At5g17010 (AtVGT2), At5g59250 (AtVGT3), At2g16120 (AtPMT1), At2g16130 (AtPMT2), At2g18480 (AtPMT3), At2g20780 (AtPMT4), At3g18830 (AtPMT5), At4g36670 (AtPMT6); for Vitis ones see Additional file 1 . Vitis ORFs names were simplified, Vv indicating GSVIVT000. Vitis vinifera putative Polyol/Monosaccharide Transporters (VvPMT; subfamily III) Five...”
Cbei_4545 sugar transporter from Clostridium beijerincki NCIMB 8052
28% identity, 91% coverage
AT3G05160 sugar transporter, putative from Arabidopsis thaliana
29% identity, 94% coverage
- Transcriptome analysis of Pará rubber tree (H. brasiliensis) seedlings under ethylene stimulation
Nakano, BMC plant biology 2021 - “...2.01 2.93 2.45 0 bx037209 AT2G48020 Major facilitator superfamily protein 2.01 2.98 2.49 2 bx019596 AT3G05160 Major facilitator superfamily protein 1.84 2.66 1.41 Sucrose-proton symporter, SUS, SWEET family 4 bx012374 AT1G22710 SUT1 0.83 1.54 2.59 4 bx013239 AT1G22710 SUT1 0.83 1.30 2.41 5 bx049225 AT5G50790 SWEET10...”
- Early Response to Dehydration Six-Like Transporter Family: Early Origin in Streptophytes and Evolution in Land Plants
Slawinski, Frontiers in plant science 2021 - “...ESL3.08/ERD6 ESL3C B10a At3g05400 AtERD6-Like 12 ESL3.09 ESL3C B10b At3g05155 AtERD6-Like 9 ESL3.10 ESL3C B11a At3g05160 AtERD6-Like 10 ESL3.11 ESL3C B11a At3g05165 At3g05165 ESL3.12 ESL3C B11b At5g27350 AtERD6-Like 17 ESL3.13/SFP1 ESL3C B11c At5g27360 AtERD6-Like 18 ESL3.14/SFP2 Figure 11 The relative expression of 17 A. thaliana ESL...”
- Responsiveness of Early Response to Dehydration Six-Like Transporter Genes to Water Deficit in Arabidopsis thaliana Leaves
Slawinski, Frontiers in plant science 2021 - “...AtESL3.04 (At3g20460), AtESL3.05/ESL3 (At1g08890), AtESL3.06/ESL2 (At1g08900), AtESL3.07/ESL1 (At1g08920) , AtESL3.08/ERD6 (At1g08930) , AtESL3.10 (At3g05400), AtESL3.11 (At3g05160), AtESL3.13/SFP1 (At5g27350), and AtESL3.14/SFP2 (At5g27360) of other vacuolar SUTs: AtSWEET16 (At3g16690), AtSWEET17 (At4g15920), AtTMT1 (At1g20840), AtTMT2 (At4g35300), AtSUC4 (At1g09960), and AtVGT2 (At5g17010), and of vacuolar invertases At Fruct3 (At1g62660) and...”
- Genome-Wide Identification and Expression Profiling of Monosaccharide Transporter Genes Associated with High Harvest Index Values in Rapeseed (Brassica napus L.)
Zhang, Genes 2020 - “...only 50 AtMST genes matched the BnMST genes, whereas the three remaining AtMST genes ( At3G05160 , At1G08890 ( AtERD6-like subfamily ), and At1G05030 ( AtpGlcT subfamily )) lacked homologs in B. napus ( Table 2 ). Detailed information about the BnMST genes is provided in...”
- Genome wide transcriptome analysis reveals ABA mediated response in Arabidopsis during gold (AuCl(-) 4) treatment
Shukla, Frontiers in plant science 2014 - “...C2H2 At3g28210 NA PMZ C2H2 At2g21400 NA SRS3 C2H2 At3g49930 NA C2H2 At3g05155 NA C2H2 At3g05160 NA C3H At5g05530 NA C3H At5g42200 NA C3H At1g14200 NA C3H At5g55970 NA Homeobox At1g70920 HD-Zip II ATHB18 Homeobox At3g61890 AtHB12 HD-Zip I ATHB-12, ATHB12 Trihelix At5g01380 NA GT-3a Trihelix...”
- Divergent evolutionary and expression patterns between lineage specific new duplicate genes and their parental paralogs in Arabidopsis thaliana
Wang, PloS one 2013 - “...flower enriched NDG At3g49420 , vegetative tissue enriched NDG At4g21460 and the root enriched NDG At3g05160 and AT3G23510 came from parental genes which had non-specific expression. The root enriched parental gene At4g23430 , the flower enriched parental gene At2g05310 , the silique enriched parental gene At5g25757...”
- “...embryo development [85] , however Ag3g55490 (the parental genes) did not share this pattern. (4) At3g05160 (the NDG) has been demonstrated to play a part in an auxin regulatory circuit involved in the control of a hypo-sulphur stress [86] , while At3g05165 (the parental gene) has...”
- Common and unique elements of the ABA-regulated transcriptome of Arabidopsis guard cells
Wang, BMC genomics 2011 - “...5.2E-08 2.7 AT1G74040 IMS1 IMS1; 2-isopropylmalate synthase 5.4E-08 3.7 AT1G17230 protein binding/protein kinase 5.5E-08 3.4 AT3G05160 sugar transporter, putative 5.9E-08 4.8 AT2G37420 kinesin motor protein-related 6.0E-08 11.0 AT1G63120 ATRBL2 ARABIDOPSIS THALIANA RHOMBOID-LIKE 2 6.3E-08 3.1 AT5G64560 magnesium transporter CorA-like family protein 8.8E-08 2.4 AT5G63620 zinc-binding dehydrogenase...”
- “...guard cells [ 74 ]. The observed repression of STP1 and the putative sugar transporter AT3G05160 by ABA might also contribute to long-term inhibition of stomatal opening. GO functional analysis The GO category lipid metabolic processes is over-represented in ABA-induced genes of guard cells and leaves....”
LEUM_0853 D-xylose proton-symporter from Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
30% identity, 95% coverage
FGSG_05042, XP_011323525 hypothetical protein from Fusarium graminearum PH-1
30% identity, 84% coverage
- FgFAD12 Regulates Vegetative Growth, Pathogenicity and Linoleic Acid Biosynthesis in Fusarium graminearum
Zhang, Journal of fungi (Basel, Switzerland) 2024 - “...RNA-seq data, decreased expression levels of genes in the Fgfad12 mutant, including FGSG_02279, FGSG_04745 and FGSG_05042, played roles in plant infection [ 49 , 69 , 70 ]. The reduced expression of these genes may also contribute to defects of Fgfad12 mutant in plant infection. In...”
- lncRsp1, a long noncoding RNA, influences Fgsp1 expression and sexual reproduction in Fusarium graminearum
Wang, Molecular plant pathology 2022 - “...RESULTS 2.1 Identification of lncRsp1 and Fgsp1 Based on the sequence analysis of the fulllength FGSG_05042 mRNA, the open reading frame (ORF) was determined to encode a protein of 534 amino acids (GenBank accession no. XP_011323525). NCBI domain analysis indicated that the protein contains a sugar...”
- “...frame (ORF) was determined to encode a protein of 534 amino acids (GenBank accession no. XP_011323525). NCBI domain analysis indicated that the protein contains a sugar transport domain and two MFS conserved domains. Therefore, FGSG_05042 was designated as Fgsp1 (Figure 1a ). Transmembrane domain prediction (...”
ATEG_02489 uncharacterized protein from Aspergillus terreus NIH2624
29% identity, 84% coverage
- Transcriptome Profiling-Based Analysis of Carbohydrate-Active Enzymes in Aspergillus terreus Involved in Plant Biomass Degradation
Corrêa, Frontiers in bioengineering and biotechnology 2020 - “...the 48 h incubation period, namely ATEG_07791, ATEG_03475, ATEG_07105, ATEG_04988, ATEG_01556, ATEG_07124, ATEG_08653, ATEG_07144, ATEG_03527, ATEG_02489, ATEG_07114, ATEG_04070, ATEG_07053, ATEG_04137, ATEG_03190, and ATEG_05008. RT-qPCR Validation of in silico RNA-Seq Transcriptome Data Expression profiles for selected A. terreus CAZyme-encoding and other genes significantly up-regulated on SB and...”
CNBG_5746 galactose transporter from Cryptococcus deuterogattii R265
27% identity, 82% coverage
- Identification and Characterization of an Intergenic "Safe Haven" Region in Human Fungal Pathogen Cryptococcus gattii
Li, Journal of fungi (Basel, Switzerland) 2022 - “...and CNBG_5898 on chromosome 4; and Candidate 3the 4073 bp intergenic region between CNBG_5745 and CNBG_5746 on chromosome 4. 3.2. Insertion of Foreign DNA into the Candidate 1 or the Candidate 2 Site Has No Significant Impact on the Expression of the Neighboring Genes Our selection...”
- “...CNBG_5897 and CNBG_5898 in the two selected transformants for candidate 2, and of CNBG_5745 and CNBG_5746 in the two selected transformants for candidate 3. The transcript level of CNBG_3433 and CNBG_3434 in the selected transformants for candidate 1 site showed no apparent difference compared to those...”
LOC100232961 hexose transporter HT2 from Vitis vinifera
29% identity, 92% coverage
- Transcripts switched off at the stop of phloem unloading highlight the energy efficiency of sugar import in the ripening V. vinifera fruit
Savoi, Horticulture research 2021 - “...GIN1 Vitvi14g01977 LOC100244103 297 2 3 99 294.2 93 [Cell wall] Expansin A (VvEXPA16) Vitvi18g00397 LOC100232961 333 119 52 84 280.7 105 [Sugar] Hexose transporter HT2 Vitvi03g00209 LOC100258952 286 35 25 91 260.4 113 [Cell wall] Expansin A-like (VvEXLA01) Vitvi18g01628 LOC100255463 351 133 106 70 245.8...”
- “...probable PM H + hexose symporter inhibited with phloem arrest was VviHT2 ( Vitvi18g00397 - LOC100232961 ) 43 . It also exhibited a considerable increase during ripening, followed by a 35% decrease in 2 weeks 44 . Synchronised berries show here that more than 50% inhibition...”
STM14_3735 galactose/proton symporter from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
28% identity, 92% coverage
CNBG_2028 MFS transporter SP family solute carrier family 2 (myo-inositol transporter) member 13 from Cryptococcus deuterogattii R265
27% identity, 85% coverage
Z4288 galactose-proton symport of transport system from Escherichia coli O157:H7 EDL933
ECs3819 galactose-proton symport of transport system from Escherichia coli O157:H7 str. Sakai
29% identity, 92% coverage
AFUA_5G01160, Afu5g01160 MFS monosaccharide transporter, putative from Aspergillus fumigatus Af293
29% identity, 81% coverage
- Analysis of an Intrinsic Mycovirus Associated With Reduced Virulence of the Human Pathogenic Fungus Aspergillus fumigatus
Takahashi-Nakaguchi, Frontiers in microbiology 2019 - “...membrane transport was identified (RTA1 domain protein; AFUA_5G05640, MFS multidrug transporter; AFUA_4G01140, MFS monosaccharide transporter; AFUA_5G01160) ( Supplementary Table S2A ). Among the genes that were down-regulated in virus-infected A. fumigatus , the most drastic change was observed in the transcript encoding NAD-dependent formate dehydrogenase AciA/Fdh...”
- Comparative transcriptome analysis revealing dormant conidia and germination associated genes in Aspergillus species: an essential role for AtfA in conidial dormancy
Hagiwara, BMC genomics 2016 - “...- Conserved hypothetical protein Afu3g01210 An01g10950 AO090026000081 454.0 867.9 583.9 n.d. - ThiJ/PfpI family protein Afu5g01160 An03g02190 AO090020000259 338.5 21.7 12.7 full - Monosaccharide transporter Afu8g06020 An15g04770 AO090005000539 275.9 74.8 297.8 full - Glutamate decarboxylase Afu6g03890 An09g03130 AO090701000158 249.3 350.6 194.9 full catA Catalase A Afu1g03580...”
- Conservation of nucleosome positions in duplicated and orthologous gene pairs
Nishida, TheScientificWorldJournal 2012 - “...AFUA_8G05620 0.398124519 YHL001W AFUA_6G03830 0.397471165 YNL255C AFUA_1G07630 0.390527675 YGL006W AFUA_3G10690 0.389206341 YIL125W AFUA_4G11650 0.387564721 YMR011W AFUA_5G01160 0.381368332 YMR010W AFUA_5G03510 0.378223656 YMR319C AFUA_4G14640 0.376638524 YDL110C AFUA_1G09160 0.376540694 YOL086C AFUA_5G06240 0.376281416 YGR076C AFUA_4G09000 0.373900773 YOR204W AFUA_4G07660 0.368301524 YMR229C AFUA_2G16040 0.367246087 YLR025W AFUA_1G06420 0.363738278 YPL281C AFUA_6G06770 0.363265962 YOR294W AFUA_7G04430...”
- “...AFUA_7G01030 0.222088168 YBR179C AFUA_5G13392 0.219453048 YKR082W AFUA_4G05840 0.214144582 YLR087C AFUA_2G13520 0.209434557 YCL064C AFUA_4G07810 0.204494803 YOL156W AFUA_5G01160 0.203744073 YBR249C AFUA_7G04070 0.202306902 YJL093C AFUA_3G07540 0.201465401 YOL077C AFUA_1G02210 0.196710807 YLR426W AFUA_1G06280 0.196041865 YMR060C AFUA_2G03840 0.194299595 YOR048C AFUA_1G13730 0.193994391 YDL174C AFUA_7G02560 0.193117882 YJL221C AFUA_8G07070 0.187015236 YGR054W AFUA_3G05970 0.181434929 YPR176C AFUA_7G04460...”
- Evolutionary Analysis of Sequence Divergence and Diversity of Duplicate Genes in Aspergillus fumigatus
Yang, Evolutionary bioinformatics online 2012 - “...1.19 [0.21, 1.58] Afu2g08040 1.79 [1.81, 0.81] Afu5g01040 1.18 [1.12, 2.70] Afu6g09970 0.61 [1.25, 2.20] Afu5g01160 1.17 [0.65, 2.17] Afu8g01180 0.57 [1.44, 1.32] Afu8g04470 1.16 [0.66, 2.13] Afu6g11320 1.79 [2.31, 1.80] Afu7g00390 1.13 [0.49, 1.91] Afu3g01120 0.66 [0.98, 1.94] Afu5g00980 1.13 [0.82, 2.31] Afu1g10370 0.97 [1.82,...”
- The proteomic signature of Aspergillus fumigatus during early development
Cagas, Molecular & cellular proteomics : MCP 2011 - “...File 8 Hours Microarray Data AFUA_8G04550 AFUA_5G01160 AFUA_6G12000 AFUA_7G01010 AFUA_8G02440 AFUA_5G08830 16 Hours Microarray Data AFUA_4G13510 AFUA_1G01490...”
- Sub-telomere directed gene expression during initiation of invasive aspergillosis
McDonagh, PLoS pathogens 2008 - “...monocarboxylate transporter 4.628176816 Afu8g01130 alpha-galactosidase C 2.8084929 Afu6g03060 monosaccharide transporter 4.576610248 Afu4g01070 acid phosphatase 3.4709519 Afu5g01160 monosaccharide transporter 4.53846138 Afu7g05610 glucanase 3.7652613 Afu4g13080 monosaccharide transporter 4.316438927 Afu4g00870 antigenic cell wall galactomannoprotein 2.8100298 Afu7g05830 MFS sugar transporter 4.069715654 Afu6g02980 extracellular exo-polygalacturonase 6.9692415 Afu6g14500 MFS sugar transporter 3.883566446...”
NCU05627 high affinity glucose transporter ght1 from Neurospora crassa OR74A
30% identity, 78% coverage
- The F-box protein gene exo-1 is a target for reverse engineering enzyme hypersecretion in filamentous fungi
Gabriel, Proceedings of the National Academy of Sciences of the United States of America 2021 (secret) - The regulatory and transcriptional landscape associated with carbon utilization in a filamentous fungus
Wu, Proceedings of the National Academy of Sciences of the United States of America 2020 - “...levels of growth on xylan ( 39 ), and pentose transporters xat-1 (NCU01132) and xyt-1 (NCU05627) ( 43 ) ( Fig. 5 ). CRE-1 binding peaks were not detected in the promoter of the major transcriptional regulator of xylan utilization, xlr-1 , although CRE-1 binding sites...”
- “...NCU06026 (quinate permease), NCU05897 ( sut-28 ), NCU10021 ( hgt-1 ), NCU00821 (sugar transporter), and NCU05627 (high-affinity glucose transporter ght-1 ). The remaining set of 21 genes included a number of carbon metabolic enzymes and 5 genes encoding proteins of unknown function ( Dataset S5 )....”
- Control of Development, Secondary Metabolism and Light-Dependent Carotenoid Biosynthesis by the Velvet Complex of Neurospora crassa
Bayram, Genetics 2019 - “...process DNA catabolic process NCU09685 4.133 -- NCU01808 NCU05627 4.047 4.0174 -- Transmembrane transport proteins that are known to form complexes in order to...”
- Alternative Oxidase Transcription Factors AOD2 and AOD5 of Neurospora crassa Control the Expression of Genes Involved in Energy Production and Metabolism
Qi, G3 (Bethesda, Md.) 2017 - “...in the absence of AOD2 ( Figure 9D ), while two (NCU04899, malate dehydrogenase and NCU05627, a glucose transporter) showed decreased expression in the absence of either AOD2 or AOD5 ( Figure 9E ). One gene (NCU02623, mitochondrial hypoxia response) shows only increased expression in the...”
- “...AOD5 + and Cm NCU04899 (malate dehydrogenase) 2+, 5+ N Na AOD5 + and Cm NCU05627 (high affinity glucose transporter 2+, 5+ N Na FN1/2+3/8+6/7 NCU05995 (ubiquitin) No effect Y Y FN3/8+4/5+6/7 NCU06211 (malate dehydrogenase) No effect Y Y FN1/2+3/8+6/7 NCU09144 (hypo) 5 N d Na...”
- A fungal transcription factor essential for starch degradation affects integration of carbon and nitrogen metabolism
Xiong, PLoS genetics 2017 - “...value less than 1e-20 identified 14 genes likely encoding transporters. Four of them, hgt-1 (NCU10021), NCU05627, NCU04963, and NCU04537 are annotated as sugar transporter genes ( Fig 2C ). hgt-1 shows high affinity glucose transport activity [ 19 ], while NCU05627 ( xyt-1 ) has xylose...”
- Transcriptional comparison of the filamentous fungus Neurospora crassa growing on three major monosaccharides D-glucose, D-xylose and L-arabinose
Li, Biotechnology for biofuels 2014 - “...here, including one glucose transporter GLT-1 (NCU01633) and two novel pentose transporters, XAT-1 (NCU01132), XYT-1 (NCU05627). One transcription factor associated with the regulation of hemicellulase genes, HCR-1 (NCU05064) was also characterized in the present study. Conclusions We conducted the first transcriptome analysis of Neurospora crassa grown...”
- “...149.95 5.65 NCU04963 High-affinity glucose transporter 4.91 128.69 402.90 NCU04537 Monosaccharide transporter 1.06 3.35 410.00 NCU05627 High affinity glucose transporter ght1 4.47 48.96 244.36 NCU00450 Sucrose transporter 28.78 52.91 23.15 NCU00801 MFS lactose permease 6.10 25.15 24.96 NCU00988 MFS quinate transporter 0.18 47.98 0.86 NCU01494 MFS...”
- Identification of the CRE-1 cellulolytic regulon in Neurospora crassa
Sun, PloS one 2011 - “...Five additional genes in this set encoded predicted sugar transporters, (NCU01633, NCU04537, NCU10021, NCU00821, and NCU05627), one encoded a nucleoside transporter (NCU08148), several genes had annotation suggesting a role in alternative carbon source utilization (e.g. pyruvic acid), and 26 genes encoded putative or hypothetical proteins. No...”
- Systems biology of the qa gene cluster in Neurospora crassa
Tang, PloS one 2011 - “...is also the more gradual response of the qa-y and a putative carbohydrate metabolism gene (NCU05627). The pronounced delay in kinetic response to QA can be seen in the transcription factor (NCU03643) and a gene (NCU09873) encoding a phosphoenolpyruvate carboxykinase involved in glycolysis/glucanogenesis [51] . The...”
- More
CAC1339 Possible sugar-proton symporter from Clostridium acetobutylicum ATCC 824
CA_C1339 sugar porter family MFS transporter from Clostridium acetobutylicum ATCC 824
30% identity, 92% coverage
- Biochemical routes for uptake and conversion of xylose by microorganisms
Zhao, Biotechnology for biofuels 2020 - “...transporter are not detected in the chromosome of C. acetobutylicum , and only several genes (CAC1339, CAC1345, CAC1530, CAC3422 and CAC3451) encoding sugar-proton symporters are identified [ 20 , 21 ]. These above symporter genes are distributed in the different parts of the chromosome, and located...”
- Development of an inducible transposon system for efficient random mutagenesis in Clostridium acetobutylicum
Zhang, FEMS microbiology letters 2016 - “...Minton ( 2015 ) pMTL82254-Pcac1339 Clostridium modular plasmid with catP reporter expressed by promoter of cac1339, pBP1 (Gram + origin), ColE1+ tra (Gram origin), Em r This study pMTL82254-Pcac1344 Clostridium modular plasmid with catP reporter expressed by promoter of cac1344, pBP1 (Gram + origin), ColE1+ tra...”
- “...pBP1 with pCB102 replicon This study pMTL-YG3 Derived from pMTL-YG0 by introducing the promoter of cac1339 to express the transposase Himar1 C9 This study a hsdR , host-specific restriction deficient; mcr , methylcytosine-specific restriction abolished; recA1 , homologous recombination abolished; endA1 , endonucleases abolished; Spe r...”
- Sugar uptake by the solventogenic clostridia
Mitchell, World journal of microbiology & biotechnology 2016 - “...in both C. acetobutylicum and C. beijerinckii. Three symporters in C. acetobutylicum , encoded by cac1339 , cac1345 and cac3451 , have been shown to be induced under conditions in which xylose is being used as a substrate (Grimmler et al. 2010 ; Servinsky et al....”
- “...al. 2015 ). In the case of arabinose, a gene cluster in C. acetobutylicum ( cac1339 cac1349 ) has been shown to be under control of a putative AraR regulator, and some of the genes in this region including cac1339 were found to be induced by...”
- Ribulokinase and transcriptional regulation of arabinose metabolism in Clostridium acetobutylicum
Zhang, Journal of bacteriology 2012 - “...araA (CAC1342 and CAC1346), araD (CAC1341), and araE (CAC1339 and CAC1345) genes in the araR-inactivated mutant were elevated more than 17-fold compared to that...”
- “...poorly explored family (Y. Zhang, personal communication). The CAC1339 to -1349 gene cluster in the C. acetobutylicum genome includes genes for two AraA...”
- Pleiotropic functions of catabolite control protein CcpA in Butanol-producing Clostridium acetobutylicum
Ren, BMC genomics 2012 - “...cluster contains most of the genes necessary for l -arabinose uptake and metabolism, including araE1/araE2 (CAC1339 and CAC1345, encoding l -arabinose-proton symporter), araA1/araA2 (CAC1342 and CAC1346, encoding l -arabinose isomerase), araK (CAC1344, encoding ribulokinase) [ 44 ], araD (CAC1341, encoding l -ribulose-5-phosphate 4-epimerase), epi (CAC1349, encoding...”
- Confirmation and elimination of xylose metabolism bottlenecks in glucose phosphoenolpyruvate-dependent phosphotransferase system-deficient Clostridium acetobutylicum for simultaneous utilization of glucose, xylose, and arabinose
Xiao, Applied and environmental microbiology 2011 - “...isomerase; xylB (cac2612), xylulokinase; araE (cac1339), L-arabinose transporter; araA (cac1342, cac1346), L-arabinose isomerase; araB (cac1344?),...”
- “...Only putative D-xylose and undefined sugar symporters (cac1339, cac3422, and cac1345) were observed. In general, symporters exhibit much lower affinity for...”
- Alleviation of Carbon Catabolite Repression through araR and xylR Inactivation in Clostridium acetobutylicum DSM 792
Delarouzée, Applied and environmental microbiology 2023 (secret) - Arabinose-Induced Catabolite Repression as a Mechanism for Pentose Hierarchy Control in Clostridium acetobutylicum ATCC 824
Servinsky, mSystems 2018 - “...( 14 , 19 ). Rodionov et al. identified AraR (CA_C1340) binding sites upstream of CA_C1339, CA_C1340, the predicted CA_C1341-CA_C1342 operon, CA_C1343, the predicted CA_C1344-CA_C1349 operon, and the predicted CA_C1529-CA_C1530 operon ( 28 ). The binding of AraR to these sites was confirmed by EMSA, and...”
- “...on arabinose than in xylose or glucose cultures ( 9 ). One notable exception is CA_C1339, a proposed xylose importer gene, which has a unique transcription profile with high mRNA levels in cells grown on xylose, moderate levels for those on arabinose, and extremely low levels...”
PDIP_55020 MFS monosaccharide transporter, putative from Penicillium digitatum
30% identity, 82% coverage
- Transcriptome Analysis of mfs2-Defective Penicillium digitatum Mutant to Reveal Importance of Pdmfs2 in Developing Fungal Prochloraz Resistance
Cuan, Microorganisms 2024 - “...up-regulation of multiple MFS isogenes, including MFS23 (PDIP_36610), MFS26 (PDIP_64100), MFS27 (PDIP_55370), MFS31 (PDIP_19850), MFS33 (PDIP_55020) ( Table 8 ). All these five MFS-encoding genes did not show up-regulation in the comparison Pd-d-(I/NI); however, three of them (i.e., MFS23 , MFS26 and MFS27 ) showed up-regulation...”
- “...1.15 / MFS31 (PDIP_19850) / 2.63 / 2.05 MFS32 (PDIP_28570) 1.23 1.11 / / MFS33 (PDIP_55020) / 1.07 / 1.22 ABC1 (PDIP_64370) / / 1.35 1.71 ABC2 (PDIP_58890) / / 1.18 / ABC3 (PDIP_13640) 2.75 1.09 2.84 1.18 ABC4 (PDIP_19230) 1.05 / 2.20 1.43 ABC5 (PDIP_78490)...”
NCU06138 quinate permease from Neurospora crassa OR74A
27% identity, 79% coverage
- Correlating sugar transporter expression and activities to identify transporters for an orphan sugar substrate
Tamayo, Applied microbiology and biotechnology 2024 - “...transporters from cluster 1 (like XYT-1, FRT-1, HGT-2, NCU04537, HGT-1, QaY, NCU06358, GLT-1, NCU06384, and NCU06138) could be potential candidates, but likely also only by contributing with unspecific side activities. Lactose uptake assays of transporter candidates Following the previous global analyses of the sugar transportome of...”
- Independent metabolism of oligosaccharides is the keystone of synchronous utilization of cellulose and hemicellulose in Myceliophthora
Liu, PNAS nexus 2024 - “...xylose transporter Mycth_96047, with a high identity with the xylose and glucose transporter encoded by NCU06138 in N. crassa ( 40 ), showed a high expression level under xylose, xylobiose, and xylan conditions, while it was strongly inhibited by glucose (Fig. 4 C). Additionally, the expression...”
- The transcription factor PDR-1 is a multi-functional regulator and key component of pectin deconstruction and catabolism in Neurospora crassa
Thieme, Biotechnology for biofuels 2017 - “...(NCU04130), the glycerol-3-phosphate O -acyltransferase chol - 6 (NCU05985), the quinate permease mfs - 19 (NCU06138), the endo-1,4--xylanase gh11 - 2 (NCU07225), the fumarylacetoacetate hydrolase fah - 2 (NCU07506), the mitochondrial triosephosphate isomerase emp - 19 (NCU10106), a glyoxalase (NCU11253), and four hypothetical proteins (NCU01700, NCU01871,...”
- “...2 1 C13 NCU05037 put . lra4 4 C1 NCU05985 chol - 6 1 C1 NCU06138 mfs - 19 1 C13 NCU07225 gh11 - 2 1 C13 NCU07506 fah - 2 3 C1 NCU08475 Hypothetical protein 2 C1 NCU09033 pdr - 1 5 C1 NCU09034 put....”
- Direct target network of the Neurospora crassa plant cell wall deconstruction regulators CLR-1, CLR-2, and XLR-1
Craig, mBio 2015 - “...1 Acetyl xylan esterase NCU05159 ce5 - 2 Acetyl xylan esterase NCU05350 Major facilitator transporter NCU06138 xy-31 Xylose transporter NCU06143 gh115-1 Putative glucuronidase NCU06490 Hypothetical protein NCU07225 a gh11-2 Endo-1,4--xylanase NCU07510 Hypothetical protein NCU08114 a cdt-2 Cellodextrin/xylodextrin transporter NCU08189 gh10-2 Endo-1,4--xylanase NCU08384 xyr-1 Xylose reductase NCU09652...”
- Transcriptional comparison of the filamentous fungus Neurospora crassa growing on three major monosaccharides D-glucose, D-xylose and L-arabinose
Li, Biotechnology for biofuels 2014 - “...1045.02 NCU00809 MFS monosaccharide transporter 7.07 314.73 6.64 NCU01132 MFS monosaccharide transporter 0.46 280.94 0.87 NCU06138 Quinate permease 0.74 213.95 75.43 NCU05897 L-fucose permease 1.10 179.47 315.45 NCU05853 MFS sugar transporter 2.36 149.95 5.65 NCU04963 High-affinity glucose transporter 4.91 128.69 402.90 NCU04537 Monosaccharide transporter 1.06 3.35...”
- “...well-characterized so far, although limited analysis has been performed on five of them; NCU04963 and NCU06138 have the capability to transport both xylose and glucose, whereas very weak xylose transportation activity was detected in a recombinant yeast strain harboring NCU02188, NCU04537 or NCU09287 [ 9 ]....”
- Deciphering transcriptional regulatory mechanisms associated with hemicellulose degradation in Neurospora crassa
Sun, Eukaryotic cell 2012 - “...(NCU00988, NCU01132, NCU02188, NCU02238, NCU02582, NCU05853, NCU06138, NCU06305, NCU06358, NCU08114, and NCU09027). In addition, 6 pentose-phosphate pathway...”
- “...NCU09652, -xylosidase, gh43-5), and two transporter genes (NCU06138 and NCU08114). Other genes encode proteins with a potential role in hemicellulose...”
- Systems analysis of plant cell wall degradation by the model filamentous fungus Neurospora crassa
Tian, Proceedings of the National Academy of Sciences of the United States of America 2009 - “...(NCU00801, NCU00988, NCU01231, NCU04963, NCU05519, NCU05853, NCU05897, NCU06138, NCU08114, and NCU10021) and 23 putative or hypothetical proteins. Of the 117...”
LOC7486368 sugar transport protein 10 from Populus trichocarpa
27% identity, 91% coverage
- The genetic architecture of trait covariation in Populus euphratica, a desert tree
Lu, Frontiers in plant science 2023 - “...is active in mitochondria, organelle envelope and cytoplasm. Q2345(nn_np_11278, Linkage Group 4) is homologous with LOC7486368, the gene encoding sugar transport protein (STP) 10 in Poplus tricocarpa . STP is a plant-specific transport protein, which is responsible for absorbing glucose from the apoplast into plant cells....”
LOC107049937 solute carrier family 2, facilitated glucose transporter member 4-like from Gallus gallus
50% identity, 32% coverage
STP1_ARATH / P23586 Sugar transport protein 1; Glucose transporter; Hexose transporter 1 from Arabidopsis thaliana (Mouse-ear cress) (see 8 papers)
TC 2.A.1.1.60 / P23586 The major hexose transporter, Htr1 (mediates the active uptake of hexoses by sugar:H+ symport. Can transport glucose, 3-O-methylglucose, fructose, xylose, mannose, galactose, fucose, 2-deoxyglucose and arabinose. Confers sensitivity to galactose in seedlings. Km=20 uM for glucose) from Arabidopsis thaliana (Mouse-ear cress) (see 14 papers)
STP1 / RF|NP_172592.1 sugar transport protein 1 from Arabidopsis thaliana (see paper)
NP_172592 sugar transporter 1 from Arabidopsis thaliana
AT1G11260 STP1 (SUGAR TRANSPORTER 1); carbohydrate transmembrane transporter/ sugar:hydrogen symporter from Arabidopsis thaliana
28% identity, 90% coverage
- function: Major hexose transporter. Mediates an active uptake of hexoses, by sugar/hydrogen symport. Can transport glucose, 3-O- methylglucose, fructose, xylose, mannose, galactose, fucose, 2- deoxyglucose and arabinose. Confers sensitivity to galactose in seedlings.
- substrates: Hexoses
- Sugar Transporter Protein 1 (STP1) contributes to regulation of the genes involved in shoot branching via carbon partitioning in Arabidopsis.
Otori, Bioscience, biotechnology, and biochemistry 2019 (PubMed)- GeneRIF: Sugar Transporter Protein 1 (STP1) contributes to regulation of the genes involved in shoot branching via carbon partitioning in Arabidopsis
- Sugar regulation of SUGAR TRANSPORTER PROTEIN 1 (STP1) expression in Arabidopsis thaliana.
Cordoba, Journal of experimental botany 2015 - GeneRIF: STP1 transcript levels decrease more rapidly after the addition of low concentrations of sugars than the levels of other repressed genes. This regulation is exerted at the transcriptional level and is initiated by phosphorylatable sugars.
- Do mitochondria use efflux pumps to protect their ribosomes from antibiotics?
Islam, Microbiology (Reading, England) 2023 - “...4.1E^183# Q42093, 7.4E^205 O15439, 3.6E^213 [ 73 ] HXT2 High-affinity glucose transporter MFS|| KGR01337.1, 0** P23586, 1 .9E^54 Q96QE2, 6.5E^41 [ 40, 73 ] JEN1 Carboxylic acid transporter protein homologue MFS KGU09375.1, 9E^121** Q9SYQ1, 0.00014 A0A286YF51, 0.0019 [ 73 ] TPO1 Polyamine transporter 1 MFS G1UAY0,...”
- “...7.8E^6 A0A1P8ATY7, 6.7E^12 Q8WW24, 1.4E^14 [ 79, 112 ] HXT13, NCU01633 Q1K4S3 MFS Q8J2J7, 2.1E^85 P23586, 1.2E^52 P11168, 2.6E^48 [ 79 ] NCU04809 Q756M6 MFS T2AWG3, 0.0014 Q8GYF4, 1.4E^24 B3KT41, 0.0022 [ 79 ] NCU09551 Q7S2B0 MFS G1UAY0, 2.3E^6 Q56ZZ7, 2.3E^7 Q8NBP5, 8.4E^9 [ 78 ]...”
- Plasma membrane aquaporins mediates vesicle stability in broccoli
Martínez-Ballesta, PloS one 2018 - “...585 64379,59 Peptide transporter PTR2 2,22 1 P83970 951 104618,27 Plasma membrane ATPase 2,42 3 P23586 522 57572,98 Sugar transport protein 1 2,30 Q9SZN1 487 54270,67 V-type proton ATPase subunit B2 2,87 1 O82226 747 85386,45 Cyclic nucleotide-gated ion channel 6 1,87 9 Cell growth and...”
- Microsome-associated proteome modifications of Arabidopsis seedlings grown on board the International Space Station reveal the possible effect on plants of space stresses other than microgravity
Mazars, Plant signaling & behavior 2014 - “...0.549 phosphatidylserine decarboxylase 3 Q9SZP6 AT4G38690 0.554 1-phosphatidylinositol phosphodiesterase-related protein Q8LDH5 0.585 endomembrane-associated protein Transporters P23586 AT1G11260 0.370 sugar transporter 1 Q8LGU1 AT3G21250 0.456 multidrug resistance-associated protein 6 Q56ZZ7 AT5G16150 0.523 Plastidic glucose transporter 4 Q53XH7 AT5G62670 0.553 H(+)-ATPase 11 Q94FB9 AT4G39850 0.559 ABC transporter D...”
- Proton-coupled sugar transport in the prototypical major facilitator superfamily protein XylE
Wisedchaisri, Nature communications 2014 - “...IolT (O34718); Arabidopsis thaliana inositol/H + symporter INT1 (Q8VZR6); Arabidopsis thaliana hexose/H + symporter STP1 (P23586); Parachlorella kessleri hexose/H + symporter HUP1 (P15686); Homo sapiens facilitated glucose transporter GLUT12 (Q8TD20); Homo sapiens H + /myo-inositol transporter GLUT13 (HMIT) (Q96QE2); Homo sapiens facilitated glucose transporter GLUT2 (P11168);...”
- Major facilitator superfamily
Pao, Microbiology and molecular biology reviews : MMBR 1998 - “...541 Accession no. Databaseb S38435 U43629 S25015 U38651 L08196 P23586 S25009 PIR GB PIR GB GB SP PIR U23453 Z69787 Z68296 Z68215 U41532 Z70683 U28737 Z66522...”
- Starch metabolism in guard cells: At the intersection of environmental stimuli and stomatal movement
Dang, Plant physiology 2024 - “...AT4G30190 GBF2 Gramene: AT4G01120 GBF2 Araport: AT4G01120 PHOT1 Gramene: AT3G45780 PHOT1 Araport: AT3G45780 STP1 Gramene: AT1G11260 STP1 Araport: AT1G11260 STP4 Gramene: At3g19930 STP4 Araport: At3g19930 AMY3 Gramene: AT1G69830 AMY3 Araport: AT1G69830 HXK1 Gramene: AT4G29130 HXK1 Araport: AT4G29130 BIK1 Gramene: AT2G39660 BIK1 Araport: AT2G39660 SUS3 Gramene: AT4G02280...”
- AlteredArabidopsis thalianasugar metabolism affects exudation, immune responses, and plant-microbe interactions
Siffert, 2024 - Metabolome and Transcriptome Association Analysis Reveals Mechanism of Synthesis of Nutrient Composition in Quinoa (Chenopodium quinoa Willd.) Seeds
Yang, Foods (Basel, Switzerland) 2024 - “...in the carbon output of Arabidopsis thaliana [ 67 ]. The gene LOC110687202 (homologous gene AT1G11260) encodes a high-affinity sugar transporter in Arabidopsis thaliana, which is highly down-regulated and can transport a variety of hexose [ 68 ]. The sugar transporter encoded in quinoa is up-regulated,...”
- Genetic Determinants of Fiber-Associated Traits in Flax Identified by Omics Data Integration
Kanapin, International journal of molecular sciences 2022 - “...domain-containing protein 47 AT3G04070, anac047, NAC047 [ 69 ] transcription factor Lus10042516 sugar transporter 1 AT1G11260, STP1 [ 97 ] H+/monosaccharide cotransporter Chr9:18121668 Lus10029638 Lus10029639 GDSL-like lipase/acylhydrolase superfamily protein AT1G54790 [ 98 , 99 , 100 ] growth, biotic stress response, in cotton the GDSL (GhGDSL)...”
- Comparative transcriptomics reveals commonalities and differences in the genetic underpinnings of a floral dimorphism
Potente, 2022 - Comparative transcriptomics reveals commonalities and differences in the genetic underpinnings of a floral dimorphism
Potente, Scientific reports 2022 - “...and comprised, among others, pveT_jg31090, homologous to A. thaliana Sugar Transporter 1 ( STP1 ; AT1G11260). Figure 4 Differential expression analysis in Primula . ( a ) Bar-plot showing the enriched GO terms among down-regulated DEGs in the P. veris style, ordered bottom-up by increasing adjusted...”
- Membrane nanodomains and transport functions in plant
Martinière, Plant physiology 2021 - “...(NAP) AT1G67940 (NAP3) Suspension cell cultures Yoshida et al., 2013 Sugar Sugar transporter protein (STP) AT1G11260 (STP1); AT3G19930 (STP4); AT5G26340 (STP13) Whole plant/suspension cell cultures/leaves Minami et al., 2009 ; Keinath et al., 2010 ; Demir et al., 2013 Sugar (continued) Sucrose transporter (SUT) AT1G22710 (SUT1)...”
- Leaf nodule endosymbiotic Burkholderia confer targeted allelopathy to their Psychotria hosts
Georgiou, Scientific reports 2021 - “...(AT1G55120), cwinv4 (AT2G36190), cwinv5 (AT3G13784), cwinv6 (AT5G11920), cinv1-4 (AT1G35580), cinv1-8 ( AT1G35580), cinv2 (AT4G09510), stp1-1 (AT1G11260), stp13-1 (AT5G26340) and the double mutants stp1 stp13 and stp1 stp4 were kindly provided by Diana Santelia (ETH Zurich, Switzerland); prc1 (AT5G64740) , cev1 (AT5G05170) and rsw1 (AT4G32410) were obtained...”
- More
TRET1_ANOGA / Q7PIR5 Facilitated trehalose transporter Tret1; AgTRET1 from Anopheles gambiae (African malaria mosquito) (see 2 papers)
32% identity, 50% coverage
- function: High-capacity facilitative transporter for trehalose. Does not transport maltose, sucrose or lactose. Mediates the bidirectional transfer of trehalose. Responsible for the transport of trehalose synthesized in the fat body and the incorporation of trehalose into other tissues that require a carbon source, thereby regulating trehalose levels in the hemolymph.
TRIREDRAFT_106556 galactose permease from Trichoderma reesei QM6a
G0RGR7 Galactose permease from Hypocrea jecorina (strain QM6a)
29% identity, 85% coverage
- Effect of the res2 transcription factor gene deletion on protein secretion and stress response in the hyperproducer strain Trichoderma reesei Rut-C30
Alharake, BMC microbiology 2023 - “...the condition LC/GC in res2 but not regulated in Rut-C30, such as low-affinity glucose transporter TRIREDRAFT_106556 ( hxt13 ), TRIREDRAFT_62747, and TRIREDRAFT_47897 which is involved in the oxidative stress response. One MFS transporter in this cluster is downregulated in the mutant (TRIREDRAFT_58561). On the other hand,...”
- “...hydrolase family 55 LC/GC -2.17 6 TRIREDRAFT_121746 Putative Glycoside hydrolase family 55 GD/GC -2.20 6 TRIREDRAFT_106556 hxt13 hexose transporter GD/GC LD/LC LC/GC 5.08 3.14 6.67 4 TRIREDRAFT_62747 MFS membrane transporter LC/GC 3.16 4 TRIREDRAFT_47897 snq2 ABC transporter involved in oxidative stress response GD/GC LC/GC 2.08 3.17...”
- Advances in fungal sugar transporters: unlocking the potential of second-generation bioethanol production.
Pereira, Applied microbiology and biotechnology 2025 - “...Glucose, xylose, fructose, galactose, and mannose T. reesei Sloothaak et al. ( 2016b ) GLT1 G0RGR7 Glucose T. reesei Havukainen et al. ( 2021b ) STP1 G0RIJ1 Glucose, fructose, galactose, mannose, cellobiose, xylose, and L-arabinose T. reesei Zhang et al. ( 2013 ); Wang et al....”
Q6BW54 DEHA2B14278p from Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
29% identity, 61% coverage
TC 2.A.1.1.68 / A3M0N3 The Glucose Transporter/Sensor Rgt2 from Pichia stipitis (see paper)
XP_001386588 glucose transporter/sensor from Scheffersomyces stipitis CBS 6054
28% identity, 85% coverage
- substrates: glucose
- Genetic basis of the highly efficient yeast Kluyveromyces marxianus: complete genome sequence and transcriptome analyses
Lertwattanasakul, Biotechnology for biofuels 2015 - “...Ps_XUT1, XP_001385583; Ps_XUT2, XP_001387242; Ps_XUT3, XP_001387138; Ps_XUT4, XP_001386715; Ps_XUT5, XP_001385962; Ps_XUT6, XP_001386589; Ps_XUT7, XP_001387067; Ps_RGT2, XP_001386588; Ps_SLT1, XP_001383774; Kl_KHT1/RAG1, XP_453656; Kl_KHT2, GN107317; Kl_KHT3, XP_454897; Kl_FRT1, XP_454356; Kl_HGT1, XP_451484; Kl_HXT1, XP_455078; Kl_HXT14, XP_454897; Kl_HXT2, XP_453960; Kl_HXT3, XP_453088; Sc_HXT4/LGT1, NP_011960; Kl_STL1, XP_456249; Kl_RAG4, XP_455315; Kl_LAC12, XP_452193; Ca_HXT6, XP_719472....”
TC 2.A.1.1.35 / Q7BEC4 The major glucose (or 2-deoxyglucose) uptake transporter, GlcP from Streptomyces lividans (see paper)
SCO5578 sugar transporter from Streptomyces coelicolor A3(2)
SCO7153 sugar transporter from Streptomyces coelicolor A3(2)
28% identity, 92% coverage
- substrates: glucose
- Comparative genomics of transport proteins in developmental bacteria: Myxococcus xanthus and Streptomyces coelicolor
Getsin, BMC microbiology 2013 - “...adaptation channel that influences sporulation and secondary metabolite production. GlcP1/2; Sco7153; Sco5578 [ 103 ] Q7BEC4 2.A.1.1.35 MFS major glucose uptake porters (two identical sequences at the AA level, and having a single substitution on the NT level). MdrA; Sco4007 [ 104 ] Q9ADP8 2.A.1.36.4 Putative...”
- Disentangling the genetic basis of rhizosphere microbiome assembly in tomato
Oyserman, Nature communications 2022 - “...B2R_17968) as well as a glucose permease (B2R_32780) with 91,5% amino acid identity to glcP1 SCO5578 of Streptomyces coelicolor A3(2) 56 . Other genes putatively involved in root exudate catabolism were also found in the ASV5 MAG, such as sarcosine oxidase ( soxBAG , B2R_20550-20551, and...”
- Comparative Proteomic Analysis of Transcriptional and Regulatory Proteins Abundances in S. lividans and S. coelicolor Suggests a Link between Various Stresses and Antibiotic Production
Clara, International journal of molecular sciences 2022 - “...of proteins playing a role in C up-take and assimilation such as the glucose permease (SCO5578) (Figure 16B of [ 9 ]) and all glycolytic enzymes (Figure 2 of [ 9 ]) in SC compared to SL . Similarly, proteins of the Pho regulon involved in...”
- Draft genome sequence of Actinotignum schaalii DSM 15541T: Genetic insights into the lifestyle, cell fitness and virulence
Yassin, PloS one 2017 - “...sugar porters which display 32% and 41% - 44% identities with the glucose transporter GlcP (SCO5578) from Streptomyces coelicolor A3 [ 2 ] and (sll0771) from Synechocystis sp. PCC 6803, respectively. The gene ( G444DRAFT_01316 ), which is annotated as minor myo -inositol:H+ symporter (IolF), clustered...”
- Transcriptomic analysis of a classical model of carbon catabolite regulation in Streptomyces coelicolor
Romero-Rodríguez, BMC microbiology 2016 - “...in a single step (Fig. 3a ). In the Glc/Agar comparison, the genes glcP1 ( SCO5578 ), and glcP2 ( SCO7153 ) showed the highest stimulation exerted by glucose (20-fold increase, and ranked number 1 and 2, respectively) (Fig. 4a ). The transcriptional regulation of glcP...”
- Functional analysis of the GlcP promoter in Streptomyces peucetius var. caesius
Romero, Applied biochemistry and biotechnology 2015 (PubMed)- “...In Streptomyces coelicolor, this protein is encoded by sco5578. However, there is little information about the physiology of the GlcP promoter in Streptomyces....”
- “...analysis of the sp7066 promoter (ortholog of sco5578) from Streptomyces peucetius var. caesius. Hydrophobicity and cellular location analysis of the putative...”
- Comparative genomics of transport proteins in developmental bacteria: Myxococcus xanthus and Streptomyces coelicolor
Getsin, BMC microbiology 2013 - “...Q9KYV5 1.A.22.1.10 MscL, osmotic adaptation channel that influences sporulation and secondary metabolite production. GlcP1/2; Sco7153; Sco5578 [ 103 ] Q7BEC4 2.A.1.1.35 MFS major glucose uptake porters (two identical sequences at the AA level, and having a single substitution on the NT level). MdrA; Sco4007 [ 104...”
- Transcriptomic analysis of a classical model of carbon catabolite regulation in Streptomyces coelicolor
Romero-Rodríguez, BMC microbiology 2016 - “...3a ). In the Glc/Agar comparison, the genes glcP1 ( SCO5578 ), and glcP2 ( SCO7153 ) showed the highest stimulation exerted by glucose (20-fold increase, and ranked number 1 and 2, respectively) (Fig. 4a ). The transcriptional regulation of glcP was dependent on the presence...”
- Comparative genomics of transport proteins in developmental bacteria: Myxococcus xanthus and Streptomyces coelicolor
Getsin, BMC microbiology 2013 - “...] Q9KYV5 1.A.22.1.10 MscL, osmotic adaptation channel that influences sporulation and secondary metabolite production. GlcP1/2; Sco7153; Sco5578 [ 103 ] Q7BEC4 2.A.1.1.35 MFS major glucose uptake porters (two identical sequences at the AA level, and having a single substitution on the NT level). MdrA; Sco4007 [...”
FVEG_02081 hypothetical protein from Fusarium verticillioides 7600
30% identity, 85% coverage
- Involvement of FST1 from Fusarium verticillioides in virulence and transport of inositol
Niu, Molecular plant pathology 2017 (secret) - Transcriptome changes in Fusarium verticillioides caused by mutation in the transporter-like gene FST1
Niu, BMC microbiology 2015 - “...genome with the yeast ITR1p sequence identified eight genes with high sequence similarity (FVEG_01519, FVEG_01638, FVEG_02081, FVEG_03992, FVEG_06504, FVEG_07757, FVEG_11293, and FVEG_12687). The sequence of FST1 was not identified by the search. Among the eight identified genes, expression was significantly down-regulated in fst1 for FVEG_06504 (named...”
VPS73_YEAST / P53142 Vacuolar protein sorting-associated protein 73 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
TC 2.A.1.1.93 / P53142 Vacuolar protein sorting-associated protein 73 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (see 7 papers)
YGL104C Mitochondrial protein; mutation affects vacuolar protein sorting; putative transporter; member of the sugar porter family from Saccharomyces cerevisiae
29% identity, 91% coverage
- function: May be involved in vacuolar protein sorting.
- substrates: NONE, Unknown
- A Chemogenomic Screen Reveals Novel Snf1p/AMPK Independent Regulators of Acetyl-CoA Carboxylase
Bozaquel-Morais, PloS one 2017 - “...3 YLR024C * UBR2 4 YOR171C LCB4 3 YPL045W * VPS16 4 YPL164C MLH3 3 YGL104C * VPS73 4 YMR091C NPL6 3 YIL040W * APQ12 3 YLR148W PEP3 3 YGR167W * CLC1 3 YGR004W PEX31 3 YAL013W * DEP1 3 YOL110W SHR5 3 YFR019W * FAB1...”
- Identification of coherent patterns in gene expression data using an efficient biclustering algorithm and parallel coordinate visualization
Cheng, BMC bioinformatics 2008 - “...YJR009C, YMR110C, YNL231C, YOR317W 17 mitochondrion 8.16E-06 2.86E-04 YCL057W, YDL027C, YDL164C, YDR116C, YDR194C, YDR375C, YDR513W, YGL104C, YHR002W, YHR067W, YHR147C, YIL087C, YIL111W, YJL063C, YLL040C, YLR270W, YLR346C, YMR098C, YMR152W, YMR188C, YNL063W, YNL073W, YNL200C, YNL274C, YOL059W, YOL071W, YOR136W, YPR011C 18 bud neck contractile ring 6.08E-05 1.58E-03 YHR023W, YJR092W, YMR032W...”
- Genomic background predicts the fate of duplicated genes: evidence from the yeast genome
Zhang, Genetics 2004 - “...(1.370) YAL060w (1.430) YOR375c (0.936) YGR040w (1.067) YGL104c (0.90) YDR516c (1.254) YLR210w (0.981) YDL143w (1.284) YER207w (1.174) YHR016c (1.32) YHR094c...”
- Predicting protein functions from redundancies in large-scale protein interaction networks
Samanta, Proceedings of the National Academy of Sciences of the United States of America 2003 - “...YGL161C(YIP5), YGL198W (YIP4) YPL246C (RBD2), YJL151C (SNA3), YGL104C (VPS73) [20], YKR030W (MSG1) YBR098W (MMS4) YHR105W (YPT35) YBL049W (MOH1), YCL039W (MOH2)...”
- Genomic screen for vacuolar protein sorting genes in Saccharomyces cerevisiae
Bonangelino, Molecular biology of the cell 2002 - “...(YPR087W), VPS70 (YJR126C), VPS71 (YML041C), VPS72 (YDR485C), VPS73 (YGL104C), VPS74 (YDR372C), VPS75 (YNL246W) This table lists a total of 148 genes whose...”
- Recognition of protein coding genes in the yeast genome at better than 95% accuracy based on the Z curve
Zhang, Nucleic acids research 2000 - “...YDR107c YGL085w YJL147c YLR404w YOL118c YAR064w YDR115w YGL104c YJL170c YLR414c YOL129w YAR068w YDR119w YGL160w YJL193w YLR416c YOL160w YAR070c YDR126w YGL186c...”
- Global response of Saccharomyces cerevisiae to an alkylating agent
Jelinsky, Proceedings of the National Academy of Sciences of the United States of America 1999 - “...import receptor YCR011C ADP1 5.5 ATP-dependent permease YGL104C -- 4.7 Glucose transport proteins\ YGL186C -- 4.5 Purine cytosine permease\ Nitrogen and...”
- “...coli FabD\ YDR001C NTH1 4.8 Neutral trehalase (a,a-trehalase) YGL104C -- 4.7 Glucose transport proteins\ YLR164W -- 4.7 Sdh4p\ YPR184W -- ;4.7 Human...”
- Data on occurrence of miRNA precursors in the Cucurbita maxima phloem sap.
Tolstyko, Data in brief 2020 - “...192 2.E26 1784 11.3 466 26.12 cme-MIR172b P53263 84 6.E16 232 7.84 32 13.79 cme-MIR2111a P53142 55 6.E16 233 3.28 16 6.87 cme-MIR319a P20012 188 2.E70 828 42.88 748 90.34 cme-MIR319b P89332 62 4.E22 144 3.83 8 5.56 cme-MIR319c P53520 87 4.E30 231 4.39 18 7.79...”
Ga0059261_1777 D-fructose transporter, sugar porter family from Sphingomonas koreensis DSMZ 15582
29% identity, 82% coverage
- mutant phenotype: Specific phenotype on fructose and raffinose; during growth on raffinose, it is probably cleaved to sucrose in the periplasm (by Ga0059261_1166), so this probably is important on raffinose because of the fructose uptake
For advice on how to use these tools together, see
Interactive tools for functional annotation of bacterial genomes.
The PaperBLAST database links 793,807 different protein sequences to 1,259,118 scientific articles. Searches against EuropePMC were last performed on March 13 2025.
PaperBLAST builds a database of protein sequences that are linked
to scientific articles. These links come from automated text searches
against the articles in EuropePMC
and from manually-curated information from GeneRIF, UniProtKB/Swiss-Prot,
BRENDA,
CAZy (as made available by dbCAN),
BioLiP,
CharProtDB,
MetaCyc,
EcoCyc,
TCDB,
REBASE,
the Fitness Browser,
and a subset of the European Nucleotide Archive with the /experiment tag.
Given this database and a protein sequence query,
PaperBLAST uses protein-protein BLAST
to find similar sequences with E < 0.001.
To build the database, we query EuropePMC with locus tags, with RefSeq protein
identifiers, and with UniProt
accessions. We obtain the locus tags from RefSeq or from MicrobesOnline. We use
queries of the form "locus_tag AND genus_name" to try to ensure that
the paper is actually discussing that gene. Because EuropePMC indexes
most recent biomedical papers, even if they are not open access, some
of the links may be to papers that you cannot read or that our
computers cannot read. We query each of these identifiers that
appears in the open access part of EuropePMC, as well as every locus
tag that appears in the 500 most-referenced genomes, so that a gene
may appear in the PaperBLAST results even though none of the papers
that mention it are open access. We also incorporate text-mined links
from EuropePMC that link open access articles to UniProt or RefSeq
identifiers. (This yields some additional links because EuropePMC
uses different heuristics for their text mining than we do.)
For every article that mentions a locus tag, a RefSeq protein
identifier, or a UniProt accession, we try to select one or two
snippets of text that refer to the protein. If we cannot get access to
the full text, we try to select a snippet from the abstract, but
unfortunately, unique identifiers such as locus tags are rarely
provided in abstracts.
PaperBLAST also incorporates manually-curated protein functions:
- Proteins from NCBI's RefSeq are included if a
GeneRIF
entry links the gene to an article in
PubMed®.
GeneRIF also provides a short summary of the article's claim about the
protein, which is shown instead of a snippet.
- Proteins from Swiss-Prot (the curated part of UniProt)
are included if the curators
identified experimental evidence for the protein's function (evidence
code ECO:0000269). For these proteins, the fields of the Swiss-Prot entry that
describe the protein's function are shown (with bold headings).
- Proteins from BRENDA,
a curated database of enzymes, are included if they are linked to a paper in PubMed
and their full sequence is known.
- Every protein from the non-redundant subset of
BioLiP,
a database
of ligand-binding sites and catalytic residues in protein structures, is included. Since BioLiP itself
does not include descriptions of the proteins, those are taken from the
Protein Data Bank.
Descriptions from PDB rely on the original submitter of the
structure and cannot be updated by others, so they may be less reliable.
(For SitesBLAST and Sites on a Tree, we use a larger subset of BioLiP so that every
ligand is represented among a group of structures with similar sequences, but for
PaperBLAST, we use the non-redundant set provided by BioLiP.)
- Every protein from EcoCyc, a curated
database of the proteins in Escherichia coli K-12, is included, regardless
of whether they are characterized or not.
- Proteins from the MetaCyc metabolic pathway database
are included if they are linked to a paper in PubMed and their full sequence is known.
- Proteins from the Transport Classification Database (TCDB)
are included if they have known substrate(s), have reference(s),
and are not described as uncharacterized or putative.
(Some of the references are not visible on the PaperBLAST web site.)
- Every protein from CharProtDB,
a database of experimentally characterized protein annotations, is included.
- Proteins from the CAZy database of carbohydrate-active enzymes
are included if they are associated with an Enzyme Classification number.
Even though CAZy does not provide links from individual protein sequences to papers,
these should all be experimentally-characterized proteins.
- Proteins from the REBASE database
of restriction enzymes are included if they have known specificity.
- Every protein with an evidence-based reannotation (based on mutant phenotypes)
in the Fitness Browser is included.
- Sequence-specific transcription factors (including sigma factors and DNA-binding response regulators)
with experimentally-determined DNA binding sites from the
PRODORIC database of gene regulation in prokaryotes.
- Putative transcription factors from RegPrecise
that have manually-curated predictions for their binding sites. These predictions are based on
conserved putative regulatory sites across genomes that contain similar transcription factors,
so PaperBLAST clusters the TFs at 70% identity and retains just one member of each cluster.
- Coding sequence (CDS) features from the
European Nucleotide Archive (ENA)
are included if the /experiment tag is set (implying that there is experimental evidence for the annotation),
the nucleotide entry links to paper(s) in PubMed,
and the nucleotide entry is from the STD data class
(implying that these are targeted annotated sequences, not from shotgun sequencing).
Also, to filter out genes whose transcription or translation was detected, but whose function
was not studied, nucleotide entries or papers with more than 25 such proteins are excluded.
Descriptions from ENA rely on the original submitter of the
sequence and cannot be updated by others, so they may be less reliable.
Except for GeneRIF and ENA,
the curated entries include a short curated
description of the protein's function.
For entries from BioLiP, the protein's function may not be known beyond binding to the ligand.
Many of these entries also link to articles in PubMed.
For more information see the
PaperBLAST paper (mSystems 2017)
or the code.
You can download PaperBLAST's database here.
Changes to PaperBLAST since the paper was written:
- November 2023: incorporated PRODORIC and RegPrecise. Many PRODORIC entries were not linked to a protein sequence (no UniProt identifier), so we added this information.
- February 2023: BioLiP changed their download format. PaperBLAST now includes their non-redundant subset. SitesBLAST and Sites on a Tree use a larger non-redundant subset that ensures that every ligand is represented within each cluster. This should ensure that every binding site is represented.
- June 2022: incorporated some coding sequences from ENA with the /experiment tag.
- March 2022: incorporated BioLiP.
- April 2020: incorporated TCDB.
- April 2019: EuropePMC now returns table entries in their search results. This has expanded PaperBLAST's database, but most of the new entries are of low relevance, and the resulting snippets are often just lists of locus tags with annotations.
- February 2018: the alignment page reports the conservation of the hit's functional sites (if available from from Swiss-Prot or UniProt)
- January 2018: incorporated BRENDA.
- December 2017: incorporated MetaCyc, CharProtDB, CAZy, REBASE, and the reannotations from the Fitness Browser.
- September 2017: EuropePMC no longer returns some table entries in their search results. This has shrunk PaperBLAST's database, but has also reduced the number of low-relevance hits.
Many of these changes are described in Interactive tools for functional annotation of bacterial genomes.
PaperBLAST cannot provide snippets for many of the papers that are
published in non-open-access journals. This limitation applies even if
the paper is marked as "free" on the publisher's web site and is
available in PubmedCentral or EuropePMC. If a journal that you publish
in is marked as "secret," please consider publishing elsewhere.
Many important articles are missing from PaperBLAST, either because
the article's full text is not in EuropePMC (as for many older
articles), or because the paper does not mention a protein identifier such as a locus tag, or because of PaperBLAST's heuristics. If you notice an
article that characterizes a protein's function but is missing from
PaperBLAST, please notify the curators at UniProt
or add an entry to GeneRIF.
Entries in either of these databases will eventually be incorporated
into PaperBLAST. Note that to add an entry to UniProt, you will need
to find the UniProt identifier for the protein. If the protein is not
already in UniProt, you can ask them to create an entry. To add an
entry to GeneRIF, you will need an NCBI Gene identifier, but
unfortunately many prokaryotic proteins in RefSeq do not have
corresponding Gene identifers.
References
PaperBLAST: Text-mining papers for information about homologs.
M. N. Price and A. P. Arkin (2017). mSystems, 10.1128/mSystems.00039-17.
Europe PMC in 2017.
M. Levchenko et al (2017). Nucleic Acids Research, 10.1093/nar/gkx1005.
Gene indexing: characterization and analysis of NLM's GeneRIFs.
J. A. Mitchell et al (2003). AMIA Annu Symp Proc 2003:460-464.
UniProt: the universal protein knowledgebase.
The UniProt Consortium (2016). Nucleic Acids Research, 10.1093/nar/gkw1099.
BRENDA in 2017: new perspectives and new tools in BRENDA.
S. Placzek et al (2017). Nucleic Acids Research, 10.1093/nar/gkw952.
The EcoCyc database: reflecting new knowledge about Escherichia coli K-12.
I. M. Keeseler et al (2016). Nucleic Acids Research, 10.1093/nar/gkw1003.
The MetaCyc database of metabolic pathways and enzymes.
R. Caspi et al (2018). Nucleic Acids Research, 10.1093/nar/gkx935.
CharProtDB: a database of experimentally characterized protein annotations.
R. Madupu et al (2012). Nucleic Acids Research, 10.1093/nar/gkr1133.
The carbohydrate-active enzymes database (CAZy) in 2013.
V. Lombard et al (2014). Nucleic Acids Research, 10.1093/nar/gkt1178.
The Transporter Classification Database (TCDB): recent advances
M. H. Saier, Jr. et al (2016). Nucleic Acids Research, 10.1093/nar/gkv1103.
REBASE - a database for DNA restriction and modification: enzymes, genes and genomes.
R. J. Roberts et al (2015). Nucleic Acids Research, 10.1093/nar/gku1046.
Deep annotation of protein function across diverse bacteria from mutant phenotypes.
M. N. Price et al (2016). bioRxiv, 10.1101/072470.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory