PaperBLAST

PaperBLAST Hits for SwissProt::P40886 Hexose transporter HXT8 (Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)) (569 a.a., MTDRKTNLPE...)

Show query sequence

>SwissProt::P40886 Hexose transporter HXT8 (Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast))
MTDRKTNLPEEPIFEEAEDDGCPSIENSSHLSVPTVEENKDFSEYNGEEAEEVVVPEKPA
SAYATVSIMCLCMAFGGFMSGWDTGTISGFVNQTDFLRRFGNYSHSKNTYYLSNVRTGLI
VSIFNVGSAIGCLFLSKLGDIYGRCMGLIIVIVVYMVGIVIQIASIDKWYQYFIGRIIAG
IGAGSISVLAPMLISETAPKHIRGTLLACWQLMVTFAIFLGYCTNYGTKTYSNSVQWRVP
LGLCFAWAIIMIGGMTFVPESPRFLVQVGKIEQAKASFAKSNKLSVDDPAVVAEIDLLVA
GVEAEEAMGTASWKELFSRKTKVFQRLTMTVMINSLQQLTGDNYFFYYGTTIFKSVGMND
SFETSIVLGIVNFASCFFSLYSVDKLGRRRCLLLGAATMTACMVIYASVGVTRLYPNGKS
EPSSKGAGNCTIVFTCFYIFCFSCTWGPVCYVIISETFPLRVRSKCMSVATAANLLWGFL
IGFFTPFITSAINFYYGYVFMGCLAFSYFYVFFFVPETKGLTLEEVDEMWMDGVLPWKSE
SWVPASRRDGDYDNEKLQHDEKPFYKRMF

Running BLASTp...

Found 250 similar proteins in the literature:

HXT8_YEAST / P40886 Hexose transporter HXT8 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
YJL214W Hxt8p from Saccharomyces cerevisiae
100% identity, 100% coverage

• function: Probable glucose transporter
• Yeast Double Transporter Gene Deletion Library for Identification of Xenobiotic Carriers in Low or High Throughput
  Almeida, mBio 2021
  • “...YGR281W, YGR289C, YHL016C, YHL040C, YHL047C, YHR092C, YHR094C, YHR096C, YIL013C, YIL088C, YIL120W, YIL121W, YJL093C, YJL129C, YJL212C, YJL214W, YJR040W, YJR054W, YJR152W, YKL174C, YKL217W, YKR039W, YKR050W, YKR103W, YKR106W, YLL028W, YLL043W, YLL048C, YLL052C, YLL061W, YLR081W, YLR092W, YLR130C, YLR138W, YLR237W, YML047C, YML116W, YML123C, YMR011W, YMR177W, YMR243C, YMR279C, YMR319C, YNL065W, YNL142W, YNL268W,...”
• Improved Xylose Metabolism by a CYC8 Mutant of Saccharomyces cerevisiae
  Nijland, Applied and environmental microbiology 2017
  • “...CYC8(Y353) Probe YMR011W YDR343C YDR342C YHR092C YHR096C YHR094C YJL214W YDL245C YJR158W YEL069C YFL011W YJL219W YOL156W YLR081W YNL318C Sum of all HXTs Sum of...”
• Extensive Copy Number Variation in Fermentation-Related Genes Among Saccharomyces cerevisiae Wine Strains
  Steenwyk, G3 (Bethesda, Md.) 2017
  • “..., HXT2 / YMR011W , HXT4 / YHR092C , HXT5 / YHR096C , HXT8 / YJL214W , HXT10 / YFL011W , HXT16 / YJR158W , RGT2 / YDL138W , and SNF3 / YDL194W ) of the HXT gene family ( Figure 3 ). Interestingly, all remaining...”
• Phylogenetic and Transcripts Profiling of Glucose Sensing Related Genes in Candida glabrata
  Ng, Jundishapur journal of microbiology 2015
  • “...YHR096C DAA06790 592 66.3 HXT6 YDR343C DAA12184 570 62.7 HXT7 YDR342C DAA12183 570 62.7 HXT8 YJL214W DAA08597 569 63.5 HXT9 YJL219W DAA08593 567 62.9 HXT10 YFL011W DAA12428 546 60.7 HXT11 YOL156W DAA10630 567 62.7 HXT13 YEL069C DAA07586 564 62.7 HXT14 YNL318C CAA96250 540 61.0 HXT15 YDL245C...”
• The switch from fermentation to respiration in Saccharomyces cerevisiae is regulated by the Ert1 transcriptional activator/repressor
  Gasmi, Genetics 2014
  • “...YKR093W QDR3 PHD1 -- HXT8 YBR043C YLR043W YLR044W YJL214W IMA5 PMA1 TKL1 DIP5 YJL216C YGL008C YPR074C YPL265W ATO2 HAP4 YNR002C YKL109W GID8 YMR135C FMP43...”
  • “...in highly purified mitochondria in high-throughput studies YKL044W YJL214W IMA5 YJL216C PMA1 YGL008C TKL1 YPR074C DSF1 YEL070W DIP5 YPL265W - YGR161W-C Unknown...”
• Transcriptomic profiling of the Saccharomyces cerevisiae response to quinine reveals a glucose limitation response attributable to drug-induced inhibition of glucose uptake
  dos, Antimicrobial agents and chemotherapy 2009
  • “...Membrane transport YCL025c YHR094c YMR011w YDR345c YHR092c YHR096c YJL214w YFL011w YKL217w YHL036w YML123c YCR037c YBR106w YBR296c YFL054c -- -- S R -- S --...”
• Phospholipid transfer protein Sec14 is required for trafficking from endosomes and regulates distinct trans-Golgi export pathways
  Curwin, The Journal of biological chemistry 2009
  • “...YER149C YLR429W YIL090W PER1 YCR044C DSD1 HXT8 YGL196W YJL214W LSM1 CBF1 YJL124C YJR060W RAD27 YKL113C EAF7 RAD34 YSA1 CUE3 YNL136W YDR314C YBR111C YGL110C...”
• Regulatory network connecting two glucose signal transduction pathways in Saccharomyces cerevisiae
  Kaniak, Eukaryotic cell 2004
  • “...YER028C YGL039W YKL035W YOL016C YHR087W YMR316W YER062C YJL214W YBR105C YDR423C YHR097C YOL046C YBR067C YDR277C YOL136C YFL054C YDR001C YPL026C YLR413W YDL062W...”
• More
• Optimizing pentose utilization in yeast: the need for novel tools and approaches
  Young, Biotechnology for biofuels 2010
  • “...TMB3201 + Saccharomyces cerevisiae HXT7 P39004 YEpkHXT7 [ 64 ] TMB3201 + Saccharomyces cerevisiae HXT8 P40886 p4H7 [ 64 ] TMB3201 - Saccharomyces cerevisiae HXT9 P40885 p4H7 [ 64 ] TMB3201 - Saccharomyces cerevisiae HXT10 P43581 p4H7 [ 64 ] TMB3201 - Saccharomyces cerevisiae HXT11 P54862...”
• Major facilitator superfamily
  Pao, Microbiology and molecular biology reviews : MMBR 1998
  • “...P49374 P32465 P23585 P32466 P32467 P38695 P39003 P39004 P40886 P43581 P40885 P39924 P42833 P47185 Z71687 P30605 X98622 P30606 S51081 P07921 P38156 P15685 P18631...”

TC 2.A.1.1.6 / P13181 Galactose, glucose uniporter, Gal2. Also transports xylose from Saccharomyces cerevisiae (Baker's yeast) (see 4 papers)
GAL2 / GI|1360445 galactose transporter from Saccharomyces cerevisiae
NP_013182 galactose permease GAL2 from Saccharomyces cerevisiae S288C
NP_013182, YLR081W Gal2p from Saccharomyces cerevisiae
68% identity, 99% coverage

• substrates: Galactose, Xylose, glucose
  tcdb comment: This transporter has been engineered by mutation (N376F) to transport xylose without being inhibited by glucose or transporting other hexoses (Farwick et al. 2014). The 3-d structure is known (Wang et al. 2015)
• Advances in fungal sugar transporters: unlocking the potential of second-generation bioethanol production
  Pereira, Applied microbiology and biotechnology 2025
  • “...) HXT13 P39924 Glucose and mannose S. cerevisiae Young et al. ( 2011 ) Gal2 P13181 Glucose, xylose, L-arabinose, galactose, fructose, mannose, and ribose S. cerevisiae Hamacher et al. ( 2002 ); Becker and Boles ( 2003 ); Young et al. ( 2011 ) GXF1 Q2MDH1...”
• The Penicillium chrysogenum transporter PcAraT enables high-affinity, glucose-insensitive l-arabinose transport in Saccharomyces cerevisiae
  Bracher, Biotechnology for biofuels 2018
  • “...rooted in iTOL ( https://itol.embl.de/ ) [ 54 ]. Gene accession numbers were ScGAL2 : P13181, PcaraT : CAP85508, SsaraT : XP_001382755, Atstp2 : OAP13698, Kmaxt1 : GZ791039, Pgaxt1 : GZ791040, Amlat1 : AY923868, Amlat2 : AY923869, Nclat - 1 : EAA30346, Mtlat - 1 :...”
  • “...literature references for each transporter are provided in Table 6 . Accession numbers: Sc Gal2: P13181, Pc AraT: CAP85508, Ss AraT: A3LQQ5-1, At Stp2: OAP13698, Km Axt1: GZ791039, Pg Axt1: GZ791040, Am Lat1: AY923868, Am Lat2: AY923869, Nc Lat-1: EAA30346, Mt Lat-1: G2QFT5-1 l -Arabinose transport...”
• Functional survey for heterologous sugar transport proteins, using Saccharomyces cerevisiae as a host
  Young, Applied and environmental microbiology 2011
  • “...a EcoRI ClaI XmaI ClaI BamHI-HF ClaI XmaI ClaI P13181 GAL2 S. cerevisiae 3, 38 Introns, Synthesized by Blue Heron Biotechnology EY220 EY221 EY194 EY208 EY159...”
• Optimizing pentose utilization in yeast: the need for novel tools and approaches
  Young, Biotechnology for biofuels 2010
  • “...TMB3201 - Saccharomyces cerevisiae HXT15 P54854 p4H7 [ 64 ] TMB3201 - Saccharomyces cerevisiae GAL2 P13181 pHL125 [ 64 ] TMB3201 + Several previous studies have evaluated the capacity of selected transport proteins to uptake xylose in yeast. The strain genotype (described in Table 2) used...”
• Major facilitator superfamily
  Pao, Microbiology and molecular biology reviews : MMBR 1998
  • “...687 555 540 486 457 602 818 569 S59368 P13181 L21753 P49374 P32465 P23585 P32466 P32467 P38695 P39003 P39004 P40886 P43581 P40885 P39924 P42833 P47185 Z71687...”
  • “...Th2A of Trypanosoma brucei P37021 P09830 P09098 P21906 P43581 P13181 P11636 P30605 P07921 P15685 S59368 Q07647 U11843 P15686 Q02563 X78855 Q06222 SP SP SP SP SP...”
• Identification of a glucose-insensitive variant of Gal2 from Saccharomyces cerevisiae exhibiting a high pentose transport capacity.
  Rojas, Scientific reports 2021
  • GeneRIF: Identification of a glucose-insensitive variant of Gal2 from Saccharomyces cerevisiae exhibiting a high pentose transport capacity.
• The regulatory roles of the galactose permease and kinase in the induction response of the GAL network in Saccharomyces cerevisiae.
  Hawkins, The Journal of biological chemistry 2006 (PubMed)
  • GeneRIF: The roles of GAL1 and GAL2 in the activation of the galactose metabolism network of S. cerevisiae are reported.
• The ubiquitin ligase SCF(Grr1) is required for Gal2p degradation in the yeast Saccharomyces cerevisiae.
  Horak, Biochemical and biophysical research communications 2005 (PubMed)
  • GeneRIF: In this study, we show that the other components of SCF(Grr1), including Skp1, Rbx1p, and the ubiquitin-conjugating enzyme Cdc34, are also necessary for glucose-induced Gal2p degradation.
• Phenotypic selection during laboratory evolution of yeast populations leads to a genome-wide sustainable chromatin compaction shift
  Moreno, Frontiers in microbiology 2022
  • “...alanine tRNA, five of them code for uncharacterized or dubious ORFs (YFL063W, YHR217C, YLL066W-B, YLL065W, YLR081W, and YML122C), and the last one for the plasma membrane permease GIT1 which mediates uptake of glycerophosphoinositol and glycerophosphocholine. Between day10 and day28, during which no selection pressure was applied,...”
• Yeast Double Transporter Gene Deletion Library for Identification of Xenobiotic Carriers in Low or High Throughput
  Almeida, mBio 2021
  • “...YJL214W, YJR040W, YJR054W, YJR152W, YKL174C, YKL217W, YKR039W, YKR050W, YKR103W, YKR106W, YLL028W, YLL043W, YLL048C, YLL052C, YLL061W, YLR081W, YLR092W, YLR130C, YLR138W, YLR237W, YML047C, YML116W, YML123C, YMR011W, YMR177W, YMR243C, YMR279C, YMR319C, YNL065W, YNL142W, YNL268W, YNL270C, YNL275W, YNL291C, YNL318C, YNR002C, YNR055C, YNR056C, YNR072W, YOL020W, YOL103W, YOL122C, YOL158C, YOR011W, YOR071C, YOR153W,...”
• Improved Xylose Metabolism by a CYC8 Mutant of Saccharomyces cerevisiae
  Nijland, Applied and environmental microbiology 2017
  • “...YHR096C YHR094C YJL214W YDL245C YJR158W YEL069C YFL011W YJL219W YOL156W YLR081W YNL318C Sum of all HXTs Sum of all genes Gene HXT2 HXT36 HXT7 HXT4 HXT5 HXT1...”
• Extensive Copy Number Variation in Fermentation-Related Genes Among Saccharomyces cerevisiae Wine Strains
  Steenwyk, G3 (Bethesda, Md.) 2017
  • “...), we also examined the absolute CN of all other 10 members ( GAL2 / YLR081W , HXT1 / YHR094C , HXT2 / YMR011W , HXT4 / YHR092C , HXT5 / YHR096C , HXT8 / YJL214W , HXT10 / YFL011W , HXT16 / YJR158W , RGT2...”
• Multiplexed gene control reveals rapid mRNA turnover
  Baudrimont, Science advances 2017
  • “...endogenous, substitutional, and insertional promoters. ( B ) Time course of the decay of the YLR081W ( GAL2 ) mRNA driven by its endogenous promoter (shut down by galactose removal; t 1/2 = 2.6 min) or driven by the substitutional promoter ( t 1/2 = 2.6...”
• Genetic basis of the highly efficient yeast Kluyveromyces marxianus: complete genome sequence and transcriptome analyses
  Lertwattanasakul, Biotechnology for biofuels 2015
  • “...of amino acid sequences of sugar transporters are as follows: Ps_HGT2, XP_001382755; Sc_HXT7, NP_010629; Sc_GAL2, NP_013182; Dh_xylhp, AY347871; Ci_GXS1, GN107181; Ci_GXF1, GN107179; Ps_SUT1, XP_001387898; Ps_SUT2, XP_001384295; Ps_SUT3, XP_001386019; Ps_HXT2.4, XP_001387757; Ps_XUT1, XP_001385583; Ps_XUT2, XP_001387242; Ps_XUT3, XP_001387138; Ps_XUT4, XP_001386715; Ps_XUT5, XP_001385962; Ps_XUT6, XP_001386589; Ps_XUT7, XP_001387067; Ps_RGT2, XP_001386588;...”
• Conservation of replication timing reveals global and local regulation of replication origin activity
  Müller, Genome research 2012
  • “...genome. Second, we noted that one of the genes adjacent to ARS1212 ( GAL2 / YLR081W ) is duplicated in S. bayanus , raising the possibility that ARS1212 is also duplicated (Supplemental Fig. S18). The presence of two close origins could then account for the observed...”
• Positional analyses of BRCA1-dependent expression in Saccharomyces cerevisiae
  Skibbens, Cell cycle (Georgetown, Tex.) 2008
  • “...Up 14.4041395 Up YBR020W GAL1 76.735115 Up 166.01247 Up YBR019C GAL10 78.75131 Up 53.76265 Up YLR081W GAL2 101.56116 Up 93.95381 Up YPL248C GAL4 36.34818 Up 46.29145 Up YBR018C GAL7 5.330396 Up 4.0937595 Up YDR019C GCV1 2.5090592 Up 2.682127 Up YPR184W GDB1 4.222917 Up 3.8256583 Up YAL062W...”
• More

KHT2 / CAA87389.1 permease from Kluyveromyces lactis (see paper)
P53387 Hexose transporter 2 from Kluyveromyces lactis
71% identity, 95% coverage

• Catabolite repression of Aox in Pichia pastoris is dependent on hexose transporter PpHxt1 and pexophagy
  Zhang, Applied and environmental microbiology 2010
  • “...for ScHxt6, NP_010629 for ScHxt7, AAU43755 for ScGal2, P53387 for KlKht2, XP_453656 for KlRag1, XP_719598 for CaHgt7, XP_001387898 for PsSut1, CAI77652 for...”

HXT6 / GI|1230670 high-affinity hexose transporter HXT6 from Saccharomyces cerevisiae
YDR343C High-affinity glucose transporter of the major facilitator superfamily, nearly identical to Hxt7p, expressed at high basal levels relative to other HXTs, repression of expression by high glucose requires SNF3 from Saccharomyces cerevisiae
NP_010630 hexose transporter HXT6 from Saccharomyces cerevisiae S288C
P39003 High-affinity hexose transporter HXT6 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
70% identity, 98% coverage

• Overexpression of THI4 and HAP4 Improves Glucose Metabolism and Ethanol Production in Saccharomyces cerevisiae
  Shi, Frontiers in microbiology 2018
  • “...Gene ID Gene name Primer sequences (53) YFL039C ACT1 F: TGGATTCCGGTGATGGTGTT (conference gene) R: TGGCGTGAGGTAGAGAGAAACC YDR343C HXT6 F: CGCTGCTATTGCAGAGCAAAC R: CGAGTGGGAGGCTGAGTCA YGR144W THI4 F: TTTGCCGTTTCTGACGTGATT R: GCGGCGGATAAACCTGAA YFL058W THI5 F: GGTTACTTCAAGGAGCAAGGTCTAGA R: CAGTGACATCGGAAGGATTGG YKL109W HAP4 F: TGTACCGATCGCCCCAAATA R: TGCCATCGTTTTCGAATTCC YJL208C NUC1 F: TCGATCCTTCCGGGTTCTT R: CGCGGTTCTGCAGATCATG YDL022W...”
• Improved Xylose Metabolism by a CYC8 Mutant of Saccharomyces cerevisiae
  Nijland, Applied and environmental microbiology 2017
  • “...carrying CYC8(Y353) and CYC8(Y353C)a CYC8(Y353) Probe YMR011W YDR343C YDR342C YHR092C YHR096C YHR094C YJL214W YDL245C YJR158W YEL069C YFL011W YJL219W YOL156W...”
• Extensive Copy Number Variation in Fermentation-Related Genes Among Saccharomyces cerevisiae Wine Strains
  Steenwyk, G3 (Bethesda, Md.) 2017
  • “...File S2 ). We identified seven members of the HXT gene family ( HXT6 / YDR343C , HXT7 / YDR342C , HXT9 / YJL219W , HXT11 / YOL156W , HXT13 / YEL069C , HXT15 / YDL245C , and HXT17 / YNR072W ), which is involved in...”
• Overexpression of a Water-Forming NADH Oxidase Improves the Metabolism and Stress Tolerance of Saccharomyces cerevisiae in Aerobic Fermentation
  Shi, Frontiers in microbiology 2016
  • “...TGGATTCCGGTGATGGTGTT R: TGGCGTGAGGTAGAGAGAAACC L196579 noxE F: TCAAAAATGGCGCAATCAAG R: CCGCGTAAACATCTGGATCA YJR158W Hxt16 F: TTTGAGCAACGTGCGTATGG R: CGCCAATGGAACATCCTACA YDR343C HXT6 F: CGCTGCTATTGCAGAGCAAAC R: CGAGTGGGAGGCTGAGTCA YGR144W THI4 F: TTTGCCGTTTCTGACGTGATT R: GCGGCGGATAAACCTGAA YFL058W THI5 F: GGTTACTTCAAGGAGCAAGGTCTAGA R: CAGTGACATCGGAAGGATTGG YJR156C THI11 F: CAAGAAGGCAACCGACTACGT R: GAGGCTTGAAGTCGATGTATTCTTT YNL332W THI12 F: GGTTACTTCAAGGAGCAAGGTCTAGA R: CAGTGACATCGGAAGGATTGG YDL244W...”
• A water-forming NADH oxidase regulates metabolism in anaerobic fermentation
  Shi, Biotechnology for biofuels 2016 (no snippet)
• Understanding the Role of the Master Regulator XYR1 in Trichoderma reesei by Global Transcriptional Analysis
  Dos, Frontiers in microbiology 2016
  • “...acid sequences of transporters from T. reesei and other species ( Saccharomyces cerevisiae YHR094C, YHR092C, YDR343C; Neurospora crassa NCU00821, NCU04963, NCU08114, NCU10021; Aspergillus nidulans AN3199, AN6831; Aspergillus oryzae AO090103000130, AO090038000233; Aspergillus niger XP_001397059.2; Escherichia coli YP006127731.1; Metarhizium anisopliae GQ167043.1, EFY97396.1, EFY94560.1; Talaromyces marneffei XP002152585.1; Talaromyces stipitatus...”
• Phylogenetic and Transcripts Profiling of Glucose Sensing Related Genes in Candida glabrata
  Ng, Jundishapur journal of microbiology 2015
  • “...YDR345C DAA12185 567 62.6 HXT4 YHR092C DAA06788 576 63.9 HXT5 YHR096C DAA06790 592 66.3 HXT6 YDR343C DAA12184 570 62.7 HXT7 YDR342C DAA12183 570 62.7 HXT8 YJL214W DAA08597 569 63.5 HXT9 YJL219W DAA08593 567 62.9 HXT10 YFL011W DAA12428 546 60.7 HXT11 YOL156W DAA10630 567 62.7 HXT13 YEL069C...”
• Genetics of single-cell protein abundance variation in large yeast populations
  Albert, Nature 2014
  • “...We noticed two clear outliers in terms of estimated purity. First, the pools for gene YDR343C ( HXT6 ) had 5060% of reads mapping to the gene YDR342C ( HXT7 ). These two genes are close paralogs, and both the ends of their ORFs and their...”
  • “...sequences. Off-target reads are therefore expected at 25% of reads for YGR192C. We retained both YDR343C and YGR192C in our analyses. The remaining genes with apparent contamination have low absolute numbers of reads overlapping the cassette fusions so that a single off-target read has a disproportionate...”
• More
• Multilevel regulation of an α-arrestin by glucose depletion controls hexose transporter endocytosis.
  Hovsepian, The Journal of cell biology 2017
  • GeneRIF: Two glucose signaling pathways converge onto Csr2 to regulate hexose transporter Hxt6 endocytosis by glucose availability.
• Regulation of the Yeast Hxt6 Hexose Transporter by the Rod1 α-Arrestin, the Snf1 Protein Kinase, and the Bmh2 14-3-3 Protein.
  Llopis-Torregrosa, The Journal of biological chemistry 2016
  • GeneRIF: demonstrated the interaction of Rod1 with Hxt6 and showed that the localization of the Rod1-Hxt6 complex at the plasma membrane is affected by carbon source and is reduced upon overexpression of SNF1 and BMH2
• Reciprocal sign epistasis between frequently experimentally evolved adaptive mutations causes a rugged fitness landscape.
  Kvitek, PLoS genetics 2011
  • GeneRIF: Variation in the copy number of HXT6/HTX7 locus was observed in a survey of ~70 yeast strains.
• Components of the Vid30c are needed for the rapamycin-induced degradation of the high-affinity hexose transporter Hxt7p in Saccharomyces cerevisiae.
  Snowdon, FEMS yeast research 2008 (PubMed)
  • GeneRIF: Three members of the VID and GID gene families, VID30/GID1, GID2, and VID28/GID5 are needed for the rapamycin or nitrogen starvation-induced degradation of the high-affinity hexose transporter Hxt7p is shown here.
• Advances in fungal sugar transporters: unlocking the potential of second-generation bioethanol production
  Pereira, Applied microbiology and biotechnology 2025
  • “...S. cerevisiae Reifenberger et al. ( 1995 ); Apel et al. ( 2016 ) HXT6 P39003 Glucose, fructose, and mannose S. cerevisiae Reifenberger et al. ( 1995 ) HXT7 P39004 Glucose, xylose, galactose, fructose, and mannose S. cerevisiae Young et al. ( 2011 ) HXT13 P39924...”
• Novel Citronellyl-Based Photoprobes Designed to Identify ER Proteins Interacting with Dolichyl Phosphate in Yeast and Mammalian Cells.
  Rush, Current chemical biology 2015
  • “...+ P54862 11 Hexose transporter HXT11 + + P40885 11 Hexose transporter HXT9 + + P39003 11 High-affinity hexose transporter HXT6 + + P39004 11 High-affinity hexose transporter HXT6 + + P32466 11 Low-affinity glucose transporter HXT3 + + P32467 11 Low-affinity glucose transporter HXT4 +...”
• Rapid response of the yeast plasma membrane proteome to salt stress
  Szopinska, Molecular & cellular proteomics : MCP 2011
  • “...PM PM PM PM and MT P23291 P38250 P39004 P39003 P38695 P32467 P32466 P23585 P32465 P06775 P53154 P10823 P08539 P38631 Q08193 Q03655 P22146 P38196 P40088 Q12333...”
• Major facilitator superfamily
  Pao, Microbiology and molecular biology reviews : MMBR 1998
  • “...P13181 L21753 P49374 P32465 P23585 P32466 P32467 P38695 P39003 P39004 P40886 P43581 P40885 P39924 P42833 P47185 Z71687 P30605 X98622 P30606 S51081 P07921 P38156...”

HXT7_YEAST / P39004 High-affinity hexose transporter HXT7 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
TC 2.A.1.1.31 / P39004 High affinity, glucose-repressible, glucose (hexose) uniporter (Hxt6/Hxt7). Asn331 and hydrophobic residue side chains in TMS5 determine substrate affinity from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (see 6 papers)
NP_010629, YDR342C High-affinity glucose transporter of the major facilitator superfamily, nearly identical to Hxt6p, expressed at high basal levels relative to other HXTs, expression repressed by high glucose levels from Saccharomyces cerevisiae
NP_010629 hexose transporter HXT7 from Saccharomyces cerevisiae S288C
70% identity, 98% coverage

• function: High-affinity glucose transporter
• substrates: Hexoses
  tcdb comment: Also transports xylose (Effect of Isomixing on Grape Must Fermentations of ATF1-Overexpressing Wine Yeast Strains
  van, Foods (Basel, Switzerland) 2020
  • “...1578-bp ATF1 open reading frame (ORF; YOR377w and HXT7 promoter (1000 bp upstream of ORF YDR342c)) was amplified using Phusion Taq polymerase (Thermo Scientific, Waltham, MA, USA) from genomic DNA of S. cerevisiae VIN13 using the primers listed in Table S1 . The amplicon containing ATF1...”
• Improved Xylose Metabolism by a CYC8 Mutant of Saccharomyces cerevisiae
  Nijland, Applied and environmental microbiology 2017
  • “...CYC8(Y353) and CYC8(Y353C)a CYC8(Y353) Probe YMR011W YDR343C YDR342C YHR092C YHR096C YHR094C YJL214W YDL245C YJR158W YEL069C YFL011W YJL219W YOL156W YLR081W...”
• Extensive Copy Number Variation in Fermentation-Related Genes Among Saccharomyces cerevisiae Wine Strains
  Steenwyk, G3 (Bethesda, Md.) 2017
  • “...identified seven members of the HXT gene family ( HXT6 / YDR343C , HXT7 / YDR342C , HXT9 / YJL219W , HXT11 / YOL156W , HXT13 / YEL069C , HXT15 / YDL245C , and HXT17 / YNR072W ), which is involved in sugar transport, that were...”
• Genetic basis of the highly efficient yeast Kluyveromyces marxianus: complete genome sequence and transcriptome analyses
  Lertwattanasakul, Biotechnology for biofuels 2015
  • “...accession numbers of amino acid sequences of sugar transporters are as follows: Ps_HGT2, XP_001382755; Sc_HXT7, NP_010629; Sc_GAL2, NP_013182; Dh_xylhp, AY347871; Ci_GXS1, GN107181; Ci_GXF1, GN107179; Ps_SUT1, XP_001387898; Ps_SUT2, XP_001384295; Ps_SUT3, XP_001386019; Ps_HXT2.4, XP_001387757; Ps_XUT1, XP_001385583; Ps_XUT2, XP_001387242; Ps_XUT3, XP_001387138; Ps_XUT4, XP_001386715; Ps_XUT5, XP_001385962; Ps_XUT6, XP_001386589; Ps_XUT7, XP_001387067;...”
• Phylogenetic and Transcripts Profiling of Glucose Sensing Related Genes in Candida glabrata
  Ng, Jundishapur journal of microbiology 2015
  • “...YHR092C DAA06788 576 63.9 HXT5 YHR096C DAA06790 592 66.3 HXT6 YDR343C DAA12184 570 62.7 HXT7 YDR342C DAA12183 570 62.7 HXT8 YJL214W DAA08597 569 63.5 HXT9 YJL219W DAA08593 567 62.9 HXT10 YFL011W DAA12428 546 60.7 HXT11 YOL156W DAA10630 567 62.7 HXT13 YEL069C DAA07586 564 62.7 HXT14 YNL318C...”
• Lipid droplet dynamics in budding yeast
  Wang, Cellular and molecular life sciences : CMLS 2015
  • “...W V N Histone H2B HXT6/7 YDR343C/ YDR342C V PM/M High-affinity glucose transporter IDP3 YNL009W V C/P/M Peroxisomal NADP-dependent isocitrate dehydrogenase...”
• Genetics of single-cell protein abundance variation in large yeast populations
  Albert, Nature 2014
  • “...pools for gene YDR343C ( HXT6 ) had 5060% of reads mapping to the gene YDR342C ( HXT7 ). These two genes are close paralogs, and both the ends of their ORFs and their downstream sequence are virtually identical, suggesting that the apparent contamination is in...”
• Transferring functional annotations of membrane transporters on the basis of sequence similarity and sequence motifs
  Barghash, BMC bioinformatics 2013
  • “...will term the normalized BLAST results "normalized E-values". As an example, we BLASTed Sc transporter YDR342C either against the At dataset (23,567 residues) or against the non-redundant (nr) database of 2011 with 3,877,139,759 residues. Among the matching sequences, we identified the Arabidopsis transporter At3g19940 in both...”
• More
• Regulation of Hxt3 and Hxt7 turnover converges on the Vid30 complex and requires inactivation of the Ras/cAMP/PKA pathway in Saccharomyces cerevisiae.
  Snowdon, PloS one 2012
  • GeneRIF: turnover of both Hxt3 and Hxt7 is dependent on the essential E3 ubiquitin ligase, Rsp5, indicating that the role of the Vid30c might be indirect of Hxt ubiquitylation
• Reciprocal sign epistasis between frequently experimentally evolved adaptive mutations causes a rugged fitness landscape.
  Kvitek, PLoS genetics 2011
  • GeneRIF: Variation in the copy number of HXT6/HTX7 locus was observed in a survey of ~70 yeast strains.
• Crucial effects of amino acid side chain length in transmembrane segment 5 on substrate affinity in yeast glucose transporter Hxt7.
  Kasahara, Biochemistry 2011 (PubMed)
  • GeneRIF: The amino acid side chain length in transmembrane segment 5 of HXT7 is important for glucose affinity.
• Identification of a key residue determining substrate affinity in the yeast glucose transporter Hxt7: a two-dimensional comprehensive study.
  Kasahara, The Journal of biological chemistry 2010
  • GeneRIF: Asp(340) is situated at or close to a substrate recognition site and is a key residue determining high-affinity glucose transport by Hxt7
• Enhanced arsenic accumulation in Saccharomyces cerevisiae overexpressing transporters Fps1p or Hxt7p.
  Shah, Journal of biotechnology 2010 (PubMed)
  • GeneRIF: Saccharomyces cerevisiae was engineered for enhanced arsenite accumulation by overexpression of transporters responsible for the influx of the contaminant. The transporter genes FPS1 and HXT7 were cloned under the control of the late-phase ADH2-promoter.
• Cell growth restoration and high level protein expression by the promoter of hexose transporter, HXT7, from Saccharomyces cerevisiae.
  Lai, Biotechnology letters 2007 (PubMed)
  • GeneRIF: promoter produces higher invertase activity at 139- and 30-fold of the basal activity in strains GN 3C.2 and W303-1, respectively
• Characterization of the effectiveness of hexose transporters for transporting xylose during glucose and xylose co-fermentation by a recombinant Saccharomyces yeast.
  Sedlak, Yeast (Chichester, England) 2004 (PubMed)
  • GeneRIF: Saccharomyces galactose transporter system could be a highly effective xylose transporter. The information reported here should be of great importance for improving the Saccharomyces yeast transport of xylose.
• Advances in fungal sugar transporters: unlocking the potential of second-generation bioethanol production
  Pereira, Applied microbiology and biotechnology 2025
  • “...HXT6 P39003 Glucose, fructose, and mannose S. cerevisiae Reifenberger et al. ( 1995 ) HXT7 P39004 Glucose, xylose, galactose, fructose, and mannose S. cerevisiae Young et al. ( 2011 ) HXT13 P39924 Glucose and mannose S. cerevisiae Young et al. ( 2011 ) Gal2 P13181 Glucose,...”
• Yeast α-arrestin Art2 is the key regulator of ubiquitylation-dependent endocytosis of plasma membrane vitamin B1 transporters
  Savocco, PLoS biology 2019
  • “...P32791 FRE1 0.31 P32466 HXT3 0.35 P38085 TAT1 0.38 Q06689 INA1 0.41 P32465 HXT1 0.42 P39004 HXT7 0.44 P32467 HXT4 0.48 P38079 YRO2 0.55 P40088 FTR1 0.55 P05030 PMA1 0.58 Q12256 TPO4 0.58 P38993 FET3 0.60 P49573 CTR1 0.63 P40474 QDR2 0.64 P22146 GAS1 0.74 P33302...”
  • “...0.3 P32465 HXT1 4.6 2.8 4.4 9.3 2.6 1.6 2.2 1.8 1.7 2.4 1.4 1.9 P39004 HXT7 0.6 0.4 0.3 1.1 0.6 0.2 0.9 0.6 0.1 0.7 0.1 0.4 P32467 HXT4 0.7 0.6 0.6 2.8 0.5 0.6 0.7 0.5 0.4 0.6 0.2 0.5 P38079 YRO2 3.9...”
• Novel Citronellyl-Based Photoprobes Designed to Identify ER Proteins Interacting with Dolichyl Phosphate in Yeast and Mammalian Cells.
  Rush, Current chemical biology 2015
  • “...P40885 11 Hexose transporter HXT9 + + P39003 11 High-affinity hexose transporter HXT6 + + P39004 11 High-affinity hexose transporter HXT6 + + P32466 11 Low-affinity glucose transporter HXT3 + + P32467 11 Low-affinity glucose transporter HXT4 + + Q03516 11 Uncharacterized protein RSN1 + P53154...”
• Functional survey for heterologous sugar transport proteins, using Saccharomyces cerevisiae as a host
  Young, Applied and environmental microbiology 2011
  • “...enzymes and primers used. 15, 36 P39924 HXT13 15, 36 P39004 HXT7 15, 36 P32466 HXT4 a EcoRI ClaI XmaI ClaI BamHI-HF ClaI XmaI ClaI P13181 GAL2 S. cerevisiae...”
• Rapid response of the yeast plasma membrane proteome to salt stress
  Szopinska, Molecular & cellular proteomics : MCP 2011
  • “...PM PM PM PM PM and MT P23291 P38250 P39004 P39003 P38695 P32467 P32466 P23585 P32465 P06775 P53154 P10823 P08539 P38631 Q08193 Q03655 P22146 P38196 P40088...”
• Optimizing pentose utilization in yeast: the need for novel tools and approaches
  Young, Biotechnology for biofuels 2010
  • “...H2219 + Saccharomyces cerevisiae HXT4 P32467 pYX212 [ 66 ] H2219 + Saccharomyces cerevisiae HXT7 P39004 pYX212 [ 66 ] H2219 + Saccharomyces cerevisiae HXT1 P32465 p4H7 [ 64 ] TMB3201 - Saccharomyces cerevisiae HXT3 P32466 p4H7 [ 64 ] TMB3201 - Saccharomyces cerevisiae HXT4 P32467...”
  • “...TMB3201 + Saccharomyces cerevisiae HXT5 P38695 p4H7 [ 64 ] TMB3201 + Saccharomyces cerevisiae HXT7 P39004 YEpkHXT7 [ 64 ] TMB3201 + Saccharomyces cerevisiae HXT8 P40886 p4H7 [ 64 ] TMB3201 - Saccharomyces cerevisiae HXT9 P40885 p4H7 [ 64 ] TMB3201 - Saccharomyces cerevisiae HXT10 P43581...”
• Major facilitator superfamily
  Pao, Microbiology and molecular biology reviews : MMBR 1998
  • “...L21753 P49374 P32465 P23585 P32466 P32467 P38695 P39003 P39004 P40886 P43581 P40885 P39924 P42833 P47185 Z71687 P30605 X98622 P30606 S51081 P07921 P38156 P15685...”

KLMA_50360 hexose transporter 2 from Kluyveromyces marxianus DMKU3-1042
72% identity, 95% coverage

• Genetic basis of the highly efficient yeast Kluyveromyces marxianus: complete genome sequence and transcriptome analyses
  Lertwattanasakul, Biotechnology for biofuels 2015
  • “...the yeast in xylose [ 4 ]. The phylogenetic tree of sugar transporters revealed that KLMA_50360, KLMA_50361, KLMA_50362, KLMA_50363, and KLMA_50364 share high similarity with xylose transporters predicted in S. stipitis (Figure 4 ) [ 21 ]. Unlike S. stipitis , however, these genes were not...”

XP_444861 hypothetical protein from Candida glabrata CBS 138
70% identity, 96% coverage

• Characteristics of Extracellular Vesicles Released by the Pathogenic Yeast-Like Fungi Candida glabrata, Candida parapsilosis and Candida tropicalis
  Karkowska-Kuleta, Cells 2020
  • “...ATPase 1 (Pma1) + + gi|50284865 (XP_444860) CAGL0A02211g high-affinity hexose transporter (Hxt7) + + gi|50284867 (XP_444861) CAGL0A02233g high-affinity hexose transporter (Hxt6) + gi|50284869 (XP_444862) CAGL0A02255g uncharacterized protein + + gi|50284959 (XP_444908) CAGL0A03234g elongation factor 2 (Eft2) + + gi|50285099 (XP_444978) CAGL0A04829g hexokinase (Hxk2) + gi|50285355 (XP_445106)...”
• Phylogenetic and Transcripts Profiling of Glucose Sensing Related Genes in Candida glabrata
  Ng, Jundishapur journal of microbiology 2015
  • “...CAG57758 556 61.5 HXT4 CAGL0A01782 XP_444843 568 62.9 HXT5 CAGL0A01826 CAG57738 588 65.7 HXT4/6/7 CAGL0A02233 XP_444861 549 61.2 HXT6/7 CAGL0A02211 XP_444860 552 61.5 HXT6/7 CAGL0A00737 XP_444803 549 61.6 HXT2/10 CAGL0D02662 XP_445530 564 62.4 HXT2/10 CAGL0D02640 XP_445530 564 62.4 HXT2/10 CAGL0I00286 XP_447265 555 61.7 HXT14 CAGL0M04103 XP_449525...”

XP_444860 hypothetical protein from Candida glabrata CBS 138
68% identity, 97% coverage

• Characteristics of Extracellular Vesicles Released by the Pathogenic Yeast-Like Fungi Candida glabrata, Candida parapsilosis and Candida tropicalis
  Karkowska-Kuleta, Cells 2020
  • “...glucose transporter (Hxt5) + gi|50284733 (XP_444794) CAGL0A00495g plasma membrane ATPase 1 (Pma1) + + gi|50284865 (XP_444860) CAGL0A02211g high-affinity hexose transporter (Hxt7) + + gi|50284867 (XP_444861) CAGL0A02233g high-affinity hexose transporter (Hxt6) + gi|50284869 (XP_444862) CAGL0A02255g uncharacterized protein + + gi|50284959 (XP_444908) CAGL0A03234g elongation factor 2 (Eft2) +...”
• Phylogenetic and Transcripts Profiling of Glucose Sensing Related Genes in Candida glabrata
  Ng, Jundishapur journal of microbiology 2015
  • “...XP_444843 568 62.9 HXT5 CAGL0A01826 CAG57738 588 65.7 HXT4/6/7 CAGL0A02233 XP_444861 549 61.2 HXT6/7 CAGL0A02211 XP_444860 552 61.5 HXT6/7 CAGL0A00737 XP_444803 549 61.6 HXT2/10 CAGL0D02662 XP_445530 564 62.4 HXT2/10 CAGL0D02640 XP_445530 564 62.4 HXT2/10 CAGL0I00286 XP_447265 555 61.7 HXT14 CAGL0M04103 XP_449525 531 59.0 Table 2. Details...”

KLMA_50361 hexose transporter 2 from Kluyveromyces marxianus DMKU3-1042
72% identity, 95% coverage

• Genetic basis of the highly efficient yeast Kluyveromyces marxianus: complete genome sequence and transcriptome analyses
  Lertwattanasakul, Biotechnology for biofuels 2015
  • “...yeast in xylose [ 4 ]. The phylogenetic tree of sugar transporters revealed that KLMA_50360, KLMA_50361, KLMA_50362, KLMA_50363, and KLMA_50364 share high similarity with xylose transporters predicted in S. stipitis (Figure 4 ) [ 21 ]. Unlike S. stipitis , however, these genes were not induced...”

HXT4_YEAST / P32467 Low-affinity glucose transporter HXT4; Low-affinity glucose transporter LGT1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
TC 2.A.1.1.30 / P32467 Low affinity, constitutive, glucose (hexose; xylose) uniporter, Hxt4 (LGT1; Rag1) (also transports arsenic trioxide [As(OH)3] as do Hxtl, 3, 5, 7 and 9) from Saccharomyces cerevisiae (Baker's yeast) (see 5 papers)
HXT4 low-affinity glucose transporter HXT4 from Saccharomyces cerevisiae (see paper)
NP_011960 hexose transporter HXT4 from Saccharomyces cerevisiae S288C
69% identity, 97% coverage

• function: Low-affinity glucose transporter. Can also transport xylose.
• substrates: Xylose, glucose
  tcdb comment: The Kluyveromyces lactis ortholog is 73% identical and is similarly regulated (Rolland et al. 2006)
• Advances in fungal sugar transporters: unlocking the potential of second-generation bioethanol production
  Pereira, Applied microbiology and biotechnology 2025
  • “...S. cerevisiae Reifenberger et al. ( 1995 ); Apel et al. ( 2016 ) HXT4 P32467 Glucose, xylose, fructose and mannose S. cerevisiae Reifenberger et al. ( 1995 ); Apel et al. ( 2016 ) HXT5 P38695 Glucose, xylose, fructose, and mannose S. cerevisiae Reifenberger et...”
• Yeast α-arrestin Art2 is the key regulator of ubiquitylation-dependent endocytosis of plasma membrane vitamin B1 transporters
  Savocco, PLoS biology 2019
  • “...P32466 HXT3 0.35 P38085 TAT1 0.38 Q06689 INA1 0.41 P32465 HXT1 0.42 P39004 HXT7 0.44 P32467 HXT4 0.48 P38079 YRO2 0.55 P40088 FTR1 0.55 P05030 PMA1 0.58 Q12256 TPO4 0.58 P38993 FET3 0.60 P49573 CTR1 0.63 P40474 QDR2 0.64 P22146 GAS1 0.74 P33302 PDR5 0.84 P32568...”
  • “...1.9 P39004 HXT7 0.6 0.4 0.3 1.1 0.6 0.2 0.9 0.6 0.1 0.7 0.1 0.4 P32467 HXT4 0.7 0.6 0.6 2.8 0.5 0.6 0.7 0.5 0.4 0.6 0.2 0.5 P38079 YRO2 3.9 1.2 2.8 1.2 1.5 0.6 2.0 1.1 0.4 1.5 1.7 0.5 P40088 FTR1 2.2...”
• Study of the Plasma Membrane Proteome Dynamics Reveals Novel Targets of the Nitrogen Regulation in Yeast
  Villers, Molecular & cellular proteomics : MCP 2017
  • “...P41948 P33413 P06775 P32901 P50276 Other transporters P32467 P38227 P33302 Plasma membrane ATPase P05030 Components of eisosomes and microdomains MCC P53252...”
• Novel Citronellyl-Based Photoprobes Designed to Identify ER Proteins Interacting with Dolichyl Phosphate in Yeast and Mammalian Cells.
  Rush, Current chemical biology 2015
  • “...11 High-affinity hexose transporter HXT6 + + P32466 11 Low-affinity glucose transporter HXT3 + + P32467 11 Low-affinity glucose transporter HXT4 + + Q03516 11 Uncharacterized protein RSN1 + P53154 10 Glycerol uptake protein 1 GUP1 + P40441 10 Putative hexose transporter 12 HXT12 + +...”
• Rapid response of the yeast plasma membrane proteome to salt stress
  Szopinska, Molecular & cellular proteomics : MCP 2011
  • “...PM PM and MT P23291 P38250 P39004 P39003 P38695 P32467 P32466 P23585 P32465 P06775 P53154 P10823 P08539 P38631 Q08193 Q03655 P22146 P38196 P40088 Q12333 P32791...”
• Optimizing pentose utilization in yeast: the need for novel tools and approaches
  Young, Biotechnology for biofuels 2010
  • “...H2219 + Saccharomyces cerevisiae HXT2 P23585 pYX212 [ 66 ] H2219 + Saccharomyces cerevisiae HXT4 P32467 pYX212 [ 66 ] H2219 + Saccharomyces cerevisiae HXT7 P39004 pYX212 [ 66 ] H2219 + Saccharomyces cerevisiae HXT1 P32465 p4H7 [ 64 ] TMB3201 - Saccharomyces cerevisiae HXT3 P32466...”
• Computational identification of ubiquitylation sites from protein sequences.
  Tung, BMC bioinformatics 2008
  • “...P40087 410 0.86 P16603 165 0.91 P37303 283 0.87 P38075 10 0.86 P31539 626 0.91 P32467 38 0.87 Figure 10 The sequence logo of the 23 peptides of promising ubiquitylation sites with w = 21. (a) Information content and (b) Frequency plot. For further validating the...”
• Major facilitator superfamily
  Pao, Microbiology and molecular biology reviews : MMBR 1998
  • “...569 S59368 P13181 L21753 P49374 P32465 P23585 P32466 P32467 P38695 P39003 P39004 P40886 P43581 P40885 P39924 P42833 P47185 Z71687 P30605 X98622 P30606 S51081...”
• Snf1p-dependent Spt-Ada-Gcn5-acetyltransferase (SAGA) recruitment and chromatin remodeling activities on the HXT2 and HXT4 promoters.
  van, The Journal of biological chemistry 2006 (PubMed)
  • GeneRIF: Snf1p-dependent Spt-Ada-Gcn5-acetyltransferase (SAGA) recruitment and chromatin remodeling activities on the HXT2 and HXT4 promoters.

XP_444803 hypothetical protein from Candida glabrata CBS 138
69% identity, 96% coverage

• Phylogenetic and Transcripts Profiling of Glucose Sensing Related Genes in Candida glabrata
  Ng, Jundishapur journal of microbiology 2015
  • “...CAG57738 588 65.7 HXT4/6/7 CAGL0A02233 XP_444861 549 61.2 HXT6/7 CAGL0A02211 XP_444860 552 61.5 HXT6/7 CAGL0A00737 XP_444803 549 61.6 HXT2/10 CAGL0D02662 XP_445530 564 62.4 HXT2/10 CAGL0D02640 XP_445530 564 62.4 HXT2/10 CAGL0I00286 XP_447265 555 61.7 HXT14 CAGL0M04103 XP_449525 531 59.0 Table 2. Details of Glucose Sensing-Related Genes of...”

XP_444843 hypothetical protein from Candida glabrata CBS 138
68% identity, 99% coverage

• Phylogenetic and Transcripts Profiling of Glucose Sensing Related Genes in Candida glabrata
  Ng, Jundishapur journal of microbiology 2015
  • “...CAG57729 424 46.4 HXT1 CAGL0A01804 CAG57737 563 62.3 HXT3 CAGL0A02321 CAG57758 556 61.5 HXT4 CAGL0A01782 XP_444843 568 62.9 HXT5 CAGL0A01826 CAG57738 588 65.7 HXT4/6/7 CAGL0A02233 XP_444861 549 61.2 HXT6/7 CAGL0A02211 XP_444860 552 61.5 HXT6/7 CAGL0A00737 XP_444803 549 61.6 HXT2/10 CAGL0D02662 XP_445530 564 62.4 HXT2/10 CAGL0D02640 XP_445530...”

NP_011960, YHR092C High-affinity glucose transporter of the major facilitator superfamily, expression is induced by low levels of glucose and repressed by high levels of glucose from Saccharomyces cerevisiae
69% identity, 95% coverage

• Functional analysis of a Phytophthora host-translocated effector using the yeast model system
  Wilson, PeerJ 2021
  • “...(YDR384C) Putative ammonium transporter; possible role in export of ammonia from the cell 1.1 HXT4 (YHR092C) High-affinity glucose transporter of the major facilitator superfamily, expression is induced by low levels of glucose and repressed by high levels of glucose 1.0 NFG1 (YLR042C) Cell wall protein of...”
  • “...Term size Query size Intersecting genes GO:0005353 Fructose transmembrane transporter activity 2.43 15 4 YDR345C, YHR092C GO:0015578 Mannose transmembrane transporter activity 2.43 15 4 YDR345C, YHR092C TF:M00061_0 Factor: Mig1p; motif: KANWWWWATSYGGGGWA; match class: 0 2.83 74 6 YDR345C, YDR384C, YHR092C Notes: Gene set enrichment analysis using...”
• Low Toxicological Impact of Commercial Pristine Multi-Walled Carbon Nanotubes on the Yeast Saccharomyces cerevisiae
  Martel, Nanomaterials (Basel, Switzerland) 2021
  • “...in different biological processes, such as metal ion homeostasis: FRE1 (YLR214W), utilization of carbon: HXT4 (YHR092C), nitrogen: ICR7 (YFR055W), and sulfur sources: SAM3 (YPL274W); purine biosynthesis and accumulation: ADE4 and FCY2 (YMR300C and YER056C); and ER-associated protein degradation: MNS1 (YJR131W). FRE1 produces a cell-surface iron reductase...”
• Yeast Double Transporter Gene Deletion Library for Identification of Xenobiotic Carriers in Low or High Throughput
  Almeida, mBio 2021
  • “...YFL055W, YGL077C, YGL114W, YGL255W, YGR055W, YGR121C, YGR138C, YGR217W, YGR224W, YGR260W, YGR281W, YGR289C, YHL016C, YHL040C, YHL047C, YHR092C, YHR094C, YHR096C, YIL013C, YIL088C, YIL120W, YIL121W, YJL093C, YJL129C, YJL212C, YJL214W, YJR040W, YJR054W, YJR152W, YKL174C, YKL217W, YKR039W, YKR050W, YKR103W, YKR106W, YLL028W, YLL043W, YLL048C, YLL052C, YLL061W, YLR081W, YLR092W, YLR130C, YLR138W, YLR237W, YML047C,...”
• Improved Xylose Metabolism by a CYC8 Mutant of Saccharomyces cerevisiae
  Nijland, Applied and environmental microbiology 2017
  • “...and CYC8(Y353C)a CYC8(Y353) Probe YMR011W YDR343C YDR342C YHR092C YHR096C YHR094C YJL214W YDL245C YJR158W YEL069C YFL011W YJL219W YOL156W YLR081W YNL318C Sum of...”
• Extensive Copy Number Variation in Fermentation-Related Genes Among Saccharomyces cerevisiae Wine Strains
  Steenwyk, G3 (Bethesda, Md.) 2017
  • “...( GAL2 / YLR081W , HXT1 / YHR094C , HXT2 / YMR011W , HXT4 / YHR092C , HXT5 / YHR096C , HXT8 / YJL214W , HXT10 / YFL011W , HXT16 / YJR158W , RGT2 / YDL138W , and SNF3 / YDL194W ) of the HXT gene...”
• Transcriptional profiling reveals molecular basis and novel genetic targets for improved resistance to multiple fermentation inhibitors in Saccharomyces cerevisiae
  Chen, Biotechnology for biofuels 2016
  • “...YCL025C, YCR021C , YDR011W, YDR135C, YDR345C , YER060W, YGL255W, YGR065C, YGR138C , YGR260W, YGR281W, YHL036W, YHR092C, YHR096C , YKL175W, YKR039W, YLL028W, YLR130C, YLR237W, YML116W, YOL119C, YOR153W, YOR306C, YOR328W, YPL036W, YPL058C, YPL274W YBR054W , YCL025C, YCR021C , YDR345C , YER103W, YGR138C , YHR094C, YHR096C , YPL036W YBL075C,...”
  • “...YBR069C, YCR021C , YDR011W, YDR046C, YDR135C, YDR345C , YDR497C, YER103W, YFL054C, YGL255W, YGR138C , YGR281W, YHR092C, YHR096C , YJR095W, YKL175W, YLL028W, YLR237W, YLR259C, YML116W, YOR153W, YOR328W, YPL058C, YPL274W, YPR138C, YPR156C Ion transport (GO: 0006811) YAL053W, YBR054W, YCL025C, YCR021C , YDR135C, YGL255W, YGR065C, YGR138C, YGR142W, YGR260W, YHL036W,...”
• Acetylated Deoxynivalenol Generates Differences of Gene Expression that Discriminate Trichothecene Toxicity
  Suzuki, Toxins 2016
  • “...sensor YHR094C HXT1 plasma membrane Low-affinity glucose transporter YMR011W HXT2 plasma membrane High-affinity glucose transporter YHR092C HXT4 plasma membrane High-affinity glucose transporter The gene expression of RGT1 , RGT2 , and SNF3 , which encode a component of a transcriptional regulator complex and glucose sensors, showed...”
• Understanding the Role of the Master Regulator XYR1 in Trichoderma reesei by Global Transcriptional Analysis
  Dos, Frontiers in microbiology 2016
  • “...amino acid sequences of transporters from T. reesei and other species ( Saccharomyces cerevisiae YHR094C, YHR092C, YDR343C; Neurospora crassa NCU00821, NCU04963, NCU08114, NCU10021; Aspergillus nidulans AN3199, AN6831; Aspergillus oryzae AO090103000130, AO090038000233; Aspergillus niger XP_001397059.2; Escherichia coli YP006127731.1; Metarhizium anisopliae GQ167043.1, EFY97396.1, EFY94560.1; Talaromyces marneffei XP002152585.1; Talaromyces...”
• More

TC 2.A.1.1.105 / P54862 Hexose transporter HXT11 (Low-affinity glucose transporter LGT3) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (see 3 papers)
YOL156W Hxt11p from Saccharomyces cerevisiae
65% identity, 96% coverage

• substrates: Hexoses
• Improved Xylose Metabolism by a CYC8 Mutant of Saccharomyces cerevisiae
  Nijland, Applied and environmental microbiology 2017
  • “...YHR092C YHR096C YHR094C YJL214W YDL245C YJR158W YEL069C YFL011W YJL219W YOL156W YLR081W YNL318C Sum of all HXTs Sum of all genes Gene HXT2 HXT36 HXT7 HXT4 HXT5...”
• Complete genome sequence and comparative genomics of the probiotic yeast Saccharomyces boulardii
  Khatri, Scientific reports 2017
  • “...of unknown function YGR295C COS6 Protein of unknown function YOL158C ENB1 Endosomal ferric enterobactin transporter YOL156W HXT11 Putative hexose transporter that is nearly identical to Hxt9p YJL219W HXT9 Putative hexose transporter that is nearly identical to Hxt11p YOL157C IMA2 Isomaltase YIL172C IMA3 Isomaltase YJL221C IMA4 Isomaltase...”
• Extensive Copy Number Variation in Fermentation-Related Genes Among Saccharomyces cerevisiae Wine Strains
  Steenwyk, G3 (Bethesda, Md.) 2017
  • “...( HXT6 / YDR343C , HXT7 / YDR342C , HXT9 / YJL219W , HXT11 / YOL156W , HXT13 / YEL069C , HXT15 / YDL245C , and HXT17 / YNR072W ), which is involved in sugar transport, that were among the 363 CN diverse genes (File S3...”
• Phylogenetic and Transcripts Profiling of Glucose Sensing Related Genes in Candida glabrata
  Ng, Jundishapur journal of microbiology 2015
  • “...YJL214W DAA08597 569 63.5 HXT9 YJL219W DAA08593 567 62.9 HXT10 YFL011W DAA12428 546 60.7 HXT11 YOL156W DAA10630 567 62.7 HXT13 YEL069C DAA07586 564 62.7 HXT14 YNL318C CAA96250 540 61.0 HXT15 YDL245C DAA11622 567 62.9 HXT16 YJR158W DAA08942 567 62.9 HXT17 YNR072W DAA10613 564 62.8 3.2. Phylogenetic...”
• Conservation of nucleosome positions in duplicated and orthologous gene pairs
  Nishida, TheScientificWorldJournal 2012
  • “...0.986389631 0.991000914 781603 chr15 YOL166W-A 0.969218719 0.964760148 585 + chr15 YOL157C 0.977029388 0.98945557 24293 chr15 YOL156W 0.979765672 0.992685071 25272 + chr15 YOL148C 0.957761501 0.971157209 47573 chr15 YOL104C 0.976917372 0.981386975 117454 chr15 YOL100W 0.961328138 0.959394148 129237 + chr15 YOL089C 0.971692903 0.984860678 153490 chr15 YOL086C 0.976082094 0.966862518 160594...”
  • “...YLR355C AFUA_3G14490 0.615946987 YLR307W AFUA_3G07210 0.615345397 YNL156C AFUA_4G07680 0.605449075 YOL157C AFUA_8G07070 0.600254438 YPL196W AFUA_3G08740 0.596649007 YOL156W AFUA_2G11520 0.589475104 YGL055W AFUA_7G05920 0.583471232 YER094C AFUA_4G07420 0.580111415 YER026C AFUA_4G13680 0.579632053 YKR031C AFUA_3G05630 0.578947614 YJR041C AFUA_1G13200 0.577042969 YCL057C-A AFUA_1G13195 0.56703028 YKL167C AFUA_6G12620 0.566497151 YDR334W AFUA_7G02370 0.556810391 YDL085W AFUA_1G11960 0.555058025 YIR038C...”
• A rapid and inexpensive labeling method for microarray gene expression analysis
  Ouellet, BMC biotechnology 2009
  • “...3.2* 2.9** YGR236C ( SPG1 ) 0.4** 0.4* 0.7* 0.5** YLR346C 7.7** 6.9** 2.0** 6.2** YOL156W 12.9** 9.7** 4.2** 6.8** (* p -value < 0.05; ** p -value < 0.01) We also had access to data collected using a new gene expression technology, the NanoStrings nCounter...”
  • “...FMP48 ATCTGATGTTCGGCGATTGCCTT TGCTGCAGGCTAACGTGTAGGTCTT YGR236C SPG1 ATATTATGTTAGGGCTGGTGGGCGC GCCTTAGTTGTGTCTACGCCGTTGA YJL219W HXT9 AAGTTGTGGCCTCAAGGAAGCAGTC TTGCCATTCCTCTTGATTTGACCCT YLR346C - TTGCAGAGTGGGTAGCATGTCCATG TCCTGGGCAGCCTTGAGTAAATCAT YOL156W HXT11 ATGCTGCTTTGCTGTGTTTGCCTC TAACGTAACAGCCGCCTGCCCA YNL072W RNH201 GGACCACCAGCGTCCTATCAGAAGA TCATCGGGATCCCTCTTCAAGGA YLR185W RPL37a CCTGTTCCTCCTGTGGTTATCCAGC AAGCAGAGCCGGTTTGGAAACC Authors' contributions MO conceptualized the method. MO and AM designed the experiments. MO conducted experiments and analyzed the data....”
• Systematic identification of balanced transposition polymorphisms in Saccharomyces cerevisiae
  Faddah, PLoS genetics 2009
  • “...initial genome assembly, S. paradoxus contig 539 contains homologs to the genes YOL157C (probe 25), YOL156W (probe 27) and YOL155C (probe 30), which span the proximal endpoint of the transposed segment and are arranged in the same order and orientation as in S288C ( Figure 8...”
• Analysis of mechanisms of T-2 toxin toxicity using yeast DNA microarrays
  Iwahashi, International journal of molecular sciences 2008
  • “...treatment in yeast. Systematic Normalized Common Description YJL089W 15.7 SIP4 interacts with SNF1 protein kinase YOL156W 15.7 HXT11 Hxt family protein with intrinsic hexose transport activity YJL219W 12.8 HXT9 Hxt family protein with intrinsic hexose transport activity YNL279W 12.4 PRM1 similarity to S. pombe coiled-coil protein...”
• More
• Novel Citronellyl-Based Photoprobes Designed to Identify ER Proteins Interacting with Dolichyl Phosphate in Yeast and Mammalian Cells.
  Rush, Current chemical biology 2015
  • “...P53134 12 Putative oligopeptide transporter YGL114W + + Q02785 11 ATP-dependent permease PDR12 + + P54862 11 Hexose transporter HXT11 + + P40885 11 Hexose transporter HXT9 + + P39003 11 High-affinity hexose transporter HXT6 + + P39004 11 High-affinity hexose transporter HXT6 + + P32466...”
• Optimizing pentose utilization in yeast: the need for novel tools and approaches
  Young, Biotechnology for biofuels 2010
  • “...TMB3201 - Saccharomyces cerevisiae HXT10 P43581 p4H7 [ 64 ] TMB3201 - Saccharomyces cerevisiae HXT11 P54862 p426MET25 [ 64 ] TMB3201 - Saccharomyces cerevisiae HXT13 P39924 p4H7 [ 64 ] TMB3201 - Saccharomyces cerevisiae HXT14 P42833 p4H7 [ 64 ] TMB3201 - Saccharomyces cerevisiae HXT15 P54854...”

YJL219W Hxt9p from Saccharomyces cerevisiae
P40885 Hexose transporter HXT9 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
64% identity, 97% coverage

• An inducible CRISPR interference library for genetic interrogation of Saccharomyces cerevisiae biology
  Momen-Roknabadi, Communications biology 2020
  • “...present in the second replicate, targeting all but five of the yeast ORFs (YBL023C, YIL171W, YJL219W, YOR324C, YPR019W; Fig. 1e and Supplementary Fig. 2 ). The two bacterial replicates are highly correlated (Fig. 1f , Pearson correlation R =0.75). The loss in the number of gRNAs...”
• Transcriptional Comparison Investigating the Influence of the Addition of Unsaturated Fatty Acids on Aroma Compounds During Alcoholic Fermentation
  Yan, Frontiers in microbiology 2019
  • “...Protein of unknown function 2.42 YCR102C Protein of unknown function 2.06 Early-stationary phase Sugar utilization YJL219W HXT9 Putative hexose transporter that is nearly identical to Hxt11p 3.47 YJL216C IMA5 Alpha-glucosidase 2.78 Unknown function YMR317W Putative protein of unknown function 2.58 YKL068W-A Putative protein of unknown function...”
  • “...mannoprotein 2.18 YLR084C RAX2 N-glycosylated protein 2.18 YDR033W MRH1 Membrane protein Related to Hsp30p 2.06 YJL219W HXT9 Putative hexose transporter that is nearly identical to Hxt11p 2.74 YBR092C PHO3 Constitutively expressed acid phosphatase similar to Pho5p 2.08 YGR131W FHN1 Functional Homolog of Nce102 2.01 YBR161W CSH1...”
• Improved Xylose Metabolism by a CYC8 Mutant of Saccharomyces cerevisiae
  Nijland, Applied and environmental microbiology 2017
  • “...YDR342C YHR092C YHR096C YHR094C YJL214W YDL245C YJR158W YEL069C YFL011W YJL219W YOL156W YLR081W YNL318C Sum of all HXTs Sum of all genes Gene HXT2 HXT36 HXT7...”
• Complete genome sequence and comparative genomics of the probiotic yeast Saccharomyces boulardii
  Khatri, Scientific reports 2017
  • “...Endosomal ferric enterobactin transporter YOL156W HXT11 Putative hexose transporter that is nearly identical to Hxt9p YJL219W HXT9 Putative hexose transporter that is nearly identical to Hxt11p YOL157C IMA2 Isomaltase YIL172C IMA3 Isomaltase YJL221C IMA4 Isomaltase YGR289C MAL11 High-affinity maltose transporter (alpha-glucoside transporter) YGR288W MAL13 MAL-activator protein...”
• Crucial role of 4-deoxy-L-erythro-5-hexoseulose uronate reductase for alginate utilization revealed by adaptive evolution in engineered Saccharomyces cerevisiae
  Matsuoka, Scientific reports 2017
  • “...( TEF1p-yopt_kdgK-CYC1t ) and yopt_eda ( TEF1p-yopt_eda-CYC1t ) were introduced into a putative pseudogene ( YJL219w ) site in the genomic DNA of both MK5315 (BY4742 ade2 0 trp1 63 ) and D452-2, creating MK5524 and MK5517. Extracts of the resultant cells (MK5524 and MK5517) produced...”
• Extensive Copy Number Variation in Fermentation-Related Genes Among Saccharomyces cerevisiae Wine Strains
  Steenwyk, G3 (Bethesda, Md.) 2017
  • “...the HXT gene family ( HXT6 / YDR343C , HXT7 / YDR342C , HXT9 / YJL219W , HXT11 / YOL156W , HXT13 / YEL069C , HXT15 / YDL245C , and HXT17 / YNR072W ), which is involved in sugar transport, that were among the 363 CN...”
• Different Toxicity Mechanisms for Citrinin and Ochratoxin A Revealed by Transcriptomic Analysis in Yeast
  Vanacloig-Pedros, Toxins 2016
  • “...zinc-finger transcription factor YMR038C CCS1 6.9 6.96 10 5 Copper chaperone for superoxide dismutase Sod1p YJL219W HXT9 6.9 1.67 10 7 Putative hexose transporter YER142C MAG1 6.8 5.46 10 7 3-methyl-adenine DNA glycosylase YBR046C ZTA1 6.7 1.13 10 5 NADPH-dependent quinone reductase YNL231C PDR16 6.6 7.41...”
• Phylogenetic and Transcripts Profiling of Glucose Sensing Related Genes in Candida glabrata
  Ng, Jundishapur journal of microbiology 2015
  • “...YDR343C DAA12184 570 62.7 HXT7 YDR342C DAA12183 570 62.7 HXT8 YJL214W DAA08597 569 63.5 HXT9 YJL219W DAA08593 567 62.9 HXT10 YFL011W DAA12428 546 60.7 HXT11 YOL156W DAA10630 567 62.7 HXT13 YEL069C DAA07586 564 62.7 HXT14 YNL318C CAA96250 540 61.0 HXT15 YDL245C DAA11622 567 62.9 HXT16 YJR158W...”
• More
• Novel Citronellyl-Based Photoprobes Designed to Identify ER Proteins Interacting with Dolichyl Phosphate in Yeast and Mammalian Cells.
  Rush, Current chemical biology 2015
  • “...+ Q02785 11 ATP-dependent permease PDR12 + + P54862 11 Hexose transporter HXT11 + + P40885 11 Hexose transporter HXT9 + + P39003 11 High-affinity hexose transporter HXT6 + + P39004 11 High-affinity hexose transporter HXT6 + + P32466 11 Low-affinity glucose transporter HXT3 + +...”
• Optimizing pentose utilization in yeast: the need for novel tools and approaches
  Young, Biotechnology for biofuels 2010
  • “...TMB3201 + Saccharomyces cerevisiae HXT8 P40886 p4H7 [ 64 ] TMB3201 - Saccharomyces cerevisiae HXT9 P40885 p4H7 [ 64 ] TMB3201 - Saccharomyces cerevisiae HXT10 P43581 p4H7 [ 64 ] TMB3201 - Saccharomyces cerevisiae HXT11 P54862 p426MET25 [ 64 ] TMB3201 - Saccharomyces cerevisiae HXT13 P39924...”
• Major facilitator superfamily
  Pao, Microbiology and molecular biology reviews : MMBR 1998
  • “...P23585 P32466 P32467 P38695 P39003 P39004 P40886 P43581 P40885 P39924 P42833 P47185 Z71687 P30605 X98622 P30606 S51081 P07921 P38156 P15685 P18631 X96876 Q10710...”

KLMA_50364 low-affinity glucose transporter from Kluyveromyces marxianus DMKU3-1042
67% identity, 95% coverage

• Genetic basis of the highly efficient yeast Kluyveromyces marxianus: complete genome sequence and transcriptome analyses
  Lertwattanasakul, Biotechnology for biofuels 2015
  • “...4 ]. The phylogenetic tree of sugar transporters revealed that KLMA_50360, KLMA_50361, KLMA_50362, KLMA_50363, and KLMA_50364 share high similarity with xylose transporters predicted in S. stipitis (Figure 4 ) [ 21 ]. Unlike S. stipitis , however, these genes were not induced specifically under the 30X...”

P18631 Low-affinity glucose transporter from Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
XP_453656 hypothetical protein from Kluyveromyces lactis NRRL Y-1140
67% identity, 94% coverage

• Major facilitator superfamily
  Pao, Microbiology and molecular biology reviews : MMBR 1998
  • “...P47185 Z71687 P30605 X98622 P30606 S51081 P07921 P38156 P15685 P18631 X96876 Q10710 P38142 S58778 U32274 P43562 Z72626 P40441 P47186 P10870 P39932 GB SP GB SP...”
• Genetic basis of the highly efficient yeast Kluyveromyces marxianus: complete genome sequence and transcriptome analyses
  Lertwattanasakul, Biotechnology for biofuels 2015
  • “...Ps_XUT3, XP_001387138; Ps_XUT4, XP_001386715; Ps_XUT5, XP_001385962; Ps_XUT6, XP_001386589; Ps_XUT7, XP_001387067; Ps_RGT2, XP_001386588; Ps_SLT1, XP_001383774; Kl_KHT1/RAG1, XP_453656; Kl_KHT2, GN107317; Kl_KHT3, XP_454897; Kl_FRT1, XP_454356; Kl_HGT1, XP_451484; Kl_HXT1, XP_455078; Kl_HXT14, XP_454897; Kl_HXT2, XP_453960; Kl_HXT3, XP_453088; Sc_HXT4/LGT1, NP_011960; Kl_STL1, XP_456249; Kl_RAG4, XP_455315; Kl_LAC12, XP_452193; Ca_HXT6, XP_719472. Genes for the initial...”
• Comparative genomics of the white-rot fungi, Phanerochaete carnosa and P. chrysosporium, to elucidate the genetic basis of the distinct wood types they colonize
  Suzuki, BMC genomics 2012
  • “...CaHgt4 (XP_723173), CaHgt11 (XP_719597), CiGxf1 (AJ937350), CiGxs1 (AJ875406), GzHyp1 (EAA74528), HpGcr1 (AAR88143), KlHgt1 (XP_451484), KlRag1 (XP_453656), KlRag4 (CAA75114), Lb_EDR07962 (EDR07962), NcHyp1 (XP_328858), NcHxt3 (CAD21508), NcNCU00801(EAA34565.1), NcNCU08114 (XP_963873.1), NcRco3 (CAE76420), Pp_115604 (EED81359), Ps_ABN65648.2 (ABN65648.2), PsSut1 (AAD00266), ScHxt1 (M82963), ScHxt7 (NP_010629), ScSnf3 (P10870), SpGht1 (Q9P3U6), Tm-CAZ81962.1 (CAZ81962.1), TrHxt1...”
• Catabolite repression of Aox in Pichia pastoris is dependent on hexose transporter PpHxt1 and pexophagy
  Zhang, Applied and environmental microbiology 2010
  • “...for ScHxt7, AAU43755 for ScGal2, P53387 for KlKht2, XP_453656 for KlRag1, XP_719598 for CaHgt7, XP_001387898 for PsSut1, CAI77652 for CiGxf1, EU476006 for...”
• Identification of hexose transporter-like sensor HXS1 and functional hexose transporter HXT1 in the methylotrophic yeast Hansenula polymorpha
  Stasyk, Eukaryotic cell 2008
  • “...HpGcr1, AAR88143; HpHxt1, EU476006; HpHxs1, EU476007; KlRag1, XP_453656; KlRag4, CAA75114; ScHxt1, M82963; ScSnf3, NP_010087; and ScRgt2, NP_010143. 740 STASYK...”

XP_447265 hypothetical protein from Candida glabrata CBS 138
67% identity, 96% coverage

• Phylogenetic and Transcripts Profiling of Glucose Sensing Related Genes in Candida glabrata
  Ng, Jundishapur journal of microbiology 2015
  • “...XP_444803 549 61.6 HXT2/10 CAGL0D02662 XP_445530 564 62.4 HXT2/10 CAGL0D02640 XP_445530 564 62.4 HXT2/10 CAGL0I00286 XP_447265 555 61.7 HXT14 CAGL0M04103 XP_449525 531 59.0 Table 2. Details of Glucose Sensing-Related Genes of Saccharomyces cerevisiae Target Gene Name Systematic Name Accession Number No. of Amino Acids Molecular Mass,...”

XP_445530 hypothetical protein from Candida glabrata CBS 138
64% identity, 96% coverage

• Phylogenetic and Transcripts Profiling of Glucose Sensing Related Genes in Candida glabrata
  Ng, Jundishapur journal of microbiology 2015
  • “...XP_444861 549 61.2 HXT6/7 CAGL0A02211 XP_444860 552 61.5 HXT6/7 CAGL0A00737 XP_444803 549 61.6 HXT2/10 CAGL0D02662 XP_445530 564 62.4 HXT2/10 CAGL0D02640 XP_445530 564 62.4 HXT2/10 CAGL0I00286 XP_447265 555 61.7 HXT14 CAGL0M04103 XP_449525 531 59.0 Table 2. Details of Glucose Sensing-Related Genes of Saccharomyces cerevisiae Target Gene Name...”

HXT3_YEAST / P32466 Low-affinity glucose transporter HXT3 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
NP_010632 hexose transporter HXT3 from Saccharomyces cerevisiae S288C
NP_010632, YDR345C Hxt3p from Saccharomyces cerevisiae
66% identity, 98% coverage

• function: Low-affinity glucose transporter
• Regulation of Hxt3 and Hxt7 turnover converges on the Vid30 complex and requires inactivation of the Ras/cAMP/PKA pathway in Saccharomyces cerevisiae.
  Snowdon, PloS one 2012
  • GeneRIF: turnover of both Hxt3 and Hxt7 is dependent on the essential E3 ubiquitin ligase, Rsp5, indicating that the role of the Vid30c might be indirect of Hxt ubiquitylation
• Advances in fungal sugar transporters: unlocking the potential of second-generation bioethanol production
  Pereira, Applied microbiology and biotechnology 2025
  • “...S. cerevisiae Reifenberger et al. ( 1995 ); Apel et al. ( 2016 ) HXT3 P32466 Glucose, fructose, and mannose S. cerevisiae Reifenberger et al. ( 1995 ); Apel et al. ( 2016 ) HXT4 P32467 Glucose, xylose, fructose and mannose S. cerevisiae Reifenberger et al....”
• Yeast α-arrestin Art2 is the key regulator of ubiquitylation-dependent endocytosis of plasma membrane vitamin B1 transporters
  Savocco, PLoS biology 2019
  • “...Q05998 THI7 0.14 P38631 FKS1 0.18 P04817 CAN1 0.19 Q01896 ENA2 0.24 P32791 FRE1 0.31 P32466 HXT3 0.35 P38085 TAT1 0.38 Q06689 INA1 0.41 P32465 HXT1 0.42 P39004 HXT7 0.44 P32467 HXT4 0.48 P38079 YRO2 0.55 P40088 FTR1 0.55 P05030 PMA1 0.58 Q12256 TPO4 0.58 P38993...”
  • “...1.1 P32791 FRE1 5.4 4.2 4.7 3.1 3.6 2.4 2.5 1.9 2.8 1.9 2.8 1.7 P32466 HXT3 3.0 1.5 2.1 8.4 1.3 0.7 1.7 0.8 3.6 1.2 1.5 0.7 P38085 TAT1 2.4 1.8 2.2 1.1 1.6 1.6 1.4 1.4 0.7 1.2 1.2 1.6 Q06689 INA1 1.2...”
• Knockout of the Hmt1p Arginine Methyltransferase in Saccharomyces cerevisiae Leads to the Dysregulation of Phosphate-associated Genes and Processes
  Chia, Molecular & cellular proteomics : MCP 2018
  • “...YJR029W* Lac1p Dbp10p Hxt3p P25369 P35688 P47100 P28496 Q12389 P32466 a Uniprot accession number of protein. bAverage (mean) ratio of both A and B replicates....”
• Novel Citronellyl-Based Photoprobes Designed to Identify ER Proteins Interacting with Dolichyl Phosphate in Yeast and Mammalian Cells.
  Rush, Current chemical biology 2015
  • “...11 High-affinity hexose transporter HXT6 + + P39004 11 High-affinity hexose transporter HXT6 + + P32466 11 Low-affinity glucose transporter HXT3 + + P32467 11 Low-affinity glucose transporter HXT4 + + Q03516 11 Uncharacterized protein RSN1 + P53154 10 Glycerol uptake protein 1 GUP1 + P40441...”
• Functional survey for heterologous sugar transport proteins, using Saccharomyces cerevisiae as a host
  Young, Applied and environmental microbiology 2011
  • “...15, 36 P39924 HXT13 15, 36 P39004 HXT7 15, 36 P32466 HXT4 a EcoRI ClaI XmaI ClaI BamHI-HF ClaI XmaI ClaI P13181 GAL2 S. cerevisiae 3, 38 Introns, Synthesized...”
• Rapid response of the yeast plasma membrane proteome to salt stress
  Szopinska, Molecular & cellular proteomics : MCP 2011
  • “...and MT P23291 P38250 P39004 P39003 P38695 P32467 P32466 P23585 P32465 P06775 P53154 P10823 P08539 P38631 Q08193 Q03655 P22146 P38196 P40088 Q12333 P32791 P23900...”
• Optimizing pentose utilization in yeast: the need for novel tools and approaches
  Young, Biotechnology for biofuels 2010
  • “...H2219 + Saccharomyces cerevisiae HXT1 P32465 p4H7 [ 64 ] TMB3201 - Saccharomyces cerevisiae HXT3 P32466 p4H7 [ 64 ] TMB3201 - Saccharomyces cerevisiae HXT4 P32467 p4H7 [ 64 ] TMB3201 + Saccharomyces cerevisiae HXT5 P38695 p4H7 [ 64 ] TMB3201 + Saccharomyces cerevisiae HXT7 P39004...”
• Major facilitator superfamily
  Pao, Microbiology and molecular biology reviews : MMBR 1998
  • “...818 569 S59368 P13181 L21753 P49374 P32465 P23585 P32466 P32467 P38695 P39003 P39004 P40886 P43581 P40885 P39924 P42833 P47185 Z71687 P30605 X98622 P30606...”
• Functional analysis of a Phytophthora host-translocated effector using the yeast model system
  Wilson, PeerJ 2021
  • “...genes following PsAvh110 expression. LFC * Gene name Protein description & function (SGD) 1.5 HXT3 (YDR345C) Low affinity glucose transporter of the major facilitator superfamily; expression is induced in low and high glucose conditions 1.3 FRM2 (YCL026C-A) Type II nitroreductase; possible role in lipid signaling, oxidative...”
  • “...* Term size Query size Intersecting genes GO:0005353 Fructose transmembrane transporter activity 2.43 15 4 YDR345C, YHR092C GO:0015578 Mannose transmembrane transporter activity 2.43 15 4 YDR345C, YHR092C TF:M00061_0 Factor: Mig1p; motif: KANWWWWATSYGGGGWA; match class: 0 2.83 74 6 YDR345C, YDR384C, YHR092C Notes: Gene set enrichment analysis...”
• Yeast Double Transporter Gene Deletion Library for Identification of Xenobiotic Carriers in Low or High Throughput
  Almeida, mBio 2021
  • “...YBR068C, YBR069C, YBR180W, YBR294W, YBR295W, YBR296C, YBR298C, YCL025C, YCR010C, YCR011C, YCR028C, YCR098C, YDL199C, YDR011W, YDR046C, YDR345C, YDR384C, YDR387C, YDR406W, YDR497C, YDR508C, YDR536W, YEL063C, YEL065W, YER056C, YER145C, YER166W, YFL011W, YFL040W, YFL050C, YFL055W, YGL077C, YGL114W, YGL255W, YGR055W, YGR121C, YGR138C, YGR217W, YGR224W, YGR260W, YGR281W, YGR289C, YHL016C, YHL040C, YHL047C, YHR092C,...”
• Transcriptional profiling reveals molecular basis and novel genetic targets for improved resistance to multiple fermentation inhibitors in Saccharomyces cerevisiae
  Chen, Biotechnology for biofuels 2016
  • “...YLR205C, YOL052C-A, YPL091W Transmembrane transport (GO:0055085) YAL053W, YBR008C, YBR054W , YCL025C, YCR021C , YDR011W, YDR135C, YDR345C , YER060W, YGL255W, YGR065C, YGR138C , YGR260W, YGR281W, YHL036W, YHR092C, YHR096C , YKL175W, YKR039W, YLL028W, YLR130C, YLR237W, YML116W, YOL119C, YOR153W, YOR306C, YOR328W, YPL036W, YPL058C, YPL274W YBR054W , YCL025C, YCR021C ,...”
  • “..., YHR094C, YHR096C , YPL036W YBL075C, YBR008C, YBR054W , YBR069C, YCR021C , YDR011W, YDR046C, YDR135C, YDR345C , YDR497C, YER103W, YFL054C, YGL255W, YGR138C , YGR281W, YHR092C, YHR096C , YJR095W, YKL175W, YLL028W, YLR237W, YLR259C, YML116W, YOR153W, YOR328W, YPL058C, YPL274W, YPR138C, YPR156C Ion transport (GO: 0006811) YAL053W, YBR054W, YCL025C,...”
• Analysis of COPII Vesicles Indicates a Role for the Emp47-Ssp120 Complex in Transport of Cell Surface Glycoproteins
  Margulis, Traffic (Copenhagen, Denmark) 2016
  • “...Plasma membrane ferro-oxidoreductase, involved in iron uptake YMR307W Gas1 1 5 Plasma membrane GPI-anchored -glucanosyltransferase YDR345C Hxt3 4 7 Plasma membrane glucose transporter YDR245W Mnn10 0 3 Subunit of a Golgi mannosyltransferase complex YOR153W Pdr5 0 10 Plasma membrane ATP-binding cassette (ABC) transporter YGL008C Pma1 21...”
• Phylogenetic and Transcripts Profiling of Glucose Sensing Related Genes in Candida glabrata
  Ng, Jundishapur journal of microbiology 2015
  • “...YGL035C CAA96736 504 55.6 HXT1 YHR094C DAA06789 570 63.3 HXT2 YMR011W DAA09909 541 59.8 HXT3 YDR345C DAA12185 567 62.6 HXT4 YHR092C DAA06788 576 63.9 HXT5 YHR096C DAA06790 592 66.3 HXT6 YDR343C DAA12184 570 62.7 HXT7 YDR342C DAA12183 570 62.7 HXT8 YJL214W DAA08597 569 63.5 HXT9 YJL219W...”
• Transcription analysis of recombinant industrial and laboratory Saccharomyces cerevisiae strains reveals the molecular basis for fermentation of glucose and xylose
  Matsushika, Microbial cell factories 2014
  • “...6.13 11.97 9.20 Xylulokinase Hexose transporters YMR011W HXT2 41.40 26.68 2.20 2.38 High-affinity glucose transporter YDR345C HXT8 7.17 16.25 4.10 5.35 Protein of unknown function with similarity to hexose transporter family members Other transporters YCR098C GIT1 13.32 8.90 2.53 2.28 Plasma membrane permease, mediates uptake of...”
  • “...2.32 4.56 Mitochondrial protein Hexose transporters YHR094C HXT1 -30.45 -21.51 -56.36 -46.31 Low-affinity glucose transporter YDR345C HXT3 -54.60 -20.87 -83.61 -32.66 Low-affinity glucose transporter YHR096C HXT5 22.20 48.69 22.78 44.86 Hexose transporter with moderate affinity for glucose Galactose metabolism YBR020W GAL1 19.10 32.47 3.71 5.48 Galactokinase...”
• Changes in cell morphology are coordinated with cell growth through the TORC1 pathway
  Goranov, Current biology : CB 2013
  • “..., S267, S288, S575 ; up S255 YPR185W Atg13 down down S454, S461, S652, S656 YDR345C Hxt3 down up S3 YJR001W Avt1 down NA YNL321W Vnx1 up up T26, S110, S121 YML035C Amd1 down down S105 YMR205C Pfk2 up up S41, S42, S170 YOL061W Prs5 up...”
• Identification of a novel deletion mutant strain in Saccharomyces cerevisiae that results in a microsatellite instability phenotype
  Ji, BioDiscovery 2012
  • “...10866.08 0.47 YBR301W uptag antisense 607.88 7201.59 0.52 YBR301W uptag sense 811.12 9768.15 0.52 DNF2 YDR345C downtag antisense 222.58 1070.08 0.52 YDR345C downtag sense 286.95 2700.63 0.52 YDR345C uptag antisense 243.56 2034.80 0.43 GYP8 YFL027C downtag sense 175.96 1300.91 0.52 YFL027C uptag antisense 780.84 5998.65 0.52...”
• More

NP_011964 hexose transporter HXT5 from Saccharomyces cerevisiae S288C
P38695 Probable glucose transporter HXT5 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
YHR096C Hexose transporter with moderate affinity for glucose, induced in the presence of non-fermentable carbon sources, induced by a decrease in growth rate, contains an extended N-terminal domain relative to other HXTs from Saccharomyces cerevisiae
68% identity, 88% coverage

• Differential regulation of glucose transport activity in yeast by specific cAMP signatures.
  Bermejo, The Biochemical journal 2013 (PubMed)
  • GeneRIF: During starvation, yeast cells anticipate exposure to glucose by activating the hexose glucose transporter (Hxt)5p, which provides an advantage during early phases after glucose resupply.
• Degradation of the hexose transporter Hxt5p in Saccharomyces cerevisiae.
  van, Biology of the cell 2007 (PubMed)
  • GeneRIF: These results suggest that internalization and degradation of Hxt5p in the vacuole occur in an ubiquitination-independent manner via the endocytic pathway.
• Advances in fungal sugar transporters: unlocking the potential of second-generation bioethanol production
  Pereira, Applied microbiology and biotechnology 2025
  • “...S. cerevisiae Reifenberger et al. ( 1995 ); Apel et al. ( 2016 ) HXT5 P38695 Glucose, xylose, fructose, and mannose S. cerevisiae Reifenberger et al. ( 1995 ); Apel et al. ( 2016 ) HXT6 P39003 Glucose, fructose, and mannose S. cerevisiae Reifenberger et al....”
• Rapid response of the yeast plasma membrane proteome to salt stress
  Szopinska, Molecular & cellular proteomics : MCP 2011
  • “...PM PM PM and MT P23291 P38250 P39004 P39003 P38695 P32467 P32466 P23585 P32465 P06775 P53154 P10823 P08539 P38631 Q08193 Q03655 P22146 P38196 P40088 Q12333...”
• Optimizing pentose utilization in yeast: the need for novel tools and approaches
  Young, Biotechnology for biofuels 2010
  • “...TMB3201 - Saccharomyces cerevisiae HXT4 P32467 p4H7 [ 64 ] TMB3201 + Saccharomyces cerevisiae HXT5 P38695 p4H7 [ 64 ] TMB3201 + Saccharomyces cerevisiae HXT7 P39004 YEpkHXT7 [ 64 ] TMB3201 + Saccharomyces cerevisiae HXT8 P40886 p4H7 [ 64 ] TMB3201 - Saccharomyces cerevisiae HXT9 P40885...”
• Major facilitator superfamily
  Pao, Microbiology and molecular biology reviews : MMBR 1998
  • “...S59368 P13181 L21753 P49374 P32465 P23585 P32466 P32467 P38695 P39003 P39004 P40886 P43581 P40885 P39924 P42833 P47185 Z71687 P30605 X98622 P30606 S51081 P07921...”
• DebaryOmics: an integrative -omics study to understand the halophilic behaviour of Debaryomyces hansenii
  Navarrete, Microbial biotechnology 2022
  • “...transport of mannose YHR094C DEHA2E04224g YES NO HXT5 Hexose transporter with moderate affinity for glucose YHR096C DEHA2D18876g YES YES RRS1 Regulator of ribosome biosynthesis YOR294W DEHA2F09834g NO NO BFR2 Involved in endoplasmic reticulum to Golgi transport YDR299W DEHA2A14212g NO NO HSP30 Negative regulator of the H+ATPase...”
• A Genome-Wide Screen in Saccharomyces cerevisiae Reveals a Critical Role for Oxidative Phosphorylation in Cellular Tolerance to Lithium Hexafluorophosphate
  Jin, Cells 2021
  • “...0.00035 0.5810 0.00003 0.5751 0.00002 cytoplasm YLR436C ECM30 0.2724 0.00002 0.4312 0.00000 0.4328 0.00002 cytoplasm YHR096C HXT5 0.2206 0.00004 0.2280 0.00002 0.2911 0.00003 - YBL021C HAP3 0.3353 0.00082 0.2217 0.00000 0.3064 0.00000 cytoplasm, nucleus YNL229C URE2 0.2639 0.00012 0.3145 0.00001 0.2208 0.00000 cytoplasm Protein Synthesis and...”
• Yeast Double Transporter Gene Deletion Library for Identification of Xenobiotic Carriers in Low or High Throughput
  Almeida, mBio 2021
  • “...YGL114W, YGL255W, YGR055W, YGR121C, YGR138C, YGR217W, YGR224W, YGR260W, YGR281W, YGR289C, YHL016C, YHL040C, YHL047C, YHR092C, YHR094C, YHR096C, YIL013C, YIL088C, YIL120W, YIL121W, YJL093C, YJL129C, YJL212C, YJL214W, YJR040W, YJR054W, YJR152W, YKL174C, YKL217W, YKR039W, YKR050W, YKR103W, YKR106W, YLL028W, YLL043W, YLL048C, YLL052C, YLL061W, YLR081W, YLR092W, YLR130C, YLR138W, YLR237W, YML047C, YML116W, YML123C,...”
  • “...( 54 ). In the Y7092 background, the same plasma membrane transporter-encoding genes (except YEL063C, YHR096C, and YOR202W) were replaced with the nat MX marker ( 49 ). In the library construction, strains containing deletions of genes not related to transport (YAL060W, YDR073W, and YIR002C) were...”
• Transcriptional Comparison Investigating the Influence of the Addition of Unsaturated Fatty Acids on Aroma Compounds During Alcoholic Fermentation
  Yan, Frontiers in microbiology 2019
  • “...name Description Fold change Mid-exponential phase Glucose transportation Hexose transporter with moderate affinity for glucose YHR096C HXT5 0.45 Zinc ion homeostasis YOL101C IZH4 Membrane protein involved in zinc ion homeostasis 0.28 Other process YBR067C TIP1 Major cell wall mannoprotein with possible lipase activity 0.47 YDL223C HBT1...”
• Improved Xylose Metabolism by a CYC8 Mutant of Saccharomyces cerevisiae
  Nijland, Applied and environmental microbiology 2017
  • “...CYC8(Y353C)a CYC8(Y353) Probe YMR011W YDR343C YDR342C YHR092C YHR096C YHR094C YJL214W YDL245C YJR158W YEL069C YFL011W YJL219W YOL156W YLR081W YNL318C Sum of all...”
• Extensive Copy Number Variation in Fermentation-Related Genes Among Saccharomyces cerevisiae Wine Strains
  Steenwyk, G3 (Bethesda, Md.) 2017
  • “..., HXT1 / YHR094C , HXT2 / YMR011W , HXT4 / YHR092C , HXT5 / YHR096C , HXT8 / YJL214W , HXT10 / YFL011W , HXT16 / YJR158W , RGT2 / YDL138W , and SNF3 / YDL194W ) of the HXT gene family ( Figure 3...”
• Transcriptional profiling reveals molecular basis and novel genetic targets for improved resistance to multiple fermentation inhibitors in Saccharomyces cerevisiae
  Chen, Biotechnology for biofuels 2016
  • “...YCR021C , YDR011W, YDR135C, YDR345C , YER060W, YGL255W, YGR065C, YGR138C , YGR260W, YGR281W, YHL036W, YHR092C, YHR096C , YKL175W, YKR039W, YLL028W, YLR130C, YLR237W, YML116W, YOL119C, YOR153W, YOR306C, YOR328W, YPL036W, YPL058C, YPL274W YBR054W , YCL025C, YCR021C , YDR345C , YER103W, YGR138C , YHR094C, YHR096C , YPL036W YBL075C, YBR008C,...”
  • “...YCR021C , YDR011W, YDR046C, YDR135C, YDR345C , YDR497C, YER103W, YFL054C, YGL255W, YGR138C , YGR281W, YHR092C, YHR096C , YJR095W, YKL175W, YLL028W, YLR237W, YLR259C, YML116W, YOR153W, YOR328W, YPL058C, YPL274W, YPR138C, YPR156C Ion transport (GO: 0006811) YAL053W, YBR054W, YCL025C, YCR021C , YDR135C, YGL255W, YGR065C, YGR138C, YGR142W, YGR260W, YHL036W, YKL165C,...”
• Phylogenetic and Transcripts Profiling of Glucose Sensing Related Genes in Candida glabrata
  Ng, Jundishapur journal of microbiology 2015
  • “...YMR011W DAA09909 541 59.8 HXT3 YDR345C DAA12185 567 62.6 HXT4 YHR092C DAA06788 576 63.9 HXT5 YHR096C DAA06790 592 66.3 HXT6 YDR343C DAA12184 570 62.7 HXT7 YDR342C DAA12183 570 62.7 HXT8 YJL214W DAA08597 569 63.5 HXT9 YJL219W DAA08593 567 62.9 HXT10 YFL011W DAA12428 546 60.7 HXT11 YOL156W...”
• More

HXT1 / P32465 low-affinity glucose/mannose transporter HXT1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (see 65 papers)
HXT1_YEAST / P32465 Low-affinity glucose transporter HXT1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
TC 2.A.1.1.108 / P32465 Low-affinity glucose transporter HXT1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (see 9 papers)
NP_011962 hexose transporter HXT1 from Saccharomyces cerevisiae S288C
NP_011962, YHR094C Hxt1p from Saccharomyces cerevisiae
65% identity, 96% coverage

• function: Low-affinity glucose transporter. HXT1 is as well involved in the transport of mannose
• substrates: glucose
• Advances in fungal sugar transporters: unlocking the potential of second-generation bioethanol production
  Pereira, Applied microbiology and biotechnology 2025
  • “...) MtCDT-2 G2Q6B1 Xylobiose and cellobiose M. thermophila Liu et al. ( 2024 ) HXT1 P32465 Glucose, xylose, fructose, and mannose S. cerevisiae Reifenberger et al. ( 1995 ); Apel et al. ( 2016 ) HXT2 P23585 Glucose, xylose, fructose, and mannose S. cerevisiae Reifenberger et...”
• Yeast α-arrestin Art2 is the key regulator of ubiquitylation-dependent endocytosis of plasma membrane vitamin B1 transporters
  Savocco, PLoS biology 2019
  • “...Q01896 ENA2 0.24 P32791 FRE1 0.31 P32466 HXT3 0.35 P38085 TAT1 0.38 Q06689 INA1 0.41 P32465 HXT1 0.42 P39004 HXT7 0.44 P32467 HXT4 0.48 P38079 YRO2 0.55 P40088 FTR1 0.55 P05030 PMA1 0.58 Q12256 TPO4 0.58 P38993 FET3 0.60 P49573 CTR1 0.63 P40474 QDR2 0.64 P22146...”
  • “...1.6 Q06689 INA1 1.2 0.9 1.6 0.8 0.8 0.4 0.8 0.4 0.5 0.7 0.1 0.3 P32465 HXT1 4.6 2.8 4.4 9.3 2.6 1.6 2.2 1.8 1.7 2.4 1.4 1.9 P39004 HXT7 0.6 0.4 0.3 1.1 0.6 0.2 0.9 0.6 0.1 0.7 0.1 0.4 P32467 HXT4 0.7...”
• Relationship between Metabolic Fluxes and Sequence-Derived Properties of Enzymes
  Zikmanis, International scholarly research notices 2014 (no snippet)
• Mutations in SLC2A2 gene reveal hGLUT2 function in pancreatic β cell development
  Michau, The Journal of biological chemistry 2013
  • “...GLUT2; Q102R8 for zebrafish (Danio rerio) GLUT2; P32465 for yeast (Saccharomyces cerevisiae) HXT1; and Q9FRL3 for plant (Arabidopsis thaliana) sugar transporter...”
• Rapid response of the yeast plasma membrane proteome to salt stress
  Szopinska, Molecular & cellular proteomics : MCP 2011
  • “...P23291 P38250 P39004 P39003 P38695 P32467 P32466 P23585 P32465 P06775 P53154 P10823 P08539 P38631 Q08193 Q03655 P22146 P38196 P40088 Q12333 P32791 P23900 Q07651...”
• Optimizing pentose utilization in yeast: the need for novel tools and approaches
  Young, Biotechnology for biofuels 2010
  • “...TMB3201 - Trichoderma reesei Xlt1 Q1EG32 pAJ401 [ 66 ] H2219 +* Saccharomyces cerevisiae HXT1 P32465 pYX212 [ 66 ] H2219 + Saccharomyces cerevisiae HXT2 P23585 pYX212 [ 66 ] H2219 + Saccharomyces cerevisiae HXT4 P32467 pYX212 [ 66 ] H2219 + Saccharomyces cerevisiae HXT7 P39004...”
• Major facilitator superfamily
  Pao, Microbiology and molecular biology reviews : MMBR 1998
  • “...486 457 602 818 569 S59368 P13181 L21753 P49374 P32465 P23585 P32466 P32467 P38695 P39003 P39004 P40886 P43581 P40885 P39924 P42833 P47185 Z71687 P30605 X98622...”
• Local Anesthetics and Antipsychotic Phenothiazines Interact Nonspecifically with Membranes and Inhibit Hexose Transporters in Yeast.
  Uesono, Genetics 2016
  • GeneRIF: Local anesthetics and antipsychotic phenothiazine inhibit uptake of glucose by interacting nonspecifically with hexose transporter HXT1
• Assessing glucose uptake through the yeast hexose transporter 1 (Hxt1).
  Roy, PloS one 2015
  • GeneRIF: Results show that Hxt1 transports 2-NBDG in a mechanism similar to human glucose transporters and, that some of the putative glucose-binding residues of Hxt1 are involved in endocytosis with N370 residue as critical for its stability and function.
• Psy2 targets the PP4 family phosphatase Pph3 to dephosphorylate Mth1 and repress glucose transporter gene expression.
  Ma, Molecular and cellular biology 2014
  • GeneRIF: Data show that Pph3-Psy2 targets the glucose signal transducer protein Mth1, which is required for the dephosphorylation of Rgt1 upon glucose withdrawal, a critical event in the repression of HXT genes, which encode glucose transporters.
• Expression of the glucose transporter HXT1 involves the Ser-Thr protein phosphatase Sit4 in Saccharomyces cerevisiae.
  Souza, FEMS yeast research 2012 (PubMed)
  • GeneRIF: Association of the HXT1 mRNA with polysomes is regulated by SIT4.
• Different signalling pathways mediate glucose induction of SUC2, HXT1 and pyruvate decarboxylase in yeast.
  Belinchón, FEMS yeast research 2007 (PubMed)
  • GeneRIF: Hxk2 is required for the high expression of HXT1.
• TOR kinase pathway and 14-3-3 proteins regulate glucose-induced expression of HXT1, a yeast low-affinity glucose transporter.
  Tomás-Cobos, Yeast (Chichester, England) 2005 (PubMed)
  • GeneRIF: TOR kinase pathway participates actively in the induction of HXT1 expression by glucose. Inhibition of the TOR kinase pathway by rapamycin treatment abolishes HXT1 glucose induction.
• Furfural tolerance of mutant Saccharomyces cerevisiae selected via ionizing radiation combined with adaptive laboratory evolution
  Ren, Biotechnology for biofuels and bioproducts 2024
  • “...RPA12 229.45 4.64 RNA polymerase I subunit A12.2 YNL112W DBP2 1399.74 4.67 ATP-dependent RNA helicase YHR094C HXT1 237.18 3.35 Low-affinity glucose transporter YKL166C TPK3 75.28 1.76 cAMP-dependent protein kinase catalytic subunit YGR087C PDC6 0.97 2.12 Minor isoform of pyruvate decarboxylase YKL029C MAE1 118.05 2.60 Mitochondrial malic...”
• DebaryOmics: an integrative -omics study to understand the halophilic behaviour of Debaryomyces hansenii
  Navarrete, Microbial biotechnology 2022
  • “...NO HXT1 Lowaffinity glucose transporter. HXT1 is as well involved in the transport of mannose YHR094C DEHA2E04224g YES NO HXT5 Hexose transporter with moderate affinity for glucose YHR096C DEHA2D18876g YES YES RRS1 Regulator of ribosome biosynthesis YOR294W DEHA2F09834g NO NO BFR2 Involved in endoplasmic reticulum to...”
• Yeast Double Transporter Gene Deletion Library for Identification of Xenobiotic Carriers in Low or High Throughput
  Almeida, mBio 2021
  • “...YGL077C, YGL114W, YGL255W, YGR055W, YGR121C, YGR138C, YGR217W, YGR224W, YGR260W, YGR281W, YGR289C, YHL016C, YHL040C, YHL047C, YHR092C, YHR094C, YHR096C, YIL013C, YIL088C, YIL120W, YIL121W, YJL093C, YJL129C, YJL212C, YJL214W, YJR040W, YJR054W, YJR152W, YKL174C, YKL217W, YKR039W, YKR050W, YKR103W, YKR106W, YLL028W, YLL043W, YLL048C, YLL052C, YLL061W, YLR081W, YLR092W, YLR130C, YLR138W, YLR237W, YML047C, YML116W,...”
• Identification of the Genetic Requirements for Zinc Tolerance and Toxicity in Saccharomyces cerevisiae
  Zhao, G3 (Bethesda, Md.) 2020
  • “...GOS1 YLR242C ARV1 YMR243C ZRC1 YDR186C SND1 YHR026W VMA16 YKL080W VMA5 YNL323W LEM3 YDR276C PMP3 YHR094C HXT1 YKL119C VPH2 YOR270C VPH1 YDR456W NHX1 YHR108W GGA2 YKR020W VPS51 YPL045W VPS16 Unclassified proteins (15) YCL007C YHR112C YKL044W MMO1 YNL204C SPS18 YDL041W YHR151C MTC6 YLR149C YPL261C YDR203W YJL211C YLR232W...”
• Improved Xylose Metabolism by a CYC8 Mutant of Saccharomyces cerevisiae
  Nijland, Applied and environmental microbiology 2017
  • “...CYC8(Y353) Probe YMR011W YDR343C YDR342C YHR092C YHR096C YHR094C YJL214W YDL245C YJR158W YEL069C YFL011W YJL219W YOL156W YLR081W YNL318C Sum of all HXTs...”
• Extensive Copy Number Variation in Fermentation-Related Genes Among Saccharomyces cerevisiae Wine Strains
  Steenwyk, G3 (Bethesda, Md.) 2017
  • “...the absolute CN of all other 10 members ( GAL2 / YLR081W , HXT1 / YHR094C , HXT2 / YMR011W , HXT4 / YHR092C , HXT5 / YHR096C , HXT8 / YJL214W , HXT10 / YFL011W , HXT16 / YJR158W , RGT2 / YDL138W , and...”
• Acetylated Deoxynivalenol Generates Differences of Gene Expression that Discriminate Trichothecene Toxicity
  Suzuki, Toxins 2016
  • “...plasma membrane Plasma membrane glucose sensor YDL194W SNF3 plasma membrane Plasma membrane low glucose sensor YHR094C HXT1 plasma membrane Low-affinity glucose transporter YMR011W HXT2 plasma membrane High-affinity glucose transporter YHR092C HXT4 plasma membrane High-affinity glucose transporter The gene expression of RGT1 , RGT2 , and SNF3...”
• Transcriptional profiling reveals molecular basis and novel genetic targets for improved resistance to multiple fermentation inhibitors in Saccharomyces cerevisiae
  Chen, Biotechnology for biofuels 2016
  • “...YOR306C, YOR328W, YPL036W, YPL058C, YPL274W YBR054W , YCL025C, YCR021C , YDR345C , YER103W, YGR138C , YHR094C, YHR096C , YPL036W YBL075C, YBR008C, YBR054W , YBR069C, YCR021C , YDR011W, YDR046C, YDR135C, YDR345C , YDR497C, YER103W, YFL054C, YGL255W, YGR138C , YGR281W, YHR092C, YHR096C , YJR095W, YKL175W, YLL028W, YLR237W, YLR259C,...”
• More

TDEL0A04250 uncharacterized protein from Torulaspora delbrueckii
63% identity, 93% coverage

• Evolution and functional diversification of yeast sugar transporters
  Donzella, Essays in biochemistry 2023
  • “...S. cerevisiae ) is also interesting as it also has a T. delbrueckii orthologue ( TDEL0A04250 ). The branching position, supported by good bootstraps, indicates that the ancestor of this gene even precedes the duplication of the original HXT that gave rise the KHT1 -like and...”

KLMA_50363 low-affinity glucose transporter from Kluyveromyces marxianus DMKU3-1042
66% identity, 95% coverage

• Genetic basis of the highly efficient yeast Kluyveromyces marxianus: complete genome sequence and transcriptome analyses
  Lertwattanasakul, Biotechnology for biofuels 2015
  • “...xylose [ 4 ]. The phylogenetic tree of sugar transporters revealed that KLMA_50360, KLMA_50361, KLMA_50362, KLMA_50363, and KLMA_50364 share high similarity with xylose transporters predicted in S. stipitis (Figure 4 ) [ 21 ]. Unlike S. stipitis , however, these genes were not induced specifically under...”

XP_444845 hypothetical protein from Candida glabrata CBS 138
68% identity, 90% coverage

• Characteristics of Extracellular Vesicles Released by the Pathogenic Yeast-Like Fungi Candida glabrata, Candida parapsilosis and Candida tropicalis
  Karkowska-Kuleta, Cells 2020
  • “...T S M gi|18073449 (CAC83344) GAS-1 homologue + + gi|20258069 (AAM16160) phospholipase B + gi|302309608 (XP_444845) CAGL0A01826g probable glucose transporter (Hxt5) + gi|50284733 (XP_444794) CAGL0A00495g plasma membrane ATPase 1 (Pma1) + + gi|50284865 (XP_444860) CAGL0A02211g high-affinity hexose transporter (Hxt7) + + gi|50284867 (XP_444861) CAGL0A02233g high-affinity hexose...”

TC 2.A.1.1.111 / P23585 High-affinity glucose transporter HXT2 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (see 6 papers)
NP_013724 hexose transporter HXT2 from Saccharomyces cerevisiae S288C
NP_013724, YMR011W High-affinity glucose transporter of the major facilitator superfamily, expression is induced by low levels of glucose and repressed by high levels of glucose from Saccharomyces cerevisiae
63% identity, 96% coverage

• substrates: glucose
  tcdb comment: Asp340 and Asn331 in part determine the high glucose affinity (Kasahara et al. 2007; Kasahara and Kasahara 2010)
• Advances in fungal sugar transporters: unlocking the potential of second-generation bioethanol production
  Pereira, Applied microbiology and biotechnology 2025
  • “...S. cerevisiae Reifenberger et al. ( 1995 ); Apel et al. ( 2016 ) HXT2 P23585 Glucose, xylose, fructose, and mannose S. cerevisiae Reifenberger et al. ( 1995 ); Apel et al. ( 2016 ) HXT3 P32466 Glucose, fructose, and mannose S. cerevisiae Reifenberger et al....”
• Adaptive mutations in sugar metabolism restore growth on glucose in a pyruvate decarboxylase negative yeast strain
  Zhang, Microbial cell factories 2015
  • “...protein sequence of each of the four S. cereviciae proteins Cit1 (UniProt# P00890), Hxt2 (UniProt# P23585), Rpd3 (UniProt# P32561) and Mth1 (UniProt# P35198) was separately used to query the NCBI database with the basic local alignment search tool (BLAST). To eliminate sequences with low identity to...”
• Rapid response of the yeast plasma membrane proteome to salt stress
  Szopinska, Molecular & cellular proteomics : MCP 2011
  • “...MT P23291 P38250 P39004 P39003 P38695 P32467 P32466 P23585 P32465 P06775 P53154 P10823 P08539 P38631 Q08193 Q03655 P22146 P38196 P40088 Q12333 P32791 P23900...”
• Optimizing pentose utilization in yeast: the need for novel tools and approaches
  Young, Biotechnology for biofuels 2010
  • “...H2219 +* Saccharomyces cerevisiae HXT1 P32465 pYX212 [ 66 ] H2219 + Saccharomyces cerevisiae HXT2 P23585 pYX212 [ 66 ] H2219 + Saccharomyces cerevisiae HXT4 P32467 pYX212 [ 66 ] H2219 + Saccharomyces cerevisiae HXT7 P39004 pYX212 [ 66 ] H2219 + Saccharomyces cerevisiae HXT1 P32465...”
• Major facilitator superfamily
  Pao, Microbiology and molecular biology reviews : MMBR 1998
  • “...602 818 569 S59368 P13181 L21753 P49374 P32465 P23585 P32466 P32467 P38695 P39003 P39004 P40886 P43581 P40885 P39924 P42833 P47185 Z71687 P30605 X98622 P30606...”
• Increased xylose affinity of Hxt2 through gene shuffling of hexose transporters in Saccharomyces cerevisiae.
  Nijland, Journal of applied microbiology 2018 (PubMed)
  • GeneRIF: The increased D-xylose affinity could be related to the C terminus, more specifically to a cysteine to proline mutation at position 505 in Hxt2.
• Low RNA Polymerase III activity results in up regulation of HXT2 glucose transporter independently of glucose signaling and despite changing environment.
  Adamczyk, PloS one 2017
  • GeneRIF: findings suggest that the general activity of RNAP III can indirectly affect the RNAP II transcriptional machinery on the HXT2 promoter when cellular perception transduced via the major signaling pathways, broadly recognized as on/off switch essential to either positive or negative HXT gene regulation, remain entirely intact
• Snf1p-dependent Spt-Ada-Gcn5-acetyltransferase (SAGA) recruitment and chromatin remodeling activities on the HXT2 and HXT4 promoters.
  van, The Journal of biological chemistry 2006 (PubMed)
  • GeneRIF: Snf1p-dependent Spt-Ada-Gcn5-acetyltransferase (SAGA) recruitment and chromatin remodeling activities on the HXT2 and HXT4 promoters.
• Eight amino acid residues in transmembrane segments of yeast glucose transporter Hxt2 are required for high affinity transport.
  Kasahara, The Journal of biological chemistry 2006 (PubMed)
  • GeneRIF: In addition to leucine 201 (TM5), four residues of Hxt2 (leucine 59 and leucine 61 in TM1, asparagine 331 in TM7, and phenylalanine 366 in TM8) were found to be important for high affinity transport
• The de novo design and synthesis of yeast chromosome XIII facilitates investigations on aging
  Zhou, Nature communications 2024
  • “...long-lived strains. In addition, an auxotrophic marker URA3, was integrated between two loxPsym sites tagging YMR011W and YMR012W on synXIII (270,117~270,525bp) to ensure a powerful positive selection for SCRaMbLEants from the library. To validate our approach, we developed a SCRaMbLE-mediated screening workflow to pinpoint strains with...”
  • “...and simultaneously a URA3 marker was integrated into the middle of two loxPsym sites between YMR011W and YMR012W on synXIII at position (270,117~270,525bp). The colony was cultured in the SCHis medium overnight and then diluted to an A 600 of 0.1 in the 5mL fresh SCHis...”
• Yeast Double Transporter Gene Deletion Library for Identification of Xenobiotic Carriers in Low or High Throughput
  Almeida, mBio 2021
  • “...YKR103W, YKR106W, YLL028W, YLL043W, YLL048C, YLL052C, YLL061W, YLR081W, YLR092W, YLR130C, YLR138W, YLR237W, YML047C, YML116W, YML123C, YMR011W, YMR177W, YMR243C, YMR279C, YMR319C, YNL065W, YNL142W, YNL268W, YNL270C, YNL275W, YNL291C, YNL318C, YNR002C, YNR055C, YNR056C, YNR072W, YOL020W, YOL103W, YOL122C, YOL158C, YOR011W, YOR071C, YOR153W, YOR192C, YOR202W, YOR273C, YOR306C, YOR328W, YOR348C, YPL036W, YPL058C,...”
• Improved Xylose Metabolism by a CYC8 Mutant of Saccharomyces cerevisiae
  Nijland, Applied and environmental microbiology 2017
  • “...strains carrying CYC8(Y353) and CYC8(Y353C)a CYC8(Y353) Probe YMR011W YDR343C YDR342C YHR092C YHR096C YHR094C YJL214W YDL245C YJR158W YEL069C YFL011W YJL219W...”
• Extensive Copy Number Variation in Fermentation-Related Genes Among Saccharomyces cerevisiae Wine Strains
  Steenwyk, G3 (Bethesda, Md.) 2017
  • “...all other 10 members ( GAL2 / YLR081W , HXT1 / YHR094C , HXT2 / YMR011W , HXT4 / YHR092C , HXT5 / YHR096C , HXT8 / YJL214W , HXT10 / YFL011W , HXT16 / YJR158W , RGT2 / YDL138W , and SNF3 / YDL194W )...”
• Acetylated Deoxynivalenol Generates Differences of Gene Expression that Discriminate Trichothecene Toxicity
  Suzuki, Toxins 2016
  • “...SNF3 plasma membrane Plasma membrane low glucose sensor YHR094C HXT1 plasma membrane Low-affinity glucose transporter YMR011W HXT2 plasma membrane High-affinity glucose transporter YHR092C HXT4 plasma membrane High-affinity glucose transporter The gene expression of RGT1 , RGT2 , and SNF3 , which encode a component of a...”
• Phylogenetic and Transcripts Profiling of Glucose Sensing Related Genes in Candida glabrata
  Ng, Jundishapur journal of microbiology 2015
  • “...YKL038W CAA81873 1170 128.2 MIG1 YGL035C CAA96736 504 55.6 HXT1 YHR094C DAA06789 570 63.3 HXT2 YMR011W DAA09909 541 59.8 HXT3 YDR345C DAA12185 567 62.6 HXT4 YHR092C DAA06788 576 63.9 HXT5 YHR096C DAA06790 592 66.3 HXT6 YDR343C DAA12184 570 62.7 HXT7 YDR342C DAA12183 570 62.7 HXT8 YJL214W...”
• Low toxicity of deoxynivalenol-3-glucoside in microbial cells
  Suzuki, Toxins 2015
  • “...cAMP signaling Glucose response YBL043W ECM13 3.39 Non-essential protein of unknown function UVA irradiation response YMR011W HXT2 5.66 High-affinity glucose transporter Induced by low levels of glucose Repressed by high levels of glucose 2.3. Real-Time Polymerase Chain Reaction Analysis DNA microarray produces false-positive data that correspond...”
• The Recent De Novo Origin of Protein C-Termini
  Andreatta, Genome biology and evolution 2015
  • “...par 353 3 6 Frameshift 2 None Strong Potassium ion transmembrane transporter activity; Pheromone-regulated protein YMR011W HXT2 S. par 542 6 15 Frameshift 2 Strong Strong High-affinity glucose transmembrane transporter activity YMR240C CUS1 S. par 437 28 41 Frameshift 2 Strong Strong Unknown function; required for...”
• More

XP_002490706 High-affinity glucose transporter of the major facilitator superfamily from Komagataella phaffii GS115
61% identity, 91% coverage

• Transcriptome of the alternative ethanol production strain Dekkera bruxellensis CBS 11270 in sugar limited, low oxygen cultivation
  Tiukova, PloS one 2013
  • “...pastoris homologs Gene function RPKM a AWRI1499_3136 HXT6 (4.010 146 ), HXT7 (4.010 146 ) XP_002490706 (3.010 156 ) Glucose transporter 3371.55 AWRI1499_3135 GAL2 (0), HXT6 (0), HXT7 (0) XP_002490706 (0) Hexose transporter 2234.21 AWRI1499_4734 HXT2 (6.010 38 ) XP_002489344 (1.010 62 ) Hexose transporter 268.06...”

TC 2.A.1.1.5 / P43581 Hexose uniporter from Saccharomyces cerevisiae (Baker's yeast) (see 2 papers)
HXT10 / RF|NP_116644.1 hexose transporter HXT10 from Saccharomyces cerevisiae
YFL011W Hxt10p from Saccharomyces cerevisiae
65% identity, 90% coverage

• substrates: Hexoses
• Yeast Double Transporter Gene Deletion Library for Identification of Xenobiotic Carriers in Low or High Throughput
  Almeida, mBio 2021
  • “...YDL199C, YDR011W, YDR046C, YDR345C, YDR384C, YDR387C, YDR406W, YDR497C, YDR508C, YDR536W, YEL063C, YEL065W, YER056C, YER145C, YER166W, YFL011W, YFL040W, YFL050C, YFL055W, YGL077C, YGL114W, YGL255W, YGR055W, YGR121C, YGR138C, YGR217W, YGR224W, YGR260W, YGR281W, YGR289C, YHL016C, YHL040C, YHL047C, YHR092C, YHR094C, YHR096C, YIL013C, YIL088C, YIL120W, YIL121W, YJL093C, YJL129C, YJL212C, YJL214W, YJR040W, YJR054W,...”
• Improved Xylose Metabolism by a CYC8 Mutant of Saccharomyces cerevisiae
  Nijland, Applied and environmental microbiology 2017
  • “...YDR343C YDR342C YHR092C YHR096C YHR094C YJL214W YDL245C YJR158W YEL069C YFL011W YJL219W YOL156W YLR081W YNL318C Sum of all HXTs Sum of all genes Gene HXT2 HXT36...”
• Extensive Copy Number Variation in Fermentation-Related Genes Among Saccharomyces cerevisiae Wine Strains
  Steenwyk, G3 (Bethesda, Md.) 2017
  • “..., HXT4 / YHR092C , HXT5 / YHR096C , HXT8 / YJL214W , HXT10 / YFL011W , HXT16 / YJR158W , RGT2 / YDL138W , and SNF3 / YDL194W ) of the HXT gene family ( Figure 3 ). Interestingly, all remaining 10 members of the...”
• Different Toxicity Mechanisms for Citrinin and Ochratoxin A Revealed by Transcriptomic Analysis in Yeast
  Vanacloig-Pedros, Toxins 2016
  • “...5.34 10 7 Meiosis-specific recombinase YOR298W MUM3 33.5 9.62 10 4 Protein of unknown function YFL011W HXT10 33.2 1.38 10 7 Putative hexose transporter YLL046C RNP1 27.3 1.08 10 7 Ribonucleoprotein YER104W RTT105 26.0 3.22 10 8 Protein with a role in regulation of Ty1 transposition...”
• Phylogenetic and Transcripts Profiling of Glucose Sensing Related Genes in Candida glabrata
  Ng, Jundishapur journal of microbiology 2015
  • “...YDR342C DAA12183 570 62.7 HXT8 YJL214W DAA08597 569 63.5 HXT9 YJL219W DAA08593 567 62.9 HXT10 YFL011W DAA12428 546 60.7 HXT11 YOL156W DAA10630 567 62.7 HXT13 YEL069C DAA07586 564 62.7 HXT14 YNL318C CAA96250 540 61.0 HXT15 YDL245C DAA11622 567 62.9 HXT16 YJR158W DAA08942 567 62.9 HXT17 YNR072W...”
• Mutation rates across budding yeast chromosome VI are correlated with replication timing
  Lang, Genome biology and evolution 2011
  • “...106463 GL44 YFR045W Hypothetical 242129 GL20 YFL012W Hypothetical 110641 GL45 b YFR049W YMR31 248510 GL21 YFL011W HXT10 112339 GL46 YFR053C HXK1 253579 GL22 YFL010C WWM1 115102 GL47 YFR054C Hypothetical 258842 GL23 YFL007W BLM3 123474 GL48 YFR055W Hypothetical 264191 GL24 YFL004W VTC2 131805 GL49 YFR057W Hypothetical 269048...”
• Transcriptomic profiling of the Saccharomyces cerevisiae response to quinine reveals a glucose limitation response attributable to drug-induced inhibition of glucose uptake
  dos, Antimicrobial agents and chemotherapy 2009
  • “...Membrane transport YCL025c YHR094c YMR011w YDR345c YHR092c YHR096c YJL214w YFL011w YKL217w YHL036w YML123c YCR037c YBR106w YBR296c YFL054c -- -- S R -- S -- S...”
• Positional analyses of BRCA1-dependent expression in Saccharomyces cerevisiae
  Skibbens, Cell cycle (Georgetown, Tex.) 2008
  • “...Up 2.9735975 Up YCL030C HIS4 2.7684693 Up 2.5967464 Up YIL116W HIS5 3.793316 Up 5.640973 Up YFL011W HXT10 2.7209184 Up 2.324241 Up YHR096C HXT5 3.2667696 Up 3.6192696 Up YJL219W HXT9 2.1079352 Up 2.2038836 Up YMR108W ILV2 3.0951784 Up 8.414132 Up YKL217W JEN1 2.4908004 Up 2.6344728 Up YGL009C...”
• More
• Optimizing pentose utilization in yeast: the need for novel tools and approaches
  Young, Biotechnology for biofuels 2010
  • “...TMB3201 - Saccharomyces cerevisiae HXT9 P40885 p4H7 [ 64 ] TMB3201 - Saccharomyces cerevisiae HXT10 P43581 p4H7 [ 64 ] TMB3201 - Saccharomyces cerevisiae HXT11 P54862 p426MET25 [ 64 ] TMB3201 - Saccharomyces cerevisiae HXT13 P39924 p4H7 [ 64 ] TMB3201 - Saccharomyces cerevisiae HXT14 P42833...”
• Major facilitator superfamily
  Pao, Microbiology and molecular biology reviews : MMBR 1998
  • “...P32465 P23585 P32466 P32467 P38695 P39003 P39004 P40886 P43581 P40885 P39924 P42833 P47185 Z71687 P30605 X98622 P30606 S51081 P07921 P38156 P15685 P18631 X96876...”
  • “...Th2A of Trypanosoma brucei P37021 P09830 P09098 P21906 P43581 P13181 P11636 P30605 P07921 P15685 S59368 Q07647 U11843 P15686 Q02563 X78855 Q06222 SP SP SP...”

KLMA_50362 hexose transporter from Kluyveromyces marxianus DMKU3-1042
72% identity, 75% coverage

• Genetic basis of the highly efficient yeast Kluyveromyces marxianus: complete genome sequence and transcriptome analyses
  Lertwattanasakul, Biotechnology for biofuels 2015
  • “...in xylose [ 4 ]. The phylogenetic tree of sugar transporters revealed that KLMA_50360, KLMA_50361, KLMA_50362, KLMA_50363, and KLMA_50364 share high similarity with xylose transporters predicted in S. stipitis (Figure 4 ) [ 21 ]. Unlike S. stipitis , however, these genes were not induced specifically...”

TC 2.A.1.1.110 / P39924 Hexose transporter HXT13 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (see 3 papers)
NP_010845 hexose transporter HXT13 from Saccharomyces cerevisiae S288C
YEL069C Hexose transporter, induced in the presence of non-fermentable carbon sources, induced by low levels of glucose, repressed by high levels of glucose from Saccharomyces cerevisiae
55% identity, 94% coverage

• substrates: Hexoses
• Hxt13, Hxt15, Hxt16 and Hxt17 from Saccharomyces cerevisiae represent a novel type of polyol transporters.
  Jordan, Scientific reports 2016
  • GeneRIF: Show that Hxt13, Hxt15, Hxt16 and Hxt17 transport two major hexitols in nature, mannitol and sorbitol, with moderate affinities, by a facilitative mechanism.
• Functional characterization of the hexose transporter Hxt13p: an efflux pump that mediates resistance to miltefosine in yeast.
  Biswas, Fungal genetics and biology : FG & B 2013 (PubMed)
  • GeneRIF: Authors identified a new function of the hexose sugar transporter gene HXT13 when overexpressed in Saccharomyces cerevisiae, namely, in efflux of miltefosine and in mediating miltefosine resistance.
• Advances in fungal sugar transporters: unlocking the potential of second-generation bioethanol production
  Pereira, Applied microbiology and biotechnology 2025
  • “...Glucose, xylose, galactose, fructose, and mannose S. cerevisiae Young et al. ( 2011 ) HXT13 P39924 Glucose and mannose S. cerevisiae Young et al. ( 2011 ) Gal2 P13181 Glucose, xylose, L-arabinose, galactose, fructose, mannose, and ribose S. cerevisiae Hamacher et al. ( 2002 ); Becker...”
• Functional survey for heterologous sugar transport proteins, using Saccharomyces cerevisiae as a host
  Young, Applied and environmental microbiology 2011
  • “...here, including the restriction enzymes and primers used. 15, 36 P39924 HXT13 15, 36 P39004 HXT7 15, 36 P32466 HXT4 a EcoRI ClaI XmaI ClaI BamHI-HF ClaI XmaI...”
• Optimizing pentose utilization in yeast: the need for novel tools and approaches
  Young, Biotechnology for biofuels 2010
  • “...TMB3201 - Saccharomyces cerevisiae HXT11 P54862 p426MET25 [ 64 ] TMB3201 - Saccharomyces cerevisiae HXT13 P39924 p4H7 [ 64 ] TMB3201 - Saccharomyces cerevisiae HXT14 P42833 p4H7 [ 64 ] TMB3201 - Saccharomyces cerevisiae HXT15 P54854 p4H7 [ 64 ] TMB3201 - Saccharomyces cerevisiae GAL2 P13181...”
• Major facilitator superfamily
  Pao, Microbiology and molecular biology reviews : MMBR 1998
  • “...P32466 P32467 P38695 P39003 P39004 P40886 P43581 P40885 P39924 P42833 P47185 Z71687 P30605 X98622 P30606 S51081 P07921 P38156 P15685 P18631 X96876 Q10710 P38142...”
• Engineering cofactor supply and NADH-dependent D-galacturonic acid reductases for redox-balanced production of L-galactonate in Saccharomyces cerevisiae
  Harth, Scientific reports 2020
  • “...of expression cassettes and strains The Saccharomyces cerevisiae endogenous open reading frames (ORFs) of HXT13 (YEL069C) and SOR2 (YDL246C) were PCR amplified using the primer pairs SiHP011-SiHP012 ( HXT13 ) and SiHP015-SiHP016 ( SOR2 ). The open reading frame encoding YlSdr 22 ; UniProtKBQ6CEE9) was amplified...”
• Improved Xylose Metabolism by a CYC8 Mutant of Saccharomyces cerevisiae
  Nijland, Applied and environmental microbiology 2017
  • “...YDR343C YDR342C YHR092C YHR096C YHR094C YJL214W YDL245C YJR158W YEL069C YFL011W YJL219W YOL156W YLR081W YNL318C Sum of all HXTs Sum of all genes Gene HXT2...”
• Systematic Identification of Determinants for Single-Strand Annealing-Mediated Deletion Formation in Saccharomyces cerevisiae
  Segura-Wang, G3 (Bethesda, Md.) 2017
  • “...the homozygous yeast deletion collection. The insertion of the construct into the HXT13 gene ( YEL069C ) in chromosome V was verified by PCRs placing primers inside and outside of both sides of the construct. This locus has been used to test for chromosomal rearrangements in...”
• Extensive Copy Number Variation in Fermentation-Related Genes Among Saccharomyces cerevisiae Wine Strains
  Steenwyk, G3 (Bethesda, Md.) 2017
  • “..., HXT7 / YDR342C , HXT9 / YJL219W , HXT11 / YOL156W , HXT13 / YEL069C , HXT15 / YDL245C , and HXT17 / YNR072W ), which is involved in sugar transport, that were among the 363 CN diverse genes (File S3 in File S1 )....”
• Structural Motifs Critical for In Vivo Function and Stability of the RecQ-Mediated Genome Instability Protein Rmi1
  Kennedy, PloS one 2015
  • “..., his3200 , lys2-Bgl , hom3-10 , ade21 , ade8 , sgs1 :: HIS3 , YEL069C :: URA3 ,). The fragment was inserted into Xba I-digested pRS415 by gap-repair cloning using the non-homologous-endjoining deficient yeast strain KHSY2331 ( ura3-52 , leu21 , trp163 , his3200 ,...”
• Phylogenetic and Transcripts Profiling of Glucose Sensing Related Genes in Candida glabrata
  Ng, Jundishapur journal of microbiology 2015
  • “...YJL219W DAA08593 567 62.9 HXT10 YFL011W DAA12428 546 60.7 HXT11 YOL156W DAA10630 567 62.7 HXT13 YEL069C DAA07586 564 62.7 HXT14 YNL318C CAA96250 540 61.0 HXT15 YDL245C DAA11622 567 62.9 HXT16 YJR158W DAA08942 567 62.9 HXT17 YNR072W DAA10613 564 62.8 3.2. Phylogenetic Analysis The multiple sequence alignment...”
• Comparative transcriptomic analysis reveals similarities and dissimilarities in Saccharomyces cerevisiae wine strains response to nitrogen availability
  Barbosa, PloS one 2015
  • “...bacterial homolog; RPL22A has a paralog, RPL22B, that arose from the whole genome duplication HXT13 YEL069C 4.0 Hexose transporter; induced in the presence of non-fermentable carbon sources, induced by low levels of glucose, repressed by high levels of glucose; HXT13 has a paralog, HXT17, that arose...”
• Variation in gene duplicates with low synonymous divergence in Saccharomyces cerevisiae relative to Caenorhabditis elegans
  Katju, Genome biology 2009
  • “...0.0066 Complete YAR068W YHR214W-A 0.0000 Complete 11 YNR073C YEL070W 0.0482 0.0817 Complete XIVI/V 4,611 YNR072C YEL069C 0.1152 Complete 12 YAR033W YGL051W 0.0280 0.0973 Complete I/VII 6,461 YAR031W YGL053W 0.1667 Complete Columns 2 and 3 list the systematic names of the group of loci representing each paralogous...”
• More

YNR072W Hexose transporter, up-regulated in media containing raffinose and galactose at pH 7.7 versus pH 4.7, repressed by high levels of glucose from Saccharomyces cerevisiae
NP_014470 hexose transporter HXT17 from Saccharomyces cerevisiae S288C
54% identity, 97% coverage

• Yeast Double Transporter Gene Deletion Library for Identification of Xenobiotic Carriers in Low or High Throughput
  Almeida, mBio 2021
  • “...YMR011W, YMR177W, YMR243C, YMR279C, YMR319C, YNL065W, YNL142W, YNL268W, YNL270C, YNL275W, YNL291C, YNL318C, YNR002C, YNR055C, YNR056C, YNR072W, YOL020W, YOL103W, YOL122C, YOL158C, YOR011W, YOR071C, YOR153W, YOR192C, YOR202W, YOR273C, YOR306C, YOR328W, YOR348C, YPL036W, YPL058C, YPL092W, YPL265W, YPL274W, YPR124W, YPR138C, YPR156C, YPR192W, YPR198W, and YPR201W ( 54 ). In the...”
• Improved Xylose Metabolism by a CYC8 Mutant of Saccharomyces cerevisiae
  Nijland, Applied and environmental microbiology 2017
  • “...right arm of chromosome XIV, including HXT17 (accession no. YNR072W). This is partially in contrast to the de novo genome sequencing of the progenitor strain...”
  • “...genes reported to be present in this study, designated YNR072W (HXT17), YNR073C (DSF1), and YNR076W (PAU6) all have homologs elsewhere in the genome with 97,...”
• Crucial role of 4-deoxy-L-erythro-5-hexoseulose uronate reductase for alginate utilization revealed by adaptive evolution in engineered Saccharomyces cerevisiae
  Matsuoka, Scientific reports 2017
  • “...YNR073C (Man2)] that oxidizes mannitol to D-fructose, and the putative MFS transporter [YEL069C (Hxt13) or YNR072W (Hxt17)]. These genes were identified using microarray analysis of the S. cerevisiae that had been induced to grow efficiently in mannitol medium 16 through an unknown mechanism. EnquistNewman et al...”
• Extensive Copy Number Variation in Fermentation-Related Genes Among Saccharomyces cerevisiae Wine Strains
  Steenwyk, G3 (Bethesda, Md.) 2017
  • “...HXT11 / YOL156W , HXT13 / YEL069C , HXT15 / YDL245C , and HXT17 / YNR072W ), which is involved in sugar transport, that were among the 363 CN diverse genes (File S3 in File S1 ). Members of the HXT gene family were duplicated, deleted,...”
• Phylogenetic and Transcripts Profiling of Glucose Sensing Related Genes in Candida glabrata
  Ng, Jundishapur journal of microbiology 2015
  • “...YNL318C CAA96250 540 61.0 HXT15 YDL245C DAA11622 567 62.9 HXT16 YJR158W DAA08942 567 62.9 HXT17 YNR072W DAA10613 564 62.8 3.2. Phylogenetic Analysis The multiple sequence alignment of selected amino acid sequences listed in Tables 1 and 2 was calculated and generated through Clustal Omega program (...”
• Multi-targeted priming for genome-wide gene expression assays
  Adomas, BMC genomics 2010
  • “...3.13 YGR249W 1.66 0.01 5.80 0.00 4.79 8.20 YMR025W 1.51 0.00 3.96 0.15 2.10 1.57 YNR072W -1.24 0.05 -6.32 0.00 -2.34 -1.36 YFR034C -1.42 0.02 -1.25 0.10 -9.08 0.00 -6.41 0.08 1.30 1.24 YKR053C -5.37 0.00 -1.88 0.14 -2.16 0.00 1.15 0.51 -2.10 -2.05 YLR126C 1.54...”
• Resurrecting ancestral alcohol dehydrogenases from yeast
  Thomson, Nature genetics 2005
  • “...HXT16 Sugar transporter repressed by high glucose levels YNR072W gi|1302608 HXT17 Sugar transporter repressed by high glucose levels f2 1/4 0.806b Pair not...”
  • “...induced by low glucose, repressed by high glucose YNR072W gi|1302608 f2 1/4 0.809b HXT17 Sugar transporter repressed by high glucose levels Sugar transporter...”
• Improvement of galactose uptake in Saccharomyces cerevisiae through overexpression of phosphoglucomutase: example of transcript analysis as a tool in inverse metabolic engineering
  Bro, Applied and environmental microbiology 2005
  • “...YKL031W YLR286C YNL239W YGR022C YEL069C YDL245C YJR158W YNR072W YBR299W YGR292W YOL126C YFL011W YMR305C YKL216W YDR520C YGL035C YPL187W YMR199W YJR159W YDL246C...”
• More
• Hxt13, Hxt15, Hxt16 and Hxt17 from Saccharomyces cerevisiae represent a novel type of polyol transporters.
  Jordan, Scientific reports 2016
  • GeneRIF: Show that Hxt13, Hxt15, Hxt16 and Hxt17 transport two major hexitols in nature, mannitol and sorbitol, with moderate affinities, by a facilitative mechanism.

TC 2.A.1.1.107 / P54854 Hexose transporter HXT15 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (see 3 papers)
NP_010036 hexose transporter HXT15 from Saccharomyces cerevisiae S288C
YDL245C Hxt15p from Saccharomyces cerevisiae
55% identity, 94% coverage

• substrates: Hexoses
• Optimizing pentose utilization in yeast: the need for novel tools and approaches
  Young, Biotechnology for biofuels 2010
  • “...TMB3201 - Saccharomyces cerevisiae HXT14 P42833 p4H7 [ 64 ] TMB3201 - Saccharomyces cerevisiae HXT15 P54854 p4H7 [ 64 ] TMB3201 - Saccharomyces cerevisiae GAL2 P13181 pHL125 [ 64 ] TMB3201 + Several previous studies have evaluated the capacity of selected transport proteins to uptake xylose...”
• Hxt13, Hxt15, Hxt16 and Hxt17 from Saccharomyces cerevisiae represent a novel type of polyol transporters.
  Jordan, Scientific reports 2016
  • GeneRIF: Show that Hxt13, Hxt15, Hxt16 and Hxt17 transport two major hexitols in nature, mannitol and sorbitol, with moderate affinities, by a facilitative mechanism.
• Improved Xylose Metabolism by a CYC8 Mutant of Saccharomyces cerevisiae
  Nijland, Applied and environmental microbiology 2017
  • “...Probe YMR011W YDR343C YDR342C YHR092C YHR096C YHR094C YJL214W YDL245C YJR158W YEL069C YFL011W YJL219W YOL156W YLR081W YNL318C Sum of all HXTs Sum of all genes...”
• Extensive Copy Number Variation in Fermentation-Related Genes Among Saccharomyces cerevisiae Wine Strains
  Steenwyk, G3 (Bethesda, Md.) 2017
  • “..., HXT9 / YJL219W , HXT11 / YOL156W , HXT13 / YEL069C , HXT15 / YDL245C , and HXT17 / YNR072W ), which is involved in sugar transport, that were among the 363 CN diverse genes (File S3 in File S1 ). Members of the HXT...”
• Phylogenetic and Transcripts Profiling of Glucose Sensing Related Genes in Candida glabrata
  Ng, Jundishapur journal of microbiology 2015
  • “...YOL156W DAA10630 567 62.7 HXT13 YEL069C DAA07586 564 62.7 HXT14 YNL318C CAA96250 540 61.0 HXT15 YDL245C DAA11622 567 62.9 HXT16 YJR158W DAA08942 567 62.9 HXT17 YNR072W DAA10613 564 62.8 3.2. Phylogenetic Analysis The multiple sequence alignment of selected amino acid sequences listed in Tables 1 and...”
• Transcriptome analysis of a respiratory Saccharomyces cerevisiae strain suggests the expression of its phenotype is glucose insensitive and predominantly controlled by Hap4, Cat8 and Mig1
  Bonander, BMC genomics 2008
  • “...6.8 c Glyoxylate cycle YCR005C CIT2 2.2 b Plasma membrane transport YEL069C HXT13 3.9 b,c YDL245C HXT15 3.2 c YBR298C MAL31 3.1 b Mitochondrial transport YNR002C ATO2 3.8 b YKL217W JEN1 10.3 b YPL134C ODC1 6.3 b Transcriptional regulation YDR516C EMI2 3.6 b,c YEL066W HPA3 2.2...”
• Resurrecting ancestral alcohol dehydrogenases from yeast
  Thomson, Nature genetics 2005
  • “...0.806b Pair not associated with any duplication block YDL245C gi|1431418 HXT15 Sugar transporter induced by low glucose, repressed by high glucose YNR072W...”
  • “...induced by low glucose, repressed by high glucose YDL245C gi|1431418 HXT15 Sugar transporter Cytoplasmic chaperone induced 2-3 fold by heat shock Subfamily...”
• Improvement of galactose uptake in Saccharomyces cerevisiae through overexpression of phosphoglucomutase: example of transcript analysis as a tool in inverse metabolic engineering
  Bro, Applied and environmental microbiology 2005
  • “...YGL130W YOL143C YKL031W YLR286C YNL239W YGR022C YEL069C YDL245C YJR158W YNR072W YBR299W YGR292W YOL126C YFL011W YMR305C YKL216W YDR520C YGL035C YPL187W YMR199W...”

P47185 Hexose transporter HXT16 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
NP_012692 hexose transporter HXT16 from Saccharomyces cerevisiae S288C
YJR158W Hxt16p from Saccharomyces cerevisiae
55% identity, 94% coverage

• Major facilitator superfamily
  Pao, Microbiology and molecular biology reviews : MMBR 1998
  • “...P38695 P39003 P39004 P40886 P43581 P40885 P39924 P42833 P47185 Z71687 P30605 X98622 P30606 S51081 P07921 P38156 P15685 P18631 X96876 Q10710 P38142 S58778 U32274...”
• Hxt13, Hxt15, Hxt16 and Hxt17 from Saccharomyces cerevisiae represent a novel type of polyol transporters.
  Jordan, Scientific reports 2016
  • GeneRIF: Show that Hxt13, Hxt15, Hxt16 and Hxt17 transport two major hexitols in nature, mannitol and sorbitol, with moderate affinities, by a facilitative mechanism.
• Improved Xylose Metabolism by a CYC8 Mutant of Saccharomyces cerevisiae
  Nijland, Applied and environmental microbiology 2017
  • “...YMR011W YDR343C YDR342C YHR092C YHR096C YHR094C YJL214W YDL245C YJR158W YEL069C YFL011W YJL219W YOL156W YLR081W YNL318C Sum of all HXTs Sum of all genes Gene...”
• Extensive Copy Number Variation in Fermentation-Related Genes Among Saccharomyces cerevisiae Wine Strains
  Steenwyk, G3 (Bethesda, Md.) 2017
  • “..., HXT5 / YHR096C , HXT8 / YJL214W , HXT10 / YFL011W , HXT16 / YJR158W , RGT2 / YDL138W , and SNF3 / YDL194W ) of the HXT gene family ( Figure 3 ). Interestingly, all remaining 10 members of the HXT gene family were...”
• Overexpression of a Water-Forming NADH Oxidase Improves the Metabolism and Stress Tolerance of Saccharomyces cerevisiae in Aerobic Fermentation
  Shi, Frontiers in microbiology 2016
  • “...sequences YFL039C ACT1 (reference gene) F: TGGATTCCGGTGATGGTGTT R: TGGCGTGAGGTAGAGAGAAACC L196579 noxE F: TCAAAAATGGCGCAATCAAG R: CCGCGTAAACATCTGGATCA YJR158W Hxt16 F: TTTGAGCAACGTGCGTATGG R: CGCCAATGGAACATCCTACA YDR343C HXT6 F: CGCTGCTATTGCAGAGCAAAC R: CGAGTGGGAGGCTGAGTCA YGR144W THI4 F: TTTGCCGTTTCTGACGTGATT R: GCGGCGGATAAACCTGAA YFL058W THI5 F: GGTTACTTCAAGGAGCAAGGTCTAGA R: CAGTGACATCGGAAGGATTGG YJR156C THI11 F: CAAGAAGGCAACCGACTACGT R: GAGGCTTGAAGTCGATGTATTCTTT YNL332W...”
• Phylogenetic and Transcripts Profiling of Glucose Sensing Related Genes in Candida glabrata
  Ng, Jundishapur journal of microbiology 2015
  • “...YEL069C DAA07586 564 62.7 HXT14 YNL318C CAA96250 540 61.0 HXT15 YDL245C DAA11622 567 62.9 HXT16 YJR158W DAA08942 567 62.9 HXT17 YNR072W DAA10613 564 62.8 3.2. Phylogenetic Analysis The multiple sequence alignment of selected amino acid sequences listed in Tables 1 and 2 was calculated and generated...”
• The reacquisition of biotin prototrophy in Saccharomyces cerevisiae involved horizontal gene transfer, gene duplication and gene clustering
  Hall, Genetics 2007
  • “...uptake? YBR018C (GAL7) YBR297W (MAL33) YGR288W (MAL13) YJR158W (HXT16) YBR019C (GAL10) YBR298C (MAL31) YGR289C (MAL11) YJR159W (SOR1) Biotin synthesis Biotin...”
• Resurrecting ancestral alcohol dehydrogenases from yeast
  Thomson, Nature genetics 2005
  • “...0.805b Pair not associated with any duplication block YJR158W gi|1015917 HXT16 Sugar transporter repressed by high glucose levels YNR072W gi|1302608 HXT17 Sugar...”
  • “...levels Pair not associated with any duplication block YJR158W gi|1015917 HXT16 YEL069C gi|603249 HXT13 Sugar transporter induced by low glucose, repressed by...”
• Improvement of galactose uptake in Saccharomyces cerevisiae through overexpression of phosphoglucomutase: example of transcript analysis as a tool in inverse metabolic engineering
  Bro, Applied and environmental microbiology 2005
  • “...YOL143C YKL031W YLR286C YNL239W YGR022C YEL069C YDL245C YJR158W YNR072W YBR299W YGR292W YOL126C YFL011W YMR305C YKL216W YDR520C YGL035C YPL187W YMR199W YJR159W...”
• Molecular basis for anaerobic growth of Saccharomyces cerevisiae on xylose, investigated by global gene expression and metabolic flux analysis
  Sonderegger, Applied and environmental microbiology 2004
  • “...2.6 2.1 26 2.5 YBL015W YGL256W YJR078W YLR438W YAL062W YDR232W YJR158W YOL033W YNL073W YHR042W YGR087C YMR105C YOR321W 2.2 4.3 2.7 3.1 2.2 2.1 4.6 2.1 3.7 2.9 3...”
• More

HGT7 potential hexose transporter from Candida albicans (see 2 papers)
56% identity, 92% coverage

• CharProtDB CGD description: Putative glucose transporter, major facilitator superfamily; glucose-, fluconazole-, Snf3p-induced, expressed at high glucose; upregulated in biofilm; C. albicans glucose transporter family comprises 20 members; 12 TM regions predicted

XP_719472 Hgt7p from Candida albicans SC5314
56% identity, 92% coverage

• Genetic basis of the highly efficient yeast Kluyveromyces marxianus: complete genome sequence and transcriptome analyses
  Lertwattanasakul, Biotechnology for biofuels 2015
  • “...Kl_HXT14, XP_454897; Kl_HXT2, XP_453960; Kl_HXT3, XP_453088; Sc_HXT4/LGT1, NP_011960; Kl_STL1, XP_456249; Kl_RAG4, XP_455315; Kl_LAC12, XP_452193; Ca_HXT6, XP_719472. Genes for the initial catabolism of xylose, PPP, the conversion of PEP to ethanol, the mitochondrial conversion of acetaldehyde to acetyl-CoA and TCA cycle were relatively upregulated (Figure 2 A,B)....”

TC 2.A.1.1.67 / Q2MDH1 Glucose/xylose facilitator-1, GXF1 (functions by sugar uniport; low affinity from Candida intermedia (see paper)
gxf1 / CAI77652.1 glucose/xylose facilitator 1 from [Candida] intermedia (see paper)
58% identity, 91% coverage

• substrates: Xylose, glucose
• Advances in fungal sugar transporters: unlocking the potential of second-generation bioethanol production.
  Pereira, Applied microbiology and biotechnology 2025
  • “...2002 ); Becker and Boles ( 2003 ); Young et al. ( 2011 ) GXF1 Q2MDH1 Glucose, xylose, galactose, fructose, and mannose C. intermedia Leandro et al. ( 2006 ); Young et al. ( 2011 ) GXS1 Q2MEV7 Glucose, xylose, galactose, fructose, mannose, and ribose C....”
• Optimizing pentose utilization in yeast: the need for novel tools and approaches.
  Young, Biotechnology for biofuels 2010
  • “...Seedling cDNA [ 104 ] - pFL61 [ 64 ] TMB3201 - Candida intermedia Gxf1 Q2MDH1 YEplac195 [ 72 ] TMB3201 + Candida intermedia Gxs1 Q2MEV7 YEplac195 [ 72 ] TMB3201 + Chlorella kessleri Hup1 P15686 p4H7 [ 64 ] TMB3201 - Escherichia coli XylE P0AGF4...”

HGT6 potential hexose transporter from Candida albicans (see 2 papers)
54% identity, 93% coverage

• CharProtDB CGD description: Putative glucose transporter of major facilitator superfamily; 20 members of C. albicans glucose transporter family; 12 probable membrane-spanning segments; core stress response, fluconazole-induced; expressed in rich medium with 2% glucose

P40441 Putative hexose transporter 12 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
68% identity, 79% coverage

• Novel Citronellyl-Based Photoprobes Designed to Identify ER Proteins Interacting with Dolichyl Phosphate in Yeast and Mammalian Cells.
  Rush, Current chemical biology 2015
  • “...+ Q03516 11 Uncharacterized protein RSN1 + P53154 10 Glycerol uptake protein 1 GUP1 + P40441 10 Putative hexose transporter 12 HXT12 + + P32804 8 Zinc-regulated transporter 1 ZRT1 + + P25619 7 30 kDa heat shock protein HSP30 + + P38079 7 Protein YRO2...”
• Major facilitator superfamily
  Pao, Microbiology and molecular biology reviews : MMBR 1998
  • “...P07921 P38156 P15685 P18631 X96876 Q10710 P38142 S58778 U32274 P43562 Z72626 P40441 P47186 P10870 P39932 GB SP GB SP SP SP SP SP SP SP SP SP SP SP SP SP SP...”

CPAR2_212860 uncharacterized protein from Candida parapsilosis
55% identity, 93% coverage

• Eukaryotic transporters for hydroxyderivatives of benzoic acid
  Cillingová, Scientific reports 2017
  • “...level of expression in the control cells grown in synthetic medium containing glucose (SD) was CPAR2_212860 encoding an MFS protein with predicted sugar transporter domain (PF00083/Sugar_tr). Its ortholog in C. albicans is HGT7 (C2_01000W) and codes for a glucose transporter 40 , 41 . We assumed...”

O94151 Sugar transporter 2 protein from Scheffersomyces stipitis
XP_001384295 sugar transporter from Scheffersomyces stipitis CBS 6054
55% identity, 89% coverage

• Optimizing pentose utilization in yeast: the need for novel tools and approaches.
  Young, Biotechnology for biofuels 2010
  • “...TMB3201 - Pichia stipitis SUT1 O94155 YEp24 [ 105 ] RE700 - Pichia stipitis SUT2 O94151 YEp24 [ 105 ] RE700 - Pichia stipitis SUT3 Q9UWF5 YEp24 [ 105 ] RE700 - Pichia stipitis Genomic library [ 105 ] - YEp24 [ 64 ] TMB3201 -...”
• Genetic basis of the highly efficient yeast Kluyveromyces marxianus: complete genome sequence and transcriptome analyses
  Lertwattanasakul, Biotechnology for biofuels 2015
  • “...Ps_HGT2, XP_001382755; Sc_HXT7, NP_010629; Sc_GAL2, NP_013182; Dh_xylhp, AY347871; Ci_GXS1, GN107181; Ci_GXF1, GN107179; Ps_SUT1, XP_001387898; Ps_SUT2, XP_001384295; Ps_SUT3, XP_001386019; Ps_HXT2.4, XP_001387757; Ps_XUT1, XP_001385583; Ps_XUT2, XP_001387242; Ps_XUT3, XP_001387138; Ps_XUT4, XP_001386715; Ps_XUT5, XP_001385962; Ps_XUT6, XP_001386589; Ps_XUT7, XP_001387067; Ps_RGT2, XP_001386588; Ps_SLT1, XP_001383774; Kl_KHT1/RAG1, XP_453656; Kl_KHT2, GN107317; Kl_KHT3, XP_454897; Kl_FRT1, XP_454356;...”

Q9UWF5 Sugar transporter 3 from Scheffersomyces stipitis
XP_001386019 Sugar UpTake (tentative) from Scheffersomyces stipitis CBS 6054
55% identity, 89% coverage

• Optimizing pentose utilization in yeast: the need for novel tools and approaches.
  Young, Biotechnology for biofuels 2010
  • “...RE700 - Pichia stipitis SUT2 O94151 YEp24 [ 105 ] RE700 - Pichia stipitis SUT3 Q9UWF5 YEp24 [ 105 ] RE700 - Pichia stipitis Genomic library [ 105 ] - YEp24 [ 64 ] TMB3201 - Trichoderma reesei Xlt1 Q1EG32 pAJ401 [ 66 ] H2219 +*...”
• Genetic basis of the highly efficient yeast Kluyveromyces marxianus: complete genome sequence and transcriptome analyses
  Lertwattanasakul, Biotechnology for biofuels 2015
  • “...Sc_HXT7, NP_010629; Sc_GAL2, NP_013182; Dh_xylhp, AY347871; Ci_GXS1, GN107181; Ci_GXF1, GN107179; Ps_SUT1, XP_001387898; Ps_SUT2, XP_001384295; Ps_SUT3, XP_001386019; Ps_HXT2.4, XP_001387757; Ps_XUT1, XP_001385583; Ps_XUT2, XP_001387242; Ps_XUT3, XP_001387138; Ps_XUT4, XP_001386715; Ps_XUT5, XP_001385962; Ps_XUT6, XP_001386589; Ps_XUT7, XP_001387067; Ps_RGT2, XP_001386588; Ps_SLT1, XP_001383774; Kl_KHT1/RAG1, XP_453656; Kl_KHT2, GN107317; Kl_KHT3, XP_454897; Kl_FRT1, XP_454356; Kl_HGT1, XP_451484;...”

XP_001387898 hexose transporter from Scheffersomyces stipitis CBS 6054
O94155 Sugar transporter 1 from Scheffersomyces stipitis
52% identity, 96% coverage

• Genetic basis of the highly efficient yeast Kluyveromyces marxianus: complete genome sequence and transcriptome analyses
  Lertwattanasakul, Biotechnology for biofuels 2015
  • “...as follows: Ps_HGT2, XP_001382755; Sc_HXT7, NP_010629; Sc_GAL2, NP_013182; Dh_xylhp, AY347871; Ci_GXS1, GN107181; Ci_GXF1, GN107179; Ps_SUT1, XP_001387898; Ps_SUT2, XP_001384295; Ps_SUT3, XP_001386019; Ps_HXT2.4, XP_001387757; Ps_XUT1, XP_001385583; Ps_XUT2, XP_001387242; Ps_XUT3, XP_001387138; Ps_XUT4, XP_001386715; Ps_XUT5, XP_001385962; Ps_XUT6, XP_001386589; Ps_XUT7, XP_001387067; Ps_RGT2, XP_001386588; Ps_SLT1, XP_001383774; Kl_KHT1/RAG1, XP_453656; Kl_KHT2, GN107317; Kl_KHT3, XP_454897;...”
• Optimizing pentose utilization in yeast: the need for novel tools and approaches.
  Young, Biotechnology for biofuels 2010
  • “...TMB3201 - Escherichia coli XylE P0AGF4 p4H7 [ 64 ] TMB3201 - Pichia stipitis SUT1 O94155 YEp24 [ 105 ] RE700 - Pichia stipitis SUT2 O94151 YEp24 [ 105 ] RE700 - Pichia stipitis SUT3 Q9UWF5 YEp24 [ 105 ] RE700 - Pichia stipitis Genomic library...”

B5RTM9 DEHA2D18876p from Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
54% identity, 93% coverage

• DebaryOmics: an integrative -omics study to understand the halophilic behaviour of Debaryomyces hansenii
  Navarrete, Microbial biotechnology 2022
  • “...most significant changes identified in our protein list (FDR<0.05), we find the HXT5 hexose transporter (B5RTM9), a haloperoxidase (Q6BYM5) and a ferric oxidoreductase (Q6BV08) among the top ones (Table S3 ). Moreover, 6 of those 15 proteins show a logFC>10. In the presence of KCl, apart...”

AO090020000259 No description from Aspergillus oryzae RIB40
43% identity, 83% coverage

• Comparative transcriptome analysis revealing dormant conidia and germination associated genes in Aspergillus species: an essential role for AtfA in conidial dormancy
  Hagiwara, BMC genomics 2016
  • “...hypothetical protein Afu3g01210 An01g10950 AO090026000081 454.0 867.9 583.9 n.d. - ThiJ/PfpI family protein Afu5g01160 An03g02190 AO090020000259 338.5 21.7 12.7 full - Monosaccharide transporter Afu8g06020 An15g04770 AO090005000539 275.9 74.8 297.8 full - Glutamate decarboxylase Afu6g03890 An09g03130 AO090701000158 249.3 350.6 194.9 full catA Catalase A Afu1g03580 An18g04120 AO090009000418...”

XP_025453682 general substrate transporter from Aspergillus niger CBS 101883
43% identity, 86% coverage

• Advances in fungal sugar transporters: unlocking the potential of second-generation bioethanol production
  Pereira, Applied microbiology and biotechnology 2025
  • “...A. niger vankuyk et al. ( 2004 ); Jrgensen et al. ( 2007 ) MstG XP_025453682 Glucose, galactose, mannose, and sucrose A. niger Sloothaak et al. ( 2015 ) MstH XP_001396930 Glucose, fructose, galactose, mannose, and sucrose A. niger Sloothaak et al. ( 2015 ) XltA...”

AFUA_2G11520 MFS monosaccharide transporter, putative from Aspergillus fumigatus Af293
40% identity, 94% coverage

• Conservation of nucleosome positions in duplicated and orthologous gene pairs
  Nishida, TheScientificWorldJournal 2012
  • “...AFUA_3G04200 0.653965099 YMR110C AFUA_4G13500 0.649573592 YDR479C AFUA_2G01510 0.649340576 YLR307W AFUA_4G09940 0.641152119 YLL050C AFUA_5G10570 0.636927762 YMR011W AFUA_2G11520 0.631877767 YGR149W AFUA_3G08240 0.627253467 YKL125W AFUA_1G02590 0.626251676 YDL247W AFUA_3G01700 0.621782331 YHR165C AFUA_2G03030 0.616638486 YLR355C AFUA_3G14490 0.615946987 YLR307W AFUA_3G07210 0.615345397 YNL156C AFUA_4G07680 0.605449075 YOL157C AFUA_8G07070 0.600254438 YPL196W AFUA_3G08740 0.596649007 YOL156W AFUA_2G11520...”
  • “...AFUA_3G07380 0.064624439 YIR038C AFUA_2G17300 0.068756542 YDL102W AFUA_2G16600 0.088010728 YOR389W AFUA_2G01940 0.09375584 YBR244W AFUA_3G12270 0.097477745 YJL219W AFUA_2G11520 0.098366126 YPL126W AFUA_7G02610 0.101632712 YDL189W AFUA_1G09400 0.104331651 YHL016C AFUA_1G04870 0.106608293 YLR380W AFUA_4G13930 0.111437921 YPR165W AFUA_6G06900 0.117573203 YOL062C AFUA_5G07930 0.122120003 YGL248W AFUA_1G14890 0.124318908 YLR029C AFUA_1G04660 0.129375946 YMR214W AFUA_2G08300 0.130867913 YOR124C AFUA_6G12270...”
• The proteomic signature of Aspergillus fumigatus during early development
  Cagas, Molecular & cellular proteomics : MCP 2011
  • “...AFUA_5G10070 AFUA_4G09600 AFUA_7G01010 AFUA_2G03830 AFUA_2G09030 AFUA_2G11520 AFUA_4G01290 ORF Name fatty acid beta-oxidation N-acetylglucosamine catabolic...”

An05g01290 uncharacterized protein from Aspergillus niger
43% identity, 86% coverage

• Evaluation of Aspergillus niger Six Constitutive Strong Promoters by Fluorescent-Auxotrophic Selection Coupled with Flow Cytometry: A Case for Citric Acid Production
  Lu, Journal of fungi (Basel, Switzerland) 2022
  • “...starch hydrolysis, glucose uptake, and glycolysis, such as amyA (An12g06930), glaA (An03g06550), mstC (An02g03540), mstG (An05g01290), mstH (An15g03940), pfkB (An07g02100), and ppcA (An11g02550) ( Table 2 ). As to intracellular citrate transportation, mitochondrial citrate/malate carrier protein CtpA (An11g11230) was also synergistically upregulated ( Table 2 )....”
  • “...An03g06550 glaA Glucoamylase 2.83 6.49 2.29 An02g03540 mstC Low affinity glucose transporter 1.25 1.58 1.26 An05g01290 mstG High affinity glucose transporter 1.25 1.39 1.11 An15g03940 mstH High affinity glucose transporter 2.73 5.75 2.11 An04g06910 amyR Transcription factor 2.35 2.59 1.10 An08g02260 pgkA Phosphoglycerate kinase 1.32 1.37...”
• In Silico Analysis of Putative Sugar Transporter Genes in Aspergillus niger Using Phylogeny and Comparative Transcriptomics
  Peng, Frontiers in microbiology 2018
  • “...D -glucose transporter encoding gene mstC (An02g03540) and high-affinity D -glucose transporter encoding gene mstG (An05g01290) were higher expressed on hexose substrates than other monosaccharides. The D -galacturonic acid transporter encoding genes gatA (An14g04280) ( Sloothaak et al., 2014 ) and the D -xylose transporter encoding...”
• Metabolic activity in dormant conidia of Aspergillus niger and developmental changes during conidial outgrowth
  Novodvorska, Fungal genetics and biology : FG & B 2016
  • “...putative glucose/hexose transporters ( Pel et al., 2007 ) transcription of 5 genes (An02g03540, An15g03940, An05g01290, An16g08940, An02g01270) was highly upregulated at T1. The most upregulated was the homolog of A. nidulans mstE , (An02g03540) encoding a low affinity glucose transporter. Transcription of mstA encoding a...”
  • “...lower transcript levels in the sorbic acid condition than in the control sample, apart from An05g01290. Glucokinase (An12g08610) is a high affinity glucose phosphorylating enzyme necessary for the activation of intracellular glucose and it plays an important role in the germination process especially in low glucose...”

CIMG_08310 sugar porter (SP) family MFS transporter from Coccidioides immitis RS
42% identity, 88% coverage

• Gene expression in human fungal pathogen Coccidioides immitis changes as arthroconidia differentiate into spherules and mature
  Viriyakosol, BMC microbiology 2013
  • “...well as efflux [ 33 ]. Two highly upregulated genes are sugar transporters (CIMG_03001 and CIMG_08310). A nicotinic acid transporter (CIMG_06071) and a sialate transporter (CIMG_03956) were also upregulated. The nicotinic acid transporter is presumably involved in NAD metabolism [ 34 ]; we have been unable...”

AFUA_5G01160, Afu5g01160 MFS monosaccharide transporter, putative from Aspergillus fumigatus Af293
39% identity, 98% coverage

• Analysis of an Intrinsic Mycovirus Associated With Reduced Virulence of the Human Pathogenic Fungus Aspergillus fumigatus
  Takahashi-Nakaguchi, Frontiers in microbiology 2019
  • “...membrane transport was identified (RTA1 domain protein; AFUA_5G05640, MFS multidrug transporter; AFUA_4G01140, MFS monosaccharide transporter; AFUA_5G01160) ( Supplementary Table S2A ). Among the genes that were down-regulated in virus-infected A. fumigatus , the most drastic change was observed in the transcript encoding NAD-dependent formate dehydrogenase AciA/Fdh...”
• Comparative transcriptome analysis revealing dormant conidia and germination associated genes in Aspergillus species: an essential role for AtfA in conidial dormancy
  Hagiwara, BMC genomics 2016
  • “...- Conserved hypothetical protein Afu3g01210 An01g10950 AO090026000081 454.0 867.9 583.9 n.d. - ThiJ/PfpI family protein Afu5g01160 An03g02190 AO090020000259 338.5 21.7 12.7 full - Monosaccharide transporter Afu8g06020 An15g04770 AO090005000539 275.9 74.8 297.8 full - Glutamate decarboxylase Afu6g03890 An09g03130 AO090701000158 249.3 350.6 194.9 full catA Catalase A Afu1g03580...”
• Conservation of nucleosome positions in duplicated and orthologous gene pairs
  Nishida, TheScientificWorldJournal 2012
  • “...AFUA_8G05620 0.398124519 YHL001W AFUA_6G03830 0.397471165 YNL255C AFUA_1G07630 0.390527675 YGL006W AFUA_3G10690 0.389206341 YIL125W AFUA_4G11650 0.387564721 YMR011W AFUA_5G01160 0.381368332 YMR010W AFUA_5G03510 0.378223656 YMR319C AFUA_4G14640 0.376638524 YDL110C AFUA_1G09160 0.376540694 YOL086C AFUA_5G06240 0.376281416 YGR076C AFUA_4G09000 0.373900773 YOR204W AFUA_4G07660 0.368301524 YMR229C AFUA_2G16040 0.367246087 YLR025W AFUA_1G06420 0.363738278 YPL281C AFUA_6G06770 0.363265962 YOR294W AFUA_7G04430...”
  • “...AFUA_7G01030 0.222088168 YBR179C AFUA_5G13392 0.219453048 YKR082W AFUA_4G05840 0.214144582 YLR087C AFUA_2G13520 0.209434557 YCL064C AFUA_4G07810 0.204494803 YOL156W AFUA_5G01160 0.203744073 YBR249C AFUA_7G04070 0.202306902 YJL093C AFUA_3G07540 0.201465401 YOL077C AFUA_1G02210 0.196710807 YLR426W AFUA_1G06280 0.196041865 YMR060C AFUA_2G03840 0.194299595 YOR048C AFUA_1G13730 0.193994391 YDL174C AFUA_7G02560 0.193117882 YJL221C AFUA_8G07070 0.187015236 YGR054W AFUA_3G05970 0.181434929 YPR176C AFUA_7G04460...”
• Evolutionary Analysis of Sequence Divergence and Diversity of Duplicate Genes in Aspergillus fumigatus
  Yang, Evolutionary bioinformatics online 2012
  • “...1.19 [0.21, 1.58] Afu2g08040 1.79 [1.81, 0.81] Afu5g01040 1.18 [1.12, 2.70] Afu6g09970 0.61 [1.25, 2.20] Afu5g01160 1.17 [0.65, 2.17] Afu8g01180 0.57 [1.44, 1.32] Afu8g04470 1.16 [0.66, 2.13] Afu6g11320 1.79 [2.31, 1.80] Afu7g00390 1.13 [0.49, 1.91] Afu3g01120 0.66 [0.98, 1.94] Afu5g00980 1.13 [0.82, 2.31] Afu1g10370 0.97 [1.82,...”
• The proteomic signature of Aspergillus fumigatus during early development
  Cagas, Molecular & cellular proteomics : MCP 2011
  • “...File 8 Hours Microarray Data AFUA_8G04550 AFUA_5G01160 AFUA_6G12000 AFUA_7G01010 AFUA_8G02440 AFUA_5G08830 16 Hours Microarray Data AFUA_4G13510 AFUA_1G01490...”
• Sub-telomere directed gene expression during initiation of invasive aspergillosis
  McDonagh, PLoS pathogens 2008
  • “...monocarboxylate transporter 4.628176816 Afu8g01130 alpha-galactosidase C 2.8084929 Afu6g03060 monosaccharide transporter 4.576610248 Afu4g01070 acid phosphatase 3.4709519 Afu5g01160 monosaccharide transporter 4.53846138 Afu7g05610 glucanase 3.7652613 Afu4g13080 monosaccharide transporter 4.316438927 Afu4g00870 antigenic cell wall galactomannoprotein 2.8100298 Afu7g05830 MFS sugar transporter 4.069715654 Afu6g02980 extracellular exo-polygalacturonase 6.9692415 Afu6g14500 MFS sugar transporter 3.883566446...”

ATEG_03527 uncharacterized protein from Aspergillus terreus NIH2624
42% identity, 87% coverage

• Transcriptome Profiling-Based Analysis of Carbohydrate-Active Enzymes in Aspergillus terreus Involved in Plant Biomass Degradation
  Corrêa, Frontiers in bioengineering and biotechnology 2020
  • “...during the 48 h incubation period, namely ATEG_07791, ATEG_03475, ATEG_07105, ATEG_04988, ATEG_01556, ATEG_07124, ATEG_08653, ATEG_07144, ATEG_03527, ATEG_02489, ATEG_07114, ATEG_04070, ATEG_07053, ATEG_04137, ATEG_03190, and ATEG_05008. RT-qPCR Validation of in silico RNA-Seq Transcriptome Data Expression profiles for selected A. terreus CAZyme-encoding and other genes significantly up-regulated on SB...”

PDIP_55020 MFS monosaccharide transporter, putative from Penicillium digitatum
40% identity, 95% coverage

• Transcriptome Analysis of mfs2-Defective Penicillium digitatum Mutant to Reveal Importance of Pdmfs2 in Developing Fungal Prochloraz Resistance
  Cuan, Microorganisms 2024
  • “...up-regulation of multiple MFS isogenes, including MFS23 (PDIP_36610), MFS26 (PDIP_64100), MFS27 (PDIP_55370), MFS31 (PDIP_19850), MFS33 (PDIP_55020) ( Table 8 ). All these five MFS-encoding genes did not show up-regulation in the comparison Pd-d-(I/NI); however, three of them (i.e., MFS23 , MFS26 and MFS27 ) showed up-regulation...”
  • “...1.15 / MFS31 (PDIP_19850) / 2.63 / 2.05 MFS32 (PDIP_28570) 1.23 1.11 / / MFS33 (PDIP_55020) / 1.07 / 1.22 ABC1 (PDIP_64370) / / 1.35 1.71 ABC2 (PDIP_58890) / / 1.18 / ABC3 (PDIP_13640) 2.75 1.09 2.84 1.18 ABC4 (PDIP_19230) 1.05 / 2.20 1.43 ABC5 (PDIP_78490)...”

AFUA_7G00950, Afu7g00950 MFS monosaccharide transporter, putative from Aspergillus fumigatus Af293
42% identity, 88% coverage

• Broad-spectrum antimicrobial activities of a food fermentate of <i>Aspergillus oryzae</i>
  Choi, Microbiology spectrum 2024
  • “...AFUA_1G04780 pxa1 Putative peroxisomal ABC transporter 2.38 AFUA_1G14330 abcC Putative ABC transporter, Azole transporter 2.35 AFUA_7G00950 Putative MFS monosaccharide transporter 2.25 AFUA_2G12500 Putative MFS multidrug transporter 2.25 AFUA_3G01840 Putative MFS transporter 2.25 AFUA_6G03060 Putative MFS monosaccharide transporter 2.14 AFUA_4G03750 Putative phthalate transporter 2.05 AFUA_6G03720 Putative MFS...”
• Induction of <i>Aspergillus fumigatus</i> zinc cluster transcription factor OdrA/Mdu2 provides combined cellular responses for oxidative stress protection and multiple antifungal drug resistance
  Sasse, mBio 2023
  • “...Up +753 (inside the 2nd intron) Afu4g14380 Up Up 247 Afu5g06070 mdr1 Up Up 1668 Afu7g00950 Up Up 1038 Afu8g01860 Up Up 181 Afu8g06430 Up Down Not found Afu2g02690 atrR/odrD Up 811 Afu3g01910 Down Up 152 Afu3g01910 Down Up +1447 (inside the seventh exon) Afu5g14740 fleA...”
• A Novel Zn2-Cys6 Transcription Factor AtrR Plays a Key Role in an Azole Resistance Mechanism of Aspergillus fumigatus by Co-regulating cyp51A and cdr1B Expressions
  Hagiwara, PLoS pathogens 2017
  • “...6.46 9.32 hypothetical protein Afu5g06070 mdr1 11.9 65.9 108.2 5.53 9.09 ABC multidrug transporter Mdr1 Afu7g00950 10.3 60.5 77.7 5.87 7.54 MFS monosaccharide transporter, putative Afu8g01860 30.6 163.0 218.8 5.32 7.15 hypothetical protein DOWN in atrR and srbA Afu1g03150 erg24A 25.5 1.1 2.5 0.04 0.10 c-14...”
• Temperature during conidiation affects stress tolerance, pigmentation, and trypacidin accumulation in the conidia of the airborne pathogen Aspergillus fumigatus
  Hagiwara, PloS one 2017
  • “...3.1 13.69 0.99 conserved hypothetical protein AFUA_8G04920 201.1 14.9 8.2 13.49 0.55 LEA domain protein AFUA_7G00950 285.3 22.1 26.7 12.89 1.21 MFS monosaccharide transporter, putative AFUA_5G00145 101.3 8.1 2.5 12.48 0.31 conserved hypothetical protein AFUA_4G00730 3748.9 308.7 61.8 12.14 0.20 HHE domain protein AFUA_3G14750 31.9 2.6...”
• Conservation of nucleosome positions in duplicated and orthologous gene pairs
  Nishida, TheScientificWorldJournal 2012
  • “...AFUA_5G13130 0.490832735 YDR055W AFUA_4G06820 0.482973721 YLR104W AFUA_5G04040 0.47610876 YIL129C AFUA_6G11010 0.473123981 YDR300C AFUA_2G07570 0.469287567 YOL156W AFUA_7G00950 0.46726022 YGL201C AFUA_5G10890 0.462753539 YKR086W AFUA_1G03820 0.461061937 YPL157W AFUA_6G08610 0.460257721 YIL046W AFUA_2G14110 0.45798838 YGL048C AFUA_4G04660 0.457664607 YHR216W AFUA_2G03610 0.456902272 YDR424C AFUA_1G04850 0.455530713 YPR141C AFUA_2G14280 0.452133975 YLR427W AFUA_1G07150 0.444534443 YHL004W AFUA_1G06570...”
  • “...AFUA_2G02850 0.284622252 YLR429W AFUA_2G14270 0.283845667 YDR397C AFUA_3G02340 0.283499213 YBR260C AFUA_3G06280 0.282196097 YCR087C-A AFUA_7G04700 0.281322207 YMR011W AFUA_7G00950 0.280854319 YOL148C AFUA_1G16580 0.274850272 YDR379W AFUA_1G12680 0.273041289 YJL151C AFUA_5G10590 0.272979399 YML020W AFUA_5G12090 0.266526854 YGR082W AFUA_6G11380 0.265129767 YJR113C AFUA_1G04280 0.262789584 YIL031W AFUA_5G03200 0.256820972 YDR432W AFUA_3G10100 0.255963453 YDR359C AFUA_4G07560 0.255317292 YDR233C AFUA_6G13670...”

SJAG_03606 hexose transporter Ght6 from Schizosaccharomyces japonicus yFS275
41% identity, 85% coverage

• Molecular and comparative genomic analyses reveal evolutionarily conserved and unique features of the Schizosaccharomyces japonicus mycelial growth and the underlying genomic changes
  Papp, Current genetics 2021
  • “...Diphthamide biosynthesis protein orf19.4173 + HCBG_08193 + SJAG_02958 Hexose transporter Ght5 orf19.2023 + HCBG_04231 + SJAG_03606 Hexose transporter Ght6 orf19.2023 + HCBG_04231 + SJAG_02883 Potassium ion transporter Trk2 orf19.600 + HCBG_06373 + SJAG_05329 Anaphase-promoting complex subunit Apc1 orf19.6046 + HCBG_07750 + SJAG_00493 Fumarylacetoacetate hydrolase orf19.2184 +...”

TC 2.A.1.1.22 / O74849 Hexose:H+ symporter, Ght6 (Fructose > Glucose) from Schizosaccharomyces pombe (Fission yeast) (see 3 papers)
ght6 / RF|NP_587739.1 high-affinity fructose transporter ght6 from Schizosaccharomyces pombe (see paper)
SPCC1235.13 hexose transporter Ght6 (PMID 10735857) from Schizosaccharomyces pombe
41% identity, 86% coverage

• substrates: H+, Hexose
• Dataset describing the genome wide effects on transcription resulting from alterations in the relative levels of the bZIP transcription factors Atf1 and Pcr1 in Schizosaccharomyces pombe
  Basu, Data in brief 2022
  • “...SPAPB1E7.05 gde1 glycerophosphoryl diester phosphodiesterase Gde SPBC11C11.05 SPBC11C11.05 conserved fungal cell wall protein, Kre9/Knh1 family SPCC1235.13 ght6 plasma membrane glucose/fructose:proton symporter Ght6 SPBC14C8.01c cut2 sister chromatid separation inhibitor, securin SPAC821.09 eng1 cell septum surface endo-1,3-beta-glucanase Eng1 SPAC1006.08 etd1 Spg1-binding protein Etd1 SPBP26C9.03c fet4 plasma membrane iron/zinc...”
• The contribution of non-essential Schizosaccharomyces pombe genes to fitness in response to altered nutrient supply and target of rapamycin activity
  Lie, Open biology 2018
  • “...histone acetyltransferase catalytic subunit Gcn5 sensitive (T) SPAC1F8.01 ght3 hexose transmembrane transporter Ght3 sensitive (T) SPCC1235.13 ght6 hexose transmembrane transporter Ght6 sensitive (A, T) SPAC12G12.12 gms2 UDP-galactose transmembrane transporter Gms2 (predicted) sensitive (T) SPAC30D11.06c hfl1 Lazarus1 family transmembrane transporter resistant (G, P) SPBC2G2.01c liz1 pantothenate transmembrane...”
• Endocytosis is essential for dynamic translocation of a syntaxin 1 orthologue during fission yeast meiosis
  Kashiwazaki, Molecular biology of the cell 2011
  • “...Sec14 cytosolic family 0 PM, FSM ZK374 SPCC584.05 sec1 + SNARE-binding protein 0 FSM ZK375 SPCC1235.13 ght6 + /meu12 + Hexose transporter 10 PM, vacuole ZK230 SPCC1739.10 mug33 + Conserved fungal protein 4 Vacuole ZK228 Although internalization of both Psy1 and Pmd1 was facilitated during meiosis,...”
• Comprehensive isolation of meiosis-specific genes identifies novel proteins and unusual non-coding transcripts in Schizosaccharomyces pombe
  Watanabe, Nucleic acids research 2001
  • “...(3). ght6+ codes for a putative hexose transporter (SPCC1235.13) with close similarity to the Ght5 protein. Bgs2, a putative 1,3--glucan synthase component, was...”

ATEG_08653 uncharacterized protein from Aspergillus terreus NIH2624
44% identity, 52% coverage

• Transcriptome Profiling-Based Analysis of Carbohydrate-Active Enzymes in Aspergillus terreus Involved in Plant Biomass Degradation
  Corrêa, Frontiers in bioengineering and biotechnology 2020
  • “...and SH during the 48 h incubation period, namely ATEG_07791, ATEG_03475, ATEG_07105, ATEG_04988, ATEG_01556, ATEG_07124, ATEG_08653, ATEG_07144, ATEG_03527, ATEG_02489, ATEG_07114, ATEG_04070, ATEG_07053, ATEG_04137, ATEG_03190, and ATEG_05008. RT-qPCR Validation of in silico RNA-Seq Transcriptome Data Expression profiles for selected A. terreus CAZyme-encoding and other genes significantly up-regulated...”

NP_587740 plasma membrane high-affinity glucose/fructose:proton symporter Ght5 from Schizosaccharomyces pombe
SPCC1235.14 hexose transporter Ght5 (PMID 10735857) from Schizosaccharomyces pombe
41% identity, 87% coverage

• TORC2 inhibition of α-arrestin Aly3 mediates cell surface persistence of S. pombe Ght5 glucose transporter in low glucose.
  Toyoda, Journal of cell science 2021 (PubMed)
  • GeneRIF: TORC2 inhibition of alpha-arrestin Aly3 mediates cell surface persistence of S. pombe Ght5 glucose transporter in low glucose.
• Iron regulates hexose transporters in Schizosaccharomyces pombe.
  Özkan, Journal of basic microbiology 2019 (PubMed)
  • GeneRIF: Schizosaccharomyces pombe hexose transporter Ght5 is significantly decreased by toxic iron dose but not by non-toxic doses. Ght5 protein might play a role in sensing and signaling of iron stress.
• Mechanisms of expression and translocation of major fission yeast glucose transporters regulated by CaMKK/phosphatases, nuclear shuttling, and TOR.
  Saitoh, Molecular biology of the cell 2015
  • GeneRIF: Data show that the newly synthesized glucose transport Ght5 locates preferentially at the cell tips with the aid of the target of rapamycin (TOR) complex 2 signaling.
• Inorganic polyphosphate abets silencing of a sub-telomeric gene cluster in fission yeast
  Sanchez, microPublication biology 2023
  • “...in meiosis -1.49 SPBC21C3.19 rtc3 SBDS family protein -1.39 SPAP8A3.04c hsp9 heat shock protein -1.36 SPCC1235.14 ght5 high-affinity glucose/fructose:proton symporter -1.32 SPAC637.03 DUF1774 family -1.29 SPBC725.10 tsp0 mitochondrial outer membrane protein -1.27 SPBC23G7.13c urea transmembrane transporter -1.27 SPAC13G7.02c ssa1 Hsp70 family heat shock protein -1.18 SPBC660.06...”

TC 2.A.1.1.21 / O74969 Hexose:H+ symporter, Ght2 (Glucose > Fructose) from Schizosaccharomyces pombe (Fission yeast) (see 3 papers)
ght2 / RF|NP_596425.1 high-affinity glucose transporter ght2 from Schizosaccharomyces pombe (see paper)
NP_596425 plasma membrane glucose/fructose:proton symporter Ght2 from Schizosaccharomyces pombe
41% identity, 87% coverage

• substrates: Hexoses
• Ght2⁺ is required for UDP-galactose synthesis from extracellular galactose by Schizosaccharomyces pombe.
  Matsuzawa, Applied microbiology and biotechnology 2013 (PubMed)
  • GeneRIF: These results indicate that galactose is transported from the medium to the cytosol in a Ght2-dependent manner, and is then converted into UDP-galactose.

An03g02190 uncharacterized protein from Aspergillus niger
38% identity, 94% coverage

• Comparative transcriptome analysis revealing dormant conidia and germination associated genes in Aspergillus species: an essential role for AtfA in conidial dormancy
  Hagiwara, BMC genomics 2016
  • “...Conserved hypothetical protein Afu3g01210 An01g10950 AO090026000081 454.0 867.9 583.9 n.d. - ThiJ/PfpI family protein Afu5g01160 An03g02190 AO090020000259 338.5 21.7 12.7 full - Monosaccharide transporter Afu8g06020 An15g04770 AO090005000539 275.9 74.8 297.8 full - Glutamate decarboxylase Afu6g03890 An09g03130 AO090701000158 249.3 350.6 194.9 full catA Catalase A Afu1g03580 An18g04120...”
• Aspergillus niger membrane-associated proteome analysis for the identification of glucose transporters
  Sloothaak, Biotechnology for biofuels 2015
  • “...HMM gluT was not observed in the three studied conditions. It is denoted as MstE (An03g02190) in the UniProt database, and has been found to be expressed in germinating spores [ 45 ]. The fifth highest scoring hit, with protein ID 1143191, is MstA. The mstA...”
• The effect of natamycin on the transcriptome of conidia of Aspergillus niger
  van, Studies in mycology 2013
  • “...of the most extremely up-regulated genes are An06g02270 (similar to an arabinose transport protein, 168-fold); An03g02190 (similarity to the sugar transporter Sut 1, 136-fold) and An13g00840 (similarity to amino acid protein GAP1, 132-fold). Table 5. Transcript levels of genes involved in trafficking, fission and fusion of...”

VDAG_05443 galactose transporter from Verticillium dahliae VdLs.17
40% identity, 86% coverage

• Identification of sugar transporter genes and their roles in the pathogenicity of Verticillium dahliae on cotton
  Chen, Frontiers in plant science 2023
  • “...are capable of acquisition of monosaccharide and disaccharide substrates, including glucose, galactose (VDAG_01215, VDAG_08381 and VDAG_05443), xylose (VDAG_03925), alpha-glucoside, lactose and maltose. It was notable that several genes encoding inositol transporters and quinine permeases were identified from V. dahliae . The function of these genes in...”

TC 2.A.1.1.36 / Q400D8 The low affinity, glucose-inducible glucose transporter, MstE from Emericella nidulans (Aspergillus nidulans) (see paper)
mstE low affinity glucose transporter MstE from Emericella nidulans (see paper)
40% identity, 92% coverage

• substrates: glucose
• CharProtDB Description: Low affinity glucose transporter of the major facilitator superfamily (MFS); Source:AspGD

An02g03540 uncharacterized protein from Aspergillus niger
43% identity, 87% coverage

• The antifungal peptide AnAFP from Aspergillus niger promotes nutrient mobilization through autophagic recycling during asexual development
  Starke, Frontiers in microbiology 2024
  • “...An12g04180 Aspartate transporter agtA -1.99 1.1E-02 An15g07190 Zinc transporter, endoplasmic reticulum membrane zrfA -2.25 6.5E-04 An02g03540 Hig-affinity hexose/H+ symporter mstE -2.28 7.2E-05 An02g14410 Ammonium transporter meaA -2.9 4.1E-02 An08g05670 Nitrate transporter crnA -3.88 6.8E-03 An07g06240 MFS transporter, ferric triacetylfusarinine C transport mirD -5.28 1.8E-02 An08g03200 Ammonium...”
• ERV14 receptor impacts mycelial growth via its interactions with cell wall synthase and transporters in Aspergillus niger
  Zheng, Frontiers in microbiology 2023
  • “...of proteome and the Y2H screening. Family Protein accession Gene ID Description MFS family CAK47634 An02g03540 Fructose transmembrane transporter CAK97262 An15g03940 Monosaccharide transporter CAK37108 An01g07860 Sulfate transmembrane transporter ABC family CAK43073 An17g01770 ATPase-coupled transmembrane transporter F-ATPase family CAK37765 An02g08020 H + -transporting ATPase lipid-binding protein P-ATPase...”
• Evaluation of Aspergillus niger Six Constitutive Strong Promoters by Fluorescent-Auxotrophic Selection Coupled with Flow Cytometry: A Case for Citric Acid Production
  Lu, Journal of fungi (Basel, Switzerland) 2022
  • “...genes in starch hydrolysis, glucose uptake, and glycolysis, such as amyA (An12g06930), glaA (An03g06550), mstC (An02g03540), mstG (An05g01290), mstH (An15g03940), pfkB (An07g02100), and ppcA (An11g02550) ( Table 2 ). As to intracellular citrate transportation, mitochondrial citrate/malate carrier protein CtpA (An11g11230) was also synergistically upregulated ( Table...”
  • “...2.79 6.12 2.19 An12g06930 amyA Amylase 2.03 3.76 1.85 An03g06550 glaA Glucoamylase 2.83 6.49 2.29 An02g03540 mstC Low affinity glucose transporter 1.25 1.58 1.26 An05g01290 mstG High affinity glucose transporter 1.25 1.39 1.11 An15g03940 mstH High affinity glucose transporter 2.73 5.75 2.11 An04g06910 amyR Transcription factor...”
• Novel Treatment Approach for Aspergilloses by Targeting Germination
  Verburg, Journal of fungi (Basel, Switzerland) 2022
  • “...triggering breaking of dormancy. Negatively regulated by AtfA. A. fumigatus [ 97 ] CreA (An02g03830), (An02g03540) Fermentation/ Glycolysis: creA is a catabolite repressor. [ 174 ] FleA Recognizes and binds receptors, plays a role in attachment/adhesion to epithelial cells, as well as recognition by hosts immune...”
• RCO-3 and COL-26 form an external-to-internal module that regulates the dual-affinity glucose transport system in Neurospora crassa
  Li, Biotechnology for biofuels 2021
  • “...the WT strain [ 87 ]. In A. niger , the A. nidulans MstE ortholog An02g03540 showed a high expression level on glucose and maltose, and its expression in a amyR mutant was significantly downregulated [ 90 ]. To test the hypothesis that the dual-affinity glucose...”
• In Silico Analysis of Putative Sugar Transporter Genes in Aspergillus niger Using Phylogeny and Comparative Transcriptomics
  Peng, Frontiers in microbiology 2018
  • “...on the tested carbon sources. For instance, the low-affinity D -glucose transporter encoding gene mstC (An02g03540) and high-affinity D -glucose transporter encoding gene mstG (An05g01290) were higher expressed on hexose substrates than other monosaccharides. The D -galacturonic acid transporter encoding genes gatA (An14g04280) ( Sloothaak et...”
• Metabolic activity in dormant conidia of Aspergillus niger and developmental changes during conidial outgrowth
  Novodvorska, Fungal genetics and biology : FG & B 2016
  • “...genes encoding putative glucose/hexose transporters ( Pel et al., 2007 ) transcription of 5 genes (An02g03540, An15g03940, An05g01290, An16g08940, An02g01270) was highly upregulated at T1. The most upregulated was the homolog of A. nidulans mstE , (An02g03540) encoding a low affinity glucose transporter. Transcription of mstA...”
  • “...Verified/putative function An11g04810 3.1 94.8 Alternative oxidase, aox1 An01g09290 85.1 17.6 Neutral trehalase, treB a An02g03540 15.8 489.9 Low affinity glucose transporter, mstE An15g03940 4.0 336.7 Monosaccharide transporter An05g01290 2.8 324.2 Monosaccharide transporter An16g08940 5.1 118.8 Monosaccharide transporter An02g01270 1.6 25.8 Monosaccharide transporter An12g07450 1.6 9.5...”
• Trancriptional landscape of Aspergillus niger at breaking of conidial dormancy revealed by RNA-sequencing
  Novodvorska, BMC genomics 2013
  • “...phosphoglycerate kinase 19.01 32.17 15.68 2.05 An02g03830 creA , catabolite repressor 2.57 4.43 30.22 6.82 An02g03540 hexose transport protein 42.48 33.08 523.81 15.83 GABA shunt An10g00090 glutamate dehydrogenase 89.12 246.31 3.87 63.64 An15g04770 glutamate decarboxylase 63.83 62.34 2.3 27.10 An08g08840 glutamate decarboxylase 5.74 16.85 3.14 5.36...”
• More

G0RKF0 Galactose permease from Hypocrea jecorina (strain QM6a)
42% identity, 86% coverage

• Advances in fungal sugar transporters: unlocking the potential of second-generation bioethanol production.
  Pereira, Applied microbiology and biotechnology 2025
  • “...xylose, fructose, galactose, mannose, and L-arabinose T. reesei Sloothaak et al. ( 2016b ) STR3 G0RKF0 Glucose, xylose, fructose, galactose, and mannose T. reesei Sloothaak et al. ( 2016b ) GLT1 G0RGR7 Glucose T. reesei Havukainen et al. ( 2021b ) STP1 G0RIJ1 Glucose, fructose, galactose,...”

TC 2.A.1.1.58 / Q8J0U9 Low affinity glucose:H+ symporter, MstC from Aspergillus niger
43% identity, 85% coverage

• substrates: glucose
• Aspergillus niger membrane-associated proteome analysis for the identification of glucose transporters
  Sloothaak, Biotechnology for biofuels 2015
  • “...100 Remark Sorbitol Sorbitol+1mM glucose Sorbitol+60mM glucose 1121621 653.1 467 78.5 9.081.02 11.894.79 9.473.50 MstC (Q8J0U9) 1142882 583.1 464.5 74.8 2.240.48 4.470.20 n.d. MstG 1143598 559.3 411.7 86.1 6.381.83 17.542.39 n.d MstH 1143191 535 420 75.7 8.51e31.14e3 n.d. n.d. MstA (Q8J0V1) 1101809 364.4 364.7 85.6 4.830.51...”

GHT8_SCHPO / Q9P3U7 Probable high-affinity hexose transporter ght8, mitochondrial; Hexose transporter 8 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
SPCC548.06c hexose transporter Ght8 (predicted) from Schizosaccharomyces pombe
42% identity, 83% coverage

• Posttranslational Arginylation Enzyme Arginyltransferase1 Shows Genetic Interactions With Specific Cellular Pathways in vivo
  Wiley, Frontiers in physiology 2020
  • “...transcription factor activator Rep2 rpl3602 SPBC405.07 0.00082778 3.34334 60S ribosomal protein L36 RPL36A,RPL36B RPL36 ght8 SPCC548.06c 0.00086908 3.3298 Plasma membrane hexose:proton symporter, unknown specificity Ght8 (predicted) HXT15,HXT7,HXT6,STL1, HXT13, MAL11,HXT4, HXT1,HXT5,HXT8,HXT9, HXT16, GAL2,HXT2,HXT14, HXT17,HXT11 rpl35b SPBC1921.01c 0.00110496 3.26234 60S ribosomal protein L35a (predicted) RPL33B,RPL33A RPL35A rpl901 SPAC4G9.16c...”
• Proteasome regulation of petite-negativity in fission yeast.
  Amberg, bioRxiv : the preprint server for biology 2024
  • “...SPAC6G10.03c 0.43 0.030 mitochondrial cardiolipin-specific phospholipase Cld1 Q9HDU3 gal10 0.44 0.047 UDP-glucose 4-epimerase/aldose 1-epimerase Gal10 Q9P3U7 ght8 0.44 0.033 plasma membrane hexose:proton symporter, unknown specificity Ght8 Q9UQX0 sod2 0.46 0.009 mitochondrial superoxide dismutase Sod2 Q7Z9I3 SPCC663.08c 0.47 0.043 short chain dehydrogenase, unknown specificity O14295 plr1 0.47...”

SJAG_03608 hexose transporter Ght5 from Schizosaccharomyces japonicus yFS275
40% identity, 87% coverage

• Molecular and comparative genomic analyses reveal evolutionarily conserved and unique features of the Schizosaccharomyces japonicus mycelial growth and the underlying genomic changes
  Papp, Current genetics 2021
  • “...several glycolytic genes had altered mRNA levels in the S. japonicus hyphae. One hexose transporter (SJAG_03608), the glyceraldehyde-3P-dehydrogenase (SJAG_00027) and enolase (SJAG_02107) were strongly up-regulated, while further glycolytic genes also showed significantly elevated mRNA levels compared to yeast cells. However, their RNA values were lower than...”

TC 2.A.1.1.112 / Q9P3U6 High-affinity glucose transporter Ght1 (Hexose transporter 1) from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (see 2 papers)
SPCC548.07c hexose transporter Ght1 (PMID 10735857) from Schizosaccharomyces pombe
41% identity, 87% coverage

• substrates: glucose
• Comparative genomics of the white-rot fungi, Phanerochaete carnosa and P. chrysosporium, to elucidate the genetic basis of the distinct wood types they colonize
  Suzuki, BMC genomics 2012
  • “...NcRco3 (CAE76420), Pp_115604 (EED81359), Ps_ABN65648.2 (ABN65648.2), PsSut1 (AAD00266), ScHxt1 (M82963), ScHxt7 (NP_010629), ScSnf3 (P10870), SpGht1 (Q9P3U6), Tm-CAZ81962.1 (CAZ81962.1), TrHxt1 (AAR23147), TrXlt1 (shown enlarged; AY818402), TrHxt2 (DQ852622; Ruohonen and Margolles-Clark, unpublished). The sequences were aligned using MAFFT, and the tree was drawn by FigTree. In the heatmap...”
• The Loz1 transcription factor from Schizosaccharomyces pombe binds to Loz1 response elements and represses gene expression when zinc is in excess
  Wilson, Molecular microbiology 2019
  • “...( Corkins et al. , 2013 , Ehrensberger et al. , 2014 ) TGACGATCGAA 1515 SPCC548.07c $ ght1 Plasma membrane highaffinity glucose:proton symporter 4.70 GGAAAATCCAA 1766 TGGCAATCCCC 1808 TGCAAATCGCC 1817 SPCC1529.01 $ Transmembrane transporter 3.48 GGAAAATCCAA 1281 TGGCAATCCCC 1239 TGCAAATCGCC 1230 SPCC569.05c Spermidine family transporter 2.84...”

CCM_01166 siderophore iron transporter mirC from Cordyceps militaris CM01
41% identity, 87% coverage

• Metabolic comparison of aerial and submerged mycelia formed in the liquid surface culture of Cordyceps militaris
  Suparmin, MicrobiologyOpen 2019
  • “...12days of culture. In addition, the expression of the siderophore iron transporters mirB (CCM_08808), mirC (CCM_01166), FtrA (CCM_05132), sit1 (CCM_08222), and Atx1, putative (CCM_02485) and the ironrelated transporters (CCM_02485, CCM_08222, CCM_05132, CCM_07591, and CCM_01166) involved in the metabolism of iron were differentially expressed at 12th day...”

FGSG_02978 hypothetical protein from Fusarium graminearum PH-1
40% identity, 90% coverage

• A combined transcriptomic and physiological approach to understanding the adaptive mechanisms to cope with oxidative stress in Fusarium graminearum
  Park, Microbiology spectrum 2023
  • “...Pyrimidine precursor biosynthesis enzyme This study FgERG3A FGSG_02502 K00227 Delta7-sterol 5-desaturase ( 44 ) FgHGL3 FGSG_02978 K08139 MFS transporter, SP family, sugar:H + symporter This study FgHGL4 FGSG_04458 K05916 Nitric oxide dioxygenase This study FgHGL5 FGSG_09373 K18561 FAD-dependent fumarate reductase This study FgHGL6 FGSG_09845 K13076 Sphingolipid...”

Q1K4S3 Hexose transporter HXT13 from Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
NCU01633 hexose transporter HXT13 from Neurospora crassa OR74A
41% identity, 86% coverage

• Advances in fungal sugar transporters: unlocking the potential of second-generation bioethanol production
  Pereira, Applied microbiology and biotechnology 2025
  • “...( 2017a ) HGT-2 Q7S3Q4 Glucose N. crassa Wang et al. ( 2017a ) GLT-1 Q1K4S3 Glucose and xylose N. crassa Li et al. ( 2014 ); Wang et al. ( 2017a ) NCU00809 Q7SEC5 Lactose N. crassa Tamayo et al. ( 2024 ) CdtC S8AIR7...”
• Do mitochondria use efflux pumps to protect their ribosomes from antibiotics?
  Islam, Microbiology (Reading, England) 2023
  • “...NCU05226 Q7S8I2 ABC O42765, 7.8E^6 A0A1P8ATY7, 6.7E^12 Q8WW24, 1.4E^14 [ 79, 112 ] HXT13, NCU01633 Q1K4S3 MFS Q8J2J7, 2.1E^85 P23586, 1.2E^52 P11168, 2.6E^48 [ 79 ] NCU04809 Q756M6 MFS T2AWG3, 0.0014 Q8GYF4, 1.4E^24 B3KT41, 0.0022 [ 79 ] NCU09551 Q7S2B0 MFS G1UAY0, 2.3E^6 Q56ZZ7, 2.3E^7 Q8NBP5,...”
• Revisiting 2-Deoxyglucose Resistance in Neurospora crassa: Insights into Transcriptional Regulation of Hexose Transporters, Sugar Metabolism and Possible Modulation by Mating Type
  Pandey, 2023
• Do mitochondria use efflux pumps to protect their ribosomes from antibiotics?
  Islam, Microbiology (Reading, England) 2023
  • “...] NCU05226 Q7S8I2 ABC O42765, 7.8E^6 A0A1P8ATY7, 6.7E^12 Q8WW24, 1.4E^14 [ 79, 112 ] HXT13, NCU01633 Q1K4S3 MFS Q8J2J7, 2.1E^85 P23586, 1.2E^52 P11168, 2.6E^48 [ 79 ] NCU04809 Q756M6 MFS T2AWG3, 0.0014 Q8GYF4, 1.4E^24 B3KT41, 0.0022 [ 79 ] NCU09551 Q7S2B0 MFS G1UAY0, 2.3E^6 Q56ZZ7, 2.3E^7...”
• The F-box protein gene exo-1 is a target for reverse engineering enzyme hypersecretion in filamentous fungi
  Gabriel, Proceedings of the National Academy of Sciences of the United States of America 2021 (secret)
• Transcriptional Profiling of Myceliophthora thermophila on Galactose and Metabolic Engineering for Improved Galactose Utilization
  Wang, Frontiers in microbiology 2021
  • “...and most likely, it is the major galactose transporter in this fungus, of which ortholog (NCU01633, glt-1 ) in N. crassa has been identified as a glucose transporter and also has the capability of transportation of multiple other monosaccharides, including galactose ( Li et al., 2014...”
• Evaluating the circadian rhythm and response to glucose addition in dispersed growth cultures of Neurospora crassa
  Kelliher, Fungal biology 2020
  • “...genome, three genes were recently identified and characterized as major components of System I: glt-1 (NCU01633), and of System II: hgt-1 and hgt-2 (NCU10021 and NCU04963) ( Wang et al., 2017 ). The K m values for all three transporters fall within the ranges of earlier...”
• Identification and characterization of the glucose dual-affinity transport system in Neurospora crassa: pleiotropic roles in nutrient transport, signaling, and carbon catabolite repression
  Wang, Biotechnology for biofuels 2017
  • “...dual-affinity transport system in the model fungus N. crassa . One low-affinity glucose transporter, GLT-1 (NCU01633), and two high-affinity transporters, HGT-1/-2 (NCU10021 and NCU04963), were identified as the major components of systems I and II, respectively. Simultaneous deletion of hgt - 1/ - 2 (strain 2hgt...”
• Neurospora crassa transcriptomics reveals oxidative stress and plasma membrane homeostasis biology genes as key targets in response to chitosan
  Lopez-Moya, Molecular bioSystems 2016
  • “...other genes related with sugars assimilation were also induces in presence of chitosan such as NCU01633 ( hxt13 ; Table S2 ). Clusters 2M and 3M, had gene expression changes in the control but not in the chitosan treatment ( Figs. 4B and 4C ). Genes...”
• Involvement of the adaptor protein 3 complex in lignocellulase secretion in Neurospora crassa revealed by comparative genomic screening
  Pei, Biotechnology for biofuels 2015
  • “...alcohol oxidase 616.825.92 7.26 61 15869 NCU00335 jgi|Trire2|5140| Pre-mRNA-splicing factor cwc15 612.1815.31 6.51 62 13160 NCU01633 jgi|Trire2|62380| Hexose transporter HXT13 611.2919.85 6.33 63 19733 NCU06832 jgi|Trire2|112231| Kinesin 609.845.91 5.93 64 12341 NCU09864 jgi|Trire2|56726| 2-Oxoisovalerate dehydrogenase alpha subunit 608.184.15 5.88 65 11030 NCU07788 jgi|Trire2|52368| Fungal specific transcription...”
• More

XP_454897 hypothetical protein from Kluyveromyces lactis NRRL Y-1140
41% identity, 89% coverage

• Genetic basis of the highly efficient yeast Kluyveromyces marxianus: complete genome sequence and transcriptome analyses
  Lertwattanasakul, Biotechnology for biofuels 2015
  • “...Ps_XUT5, XP_001385962; Ps_XUT6, XP_001386589; Ps_XUT7, XP_001387067; Ps_RGT2, XP_001386588; Ps_SLT1, XP_001383774; Kl_KHT1/RAG1, XP_453656; Kl_KHT2, GN107317; Kl_KHT3, XP_454897; Kl_FRT1, XP_454356; Kl_HGT1, XP_451484; Kl_HXT1, XP_455078; Kl_HXT14, XP_454897; Kl_HXT2, XP_453960; Kl_HXT3, XP_453088; Sc_HXT4/LGT1, NP_011960; Kl_STL1, XP_456249; Kl_RAG4, XP_455315; Kl_LAC12, XP_452193; Ca_HXT6, XP_719472. Genes for the initial catabolism of xylose, PPP,...”

FGSG_07582 hypothetical protein from Fusarium graminearum PH-1
41% identity, 82% coverage

• Transcriptome-Based Discovery of Fusarium graminearum Stress Responses to FgHV1 Infection
  Wang, International journal of molecular sciences 2016
  • “...four mycoviruses, FgV1, FgV2, FgV3 and FgV4 [ 16 ]. Among these genes, FGSG_00878 and FGSG_07582 were also differentially expressed in the presence of FgHV1, showing down-regulation. FGSG_00878 encodes a hypothetical protein of unknown function, while FGSG_07582 belongs to the MFS. The MFS transporters are single-polypeptide...”
  • “...10 10 Domain: Transmembrane amino acid transporter protein FGSG_06127 0.146473 6.70 10 85 Formate dehydrogenase FGSG_07582 0.152292 0 MFS transporter FGSG_03984 0.152931 1.161 10 3 l -lactate dehydrogenase FGSG_01450 0.157498 6.18 10 57 Domain: Calcipressin FGSG_11272 0.178327 1.05 10 13 ABC transporter FGSG_07598 0.183762 2.45 10...”
• Comparison of Fusarium graminearum Transcriptomes on Living or Dead Wheat Differentiates Substrate-Responsive and Defense-Responsive Genes
  Boedi, Frontiers in microbiology 2016
  • “...FGSG_06462 Related to coenzyme a synthetase C37 NRPS FGSG_06539 Related to ACB 4-hydroxyacetophenone monooxygenase C39 FGSG_07582 Probable low-affinity hexose transporter HXT3 C40 FGSG_07587 Related to sugar transport protein STL1 C40 FGSG_13167 Uncharacterized protein C40 FGSG_08178 Related to decarboxylase DEC1 C48 FGSG_10989 Related to enoyl-coa hydratase/isomerase C64...”
• A comparison of transcriptional patterns and mycological phenotypes following infection of Fusarium graminearum by four mycoviruses
  Lee, PloS one 2014
  • “...0.0275 4.26937 0.00365 FGSG_06969 F-box protein Fbl2 4.39156 0.01665 3.49683 0.0023 3.14555 0.0029 2.89172 0.04295 FGSG_07582 similar to monosaccharide transporter 5.39624 0.00275 1.82755 0.04485 2.73038 0.00585 3.94659 0.00805 FGSG_07587 similar to hexose carrier protein 3.62644 0.0219 1.83566 0.03675 1.99288 0.023 3.12381 0.02275 FGSG_09059 hypothetical protein 4.2155...”

TRIREDRAFT_106556 galactose permease from Trichoderma reesei QM6a
G0RGR7 Galactose permease from Hypocrea jecorina (strain QM6a)
38% identity, 93% coverage

• Effect of the res2 transcription factor gene deletion on protein secretion and stress response in the hyperproducer strain Trichoderma reesei Rut-C30
  Alharake, BMC microbiology 2023
  • “...the condition LC/GC in res2 but not regulated in Rut-C30, such as low-affinity glucose transporter TRIREDRAFT_106556 ( hxt13 ), TRIREDRAFT_62747, and TRIREDRAFT_47897 which is involved in the oxidative stress response. One MFS transporter in this cluster is downregulated in the mutant (TRIREDRAFT_58561). On the other hand,...”
  • “...hydrolase family 55 LC/GC -2.17 6 TRIREDRAFT_121746 Putative Glycoside hydrolase family 55 GD/GC -2.20 6 TRIREDRAFT_106556 hxt13 hexose transporter GD/GC LD/LC LC/GC 5.08 3.14 6.67 4 TRIREDRAFT_62747 MFS membrane transporter LC/GC 3.16 4 TRIREDRAFT_47897 snq2 ABC transporter involved in oxidative stress response GD/GC LC/GC 2.08 3.17...”
• Advances in fungal sugar transporters: unlocking the potential of second-generation bioethanol production.
  Pereira, Applied microbiology and biotechnology 2025
  • “...Glucose, xylose, fructose, galactose, and mannose T. reesei Sloothaak et al. ( 2016b ) GLT1 G0RGR7 Glucose T. reesei Havukainen et al. ( 2021b ) STP1 G0RIJ1 Glucose, fructose, galactose, mannose, cellobiose, xylose, and L-arabinose T. reesei Zhang et al. ( 2013 ); Wang et al....”

FVEG_12687 MFS transporter, SP family, sugar:H+ symporter from Fusarium verticillioides 7600
40% identity, 83% coverage

• Transcriptome changes in Fusarium verticillioides caused by mutation in the transporter-like gene FST1
  Niu, BMC microbiology 2015
  • “...identified eight genes with high sequence similarity (FVEG_01519, FVEG_01638, FVEG_02081, FVEG_03992, FVEG_06504, FVEG_07757, FVEG_11293, and FVEG_12687). The sequence of FST1 was not identified by the search. Among the eight identified genes, expression was significantly down-regulated in fst1 for FVEG_06504 (named ITR1 ) (19-fold) and FVEG_03992 (5-fold),...”

SS1G_04841 hexose transporter from Sclerotinia sclerotiorum 1980 UF-70
41% identity, 83% coverage

• Transcriptional and Small RNA Responses of the White Mold Fungus Sclerotinia sclerotiorum to Infection by a Virulence-Attenuating Hypovirus
  Lee, Viruses 2018
  • “...the proteins differentially expressed primarily involved in carbohydrate metabolism, Sclerotinia sclerotiorum hexose transporter 1 (Sshxt1; SS1G_04841), and a predicted invertase (SS1G_07184; beta-fructofuranosidase) were upregulated 37.8-fold and 18.8-fold, respectively, in SsHV2-L-infected cultures. The expression of S. sclerotiorum hexose transporter 2 (SS1G_13734) was upregulated 89.3-fold by SsHV2-L infection....”
• Changes in the Sclerotinia sclerotiorum transcriptome during infection of Brassica napus
  Seifbarghi, BMC genomics 2017
  • “...2.8 SS1G_02048 spermidine drug resistance transporter 2.1 - - - - 3.2 2.2 Sugar transporters SS1G_04841 hexose transporter 4.1 2.9 - - - - SS1G_13734 hexose transporter HXT13 - 2.1 - - - - SS1G_04273 hexose transporter - - - - 6.1 15.8 SS1G_12412 hexose transporter...”

XP_007868407 uncharacterized protein from Gloeophyllum trabeum ATCC 11539
38% identity, 95% coverage

• Environment-dependent fitness gains can be driven by horizontal gene transfer of transporter-encoding genes
  Milner, Proceedings of the National Academy of Sciences of the United States of America 2019
  • “...M-M; W-R; W-S; Y-Q; V-N dipeptides (OmniLog) HGT-4 ( Fig. 3 C and D ) XP_007868407 Gloeophyllum trabeum ( Heliocybe ) (Basidiomycota) pfam00083 Sugar_tr [Sugar (and other) transporter] EBY.VW4000 ( 61 ) Mannose, glucose, galactose, xylose. HGT-4 ( Fig. 3 E ) BY4742 suc2 Euroscarf collection...”

TC 2.A.1.1.23 / Q92339 Gluconate:H+ symporter, Ght3 from Schizosaccharomyces pombe (Fission yeast) (see 2 papers)
ght3 / RF|NP_592790.1 high-affinity gluconate transporter ght3 from Schizosaccharomyces pombe (see paper)
SPAC1F8.01 hexose transporter Ght3 (PMID 10735857) from Schizosaccharomyces pombe
39% identity, 84% coverage

• substrates: Gluconate
• Dataset describing the genome wide effects on transcription resulting from alterations in the relative levels of the bZIP transcription factors Atf1 and Pcr1 in Schizosaccharomyces pombe
  Basu, Data in brief 2022
  • “...esterase/lipase SPBPB2B2.06c SPBPB2B2.06c extracellular 5-nucleotidase, human NT5E family SPAC15E1.02c SPAC15E1.02c DUF1761 family protein, conserved unknown SPAC1F8.01 ght3 plasma membrane gluconate:proton symporter Ght3 SPAC19G12.09 SPAC19G12.09 NADH/NADPH-dependent indole-3-acetaldehyde reductase, implicated in cellular detoxification SPAC4F10.20 grx1 glutaredoxin Grx1 SPBC56F2.15 tam13 Schizosaccharomyces specific protein, uncharacterized SPBC16E9.16c lsd90 Lsd90 protein SPBC21C3.19...”
  • “...meiosis-specific Smp foci lncRNA Sme2, long isoform SPAC4F10.20 grx1 glutaredoxin Grx1 SPAC22H10.13 zym1 metallothionein Zym1 SPAC1F8.01 ght3 plasma membrane gluconate:proton symporter Ght3 SPAC21E11.03c pcr1 DNA-binding transcription factor Pcr1 SPBC56F2.15 tam13 Schizosaccharomyces specific protein Tam13 SPCC1393.12 SPCC1393.12 Schizosaccharomyces specific protein, uncharacterized SPBC11C11.06c SPBC11C11.06c Schizosaccharomyces specific protein, uncharacterized...”
• The contribution of non-essential Schizosaccharomyces pombe genes to fitness in response to altered nutrient supply and target of rapamycin activity
  Lie, Open biology 2018
  • “...sensitive (G, P, A) SPAC1952.05 gcn5 SAGA complex histone acetyltransferase catalytic subunit Gcn5 sensitive (T) SPAC1F8.01 ght3 hexose transmembrane transporter Ght3 sensitive (T) SPCC1235.13 ght6 hexose transmembrane transporter Ght6 sensitive (A, T) SPAC12G12.12 gms2 UDP-galactose transmembrane transporter Gms2 (predicted) sensitive (T) SPAC30D11.06c hfl1 Lazarus1 family transmembrane...”
• A meiotic gene regulatory cascade driven by alternative fates for newly synthesized transcripts
  Cremona, Molecular biology of the cell 2011
  • “...12 2 rec8 SPBC29A10.14 4 Meiotic cohesin complex subunit 34.6 E 1 3 3 ght3 SPAC1F8.01 0 Hexose transporter 34.7 E 2 4 4 fbp1 SPBC1198.14c 0 Fructose-1,6-bisphosphatase 79.8 E 3 5 5 mei4 SPBC32H8.11 0 Meiotic forkhead transcription factor 54.9 M 4 5 6 SPAC1610.02c...”
  • “...N 168.90 0.63 268.31 242 N meu25 SPBC27.03 N 174.05 0.61 287.69 263 N ght3 SPAC1F8.01 N 119.55 0.35 341.57 312 N fbp1 SPBC1198.14c N 344.85 0.81 425.22 390 N mug125 SPAC1A6.08c N 239.25 0.65 451.15 418 N mug132 SPAC11G7.06c N 224.80 0.48 465.91 434 N...”
• Loss of the TOR kinase Tor2 mimics nitrogen starvation and activates the sexual development pathway in fission yeast
  Matsuo, Molecular and cellular biology 2007
  • “...SPCC777.04 SPBC25B2.02c SPAC1399.01c SPAC29B12.14c SPBPB2B2.01 SPBC359.01 SPAC1F8.01 SPCC965.06 Gene name 3160 MATSUO ET AL. MOL. CELL. BIOL. strictive...”

SPBC1348.14c hexose transporter Ght7 from Schizosaccharomyces pombe
40% identity, 78% coverage

• Dataset describing the genome wide effects on transcription resulting from alterations in the relative levels of the bZIP transcription factors Atf1 and Pcr1 in Schizosaccharomyces pombe
  Basu, Data in brief 2022
  • “...wall glucan 1,6-beta-glucosidase Exg1 SPAPB1E7.04c SPAPB1E7.04c chitinase SPSNORNA.32 sno12 box H/ACA small nucleolar RNA 12/snR99 SPBC1348.14c ght7 plasma membrane hexose transmembrane transporter Ght7 SPNCRNA.942 SPNCRNA.942 intergenic RNA (predicted) SPRRNA.02 rns small subunit (15S) rRNA, rns SPAC186.09 pdc102 pyruvate decarboxylase SPBPB2B2.08 SPBPB2B2.08 conserved fungal protein SPNCRNA.532 SPNCRNA.532...”
  • “...tlh1 RecQ type DNA helicase SPAC19G12.16c adg2 conserved fungal cell surface protein, Kre9/Knh1 family, Adg2 SPBC1348.14c ght7 plasma membrane hexose transmembrane transporter Ght7 SPAPB1E7.04c SPAPB1E7.04c chitinase SPBC1105.05 exg1 cell wall glucan 1,6-beta-glucosidase Exg1 SPRRNA.02 15S_rRNA small subunit (15S) rRNA, rns SPAC1039.11c gto1 alpha-glucosidase SPSNORNA.32 sno12 box...”
• High-throughput transcriptome sequencing and comparative analysis of Escherichia coli and Schizosaccharomyces pombe in respiratory and fermentative growth
  Vichi, PloS one 2021
  • “...not yet been assigned a function, such as SPBC32H8.15 and SPCC794.16, but others, such as SPBC1348.14c, encodes a high-affinity Ght7 permease involved in the introduction of hexose into cells, and SPAC1F8.02c which is involved in the transport of transmembrane iron during the cellular response to iron...”
• Expression profiling of S. pombe acetyltransferase mutants identifies redundant pathways of gene regulation
  Nugent, BMC genomics 2010
  • “...Log2 change p-value SPBC1348.09 1.89 3.69E-11 SPAC977.17 2.40 1.80E-08 map2 3.52 2.50E-12 SPAC22F8.05 1.90 0.001560473 SPBC1348.14c 2.41 2.14E-15 SPAPJ695.01c 3.52 2.00E-09 SPAC3C7.13c 1.92 3.23E-10 SPAC5H10.02c 2.46 3.89E-11 SPBC1198.01 3.55 7.19E-16 SPBPB2B2.06c 1.93 0.000987078 SPCC663.08c 2.54 0.009807792 SPAC22A12.17c 3.57 1.96E-11 SPBPB2B2.07c 1.93 9.41E-10 SPBC725.10 2.57 9.52E-05 SPAPB1A11.03...”

CNN00260 sugar transporter from Cryptococcus neoformans var. neoformans JEC21
37% identity, 85% coverage

• Comprehensive genome-scale metabolic model of the human pathogen Cryptococcus neoformans: A platform for understanding pathogen metabolism and identifying new drug targets
  Tezcan, Frontiers in bioinformatics 2023
  • “...CNC04680 Threonine aldolase THRA, THRA2 2 CNI03590 Phosphoenolpyruvate carboxykinase PPCK CNK00280 Phosphoglycerate mutase PGM 3 CNN00260 Sugar transporter GLCt1, GALt2 CNG01480 Hexose transport-related protein GLCt2, FRUt2, MANt2 4 CNJ01880 Ammonium transporter NH4t CNA02250 NH4t 5 CNF04620 Aminotran containing protein AATA3, PHETA1 CNB03180 AATA3, PHETA1 6 CNL06640...”

SJAG_02958 hexose transporter Ght5 from Schizosaccharomyces japonicus yFS275
40% identity, 79% coverage

• Molecular and comparative genomic analyses reveal evolutionarily conserved and unique features of the Schizosaccharomyces japonicus mycelial growth and the underlying genomic changes
  Papp, Current genetics 2021
  • “...HCBG_05286 SJAG_00674 Succinate-semialdehyde dehydrogenase orf19.4543 + HCBG_07054 SJAG_04085 Diphthamide biosynthesis protein orf19.4173 + HCBG_08193 + SJAG_02958 Hexose transporter Ght5 orf19.2023 + HCBG_04231 + SJAG_03606 Hexose transporter Ght6 orf19.2023 + HCBG_04231 + SJAG_02883 Potassium ion transporter Trk2 orf19.600 + HCBG_06373 + SJAG_05329 Anaphase-promoting complex subunit Apc1 orf19.6046...”

H6S33_000450 uncharacterized protein from Morchella sextelata
39% identity, 86% coverage

• Comparative Transcriptome Profiles of the Response of Mycelia of the Genus Morchella to Temperature Stress: An Examination of Potential Resistance Mechanisms
  Yue, Journal of fungi (Basel, Switzerland) 2024
  • “...module II were related to the catabolic process of glucose with putative MFS monosaccharide transporter (H6S33_000450), alpha/beta-hydrolase (H6S33_000895), glycoside hydrolase/deacetylase (H6S33_005331, H6S33_012593), and glyceraldehyde 3-phosphate dehydrogenase (H6S33_011274). Moreover, two cytochrome-related genes, H6S33_008973 and H6S33_007572, were identified. These results indicated that high culture temperatures accelerated the oxidative...”
  • “...carbon and nitrogen sources to meet metabolic requirements [ 45 ]. The MFS monosaccharide transporter H6S33_000450 was identified among the module I genes, which is consistent with the findings of previous reports showing that major facilitator superfamily (MFS) proteins are involved mainly in energy metabolism [...”

ght4 / RF|NP_595064.1 hexose transporter Ght4 from Schizosaccharomyces pombe (see paper)
SPBC1683.08 hexose transporter Ght4 (PMID 10735857) from Schizosaccharomyces pombe
36% identity, 85% coverage

• CharProtDB Source (per GeneDB): GeneDB_Spombe
• The Loz1 transcription factor from Schizosaccharomyces pombe binds to Loz1 response elements and represses gene expression when zinc is in excess
  Wilson, Molecular microbiology 2019
  • “...GGAAAATCCAA 1281 TGGCAATCCCC 1239 TGCAAATCGCC 1230 SPCC569.05c Spermidine family transporter 2.84 CGTAGATCATG 639 This study SPBC1683.08 ght4 Plasma membrane hexose:proton symporter 1.92 GGACGATCTCC 959 CGGAGATCGTC 980 TGAAGATCGAT 1056 SPAC4H3.01 DNAJ domain protein Caj1/Djp1 type 1.39 CGTCGATCATT 1321 TGCCGATCACT 1339 Carbohydrate metabolic processes SPAC977.16c dak2 Dihydroxyacetone kinase...”
• Interaction of Epe1 with the heterochromatin assembly pathway in Schizosaccharomyces pombe
  Isaac, Genetics 2007
  • “...from Chen et al. (2003). (SPBC1683.06c, SPBC1683.07, and SPBC1683.08) are upregulated during meiosis (Mata et al. 2002). These data suggest regional regulation...”

XP_042995203 uncharacterized protein from Ustilaginoidea virens
38% identity, 88% coverage

• The Identification, Characterization, and Functional Analysis of the Sugar Transporter Gene Family of the Rice False Smut Pathogen, Villosiclava virens
  Qin, International journal of molecular sciences 2024
  • “...59.40 12 Plasma membrane VvSTP31 XP_042995206 2 1605 534 7.07 59.58 12 Plasma membrane VvSTP32 XP_042995203 2 1608 535 8.55 58.13 12 Plasma membrane VvSTP33 XP_042999770 5 1560 519 6.27 56.75 12 Plasma membrane VvSTP34 XP_042998602 4 1674 557 7.97 61.46 12 Plasma membrane VvSTP35 XP_042999744...”

TC 2.A.1.1.109 / P42833 Hexose transporter HXT14 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (see 3 papers)
YNL318C Hxt14p from Saccharomyces cerevisiae
38% identity, 86% coverage

• substrates: Hexoses
• Yeast Double Transporter Gene Deletion Library for Identification of Xenobiotic Carriers in Low or High Throughput
  Almeida, mBio 2021
  • “...YLR237W, YML047C, YML116W, YML123C, YMR011W, YMR177W, YMR243C, YMR279C, YMR319C, YNL065W, YNL142W, YNL268W, YNL270C, YNL275W, YNL291C, YNL318C, YNR002C, YNR055C, YNR056C, YNR072W, YOL020W, YOL103W, YOL122C, YOL158C, YOR011W, YOR071C, YOR153W, YOR192C, YOR202W, YOR273C, YOR306C, YOR328W, YOR348C, YPL036W, YPL058C, YPL092W, YPL265W, YPL274W, YPR124W, YPR138C, YPR156C, YPR192W, YPR198W, and YPR201W (...”
• Improved Xylose Metabolism by a CYC8 Mutant of Saccharomyces cerevisiae
  Nijland, Applied and environmental microbiology 2017
  • “...YHR094C YJL214W YDL245C YJR158W YEL069C YFL011W YJL219W YOL156W YLR081W YNL318C Sum of all HXTs Sum of all genes Gene HXT2 HXT36 HXT7 HXT4 HXT5 HXT1 HXT8 HXT15...”
• The transcriptional repressor Sum1p counteracts Sir2p in regulation of the actin cytoskeleton, mitochondrial quality control and replicative lifespan in Saccharomyces cerevisiae
  Higuchi-Sanabria, Microbial cell (Graz, Austria) 2016
  • “...than 1000-fold overexpression of several previously uncharacterized open reading frames, such as YGl138c, YLR308W, and YNL318c . It is possible that these genes contribute to Sir2p-dependent and/or Sir2p-independent control of lifespan. Materials and Methods Yeast Growth Conditions Yeast cells were cultivated and manipulated as previously described...”
• Phylogenetic and Transcripts Profiling of Glucose Sensing Related Genes in Candida glabrata
  Ng, Jundishapur journal of microbiology 2015
  • “...YFL011W DAA12428 546 60.7 HXT11 YOL156W DAA10630 567 62.7 HXT13 YEL069C DAA07586 564 62.7 HXT14 YNL318C CAA96250 540 61.0 HXT15 YDL245C DAA11622 567 62.9 HXT16 YJR158W DAA08942 567 62.9 HXT17 YNR072W DAA10613 564 62.8 3.2. Phylogenetic Analysis The multiple sequence alignment of selected amino acid sequences...”
• RSC Chromatin-Remodeling Complex Is Important for Mitochondrial Function in Saccharomyces cerevisiae
  Imamura, PloS one 2015
  • “...space Cysteine motif protein YNL009W IDP3 -1.957974411 Isocitrate Dehydrogenase, NADP-specific YNL104C LEU4 -1.326612984 LEUcine biosynthesis YNL318C HXT14 -1.082656945 HeXose Transporter YOL045W PSK2 -1.053181566 Pas domain-containing Serine/threonine protein Kinase YPL091W GLR1 -1.926695216 Cytosolic and mitochondrial glutathione oxidoreductase Organigation YBR179C FZO1 -1.630212553 FuZzy Onions homolog YHR194W MDM31 -1.336269739...”
• Standing genetic variation drives repeatable experimental evolution in outcrossing populations of Saccharomyces cerevisiae
  Burke, Molecular biology and evolution 2014
  • “...in YBR184W, a histidine to arginine polymorphism in YNL318C, and a glycine to serine polymorphism in UFE1 (supplementary table S1, Supplementary Material...”
• Sum1 and Ndt80 proteins compete for binding to middle sporulation element sequences that control meiotic gene expression
  Pierce, Molecular and cellular biology 2003
  • “...SUM1 SD YHR091C YAL018C YGR059W YCL026C-A YDR522C YNL318C YLR307W YBL098W YLR343W YGL138C YFL012W YHR090C YOR365C YBR045C YLR232W YJL037W YDR523C YNL319W...”
• Optimizing pentose utilization in yeast: the need for novel tools and approaches
  Young, Biotechnology for biofuels 2010
  • “...TMB3201 - Saccharomyces cerevisiae HXT13 P39924 p4H7 [ 64 ] TMB3201 - Saccharomyces cerevisiae HXT14 P42833 p4H7 [ 64 ] TMB3201 - Saccharomyces cerevisiae HXT15 P54854 p4H7 [ 64 ] TMB3201 - Saccharomyces cerevisiae GAL2 P13181 pHL125 [ 64 ] TMB3201 + Several previous studies have...”
• Major facilitator superfamily
  Pao, Microbiology and molecular biology reviews : MMBR 1998
  • “...P32467 P38695 P39003 P39004 P40886 P43581 P40885 P39924 P42833 P47185 Z71687 P30605 X98622 P30606 S51081 P07921 P38156 P15685 P18631 X96876 Q10710 P38142 S58778...”

NCU05627 high affinity glucose transporter ght1 from Neurospora crassa OR74A
37% identity, 87% coverage

• The F-box protein gene exo-1 is a target for reverse engineering enzyme hypersecretion in filamentous fungi
  Gabriel, Proceedings of the National Academy of Sciences of the United States of America 2021 (secret)
• The regulatory and transcriptional landscape associated with carbon utilization in a filamentous fungus
  Wu, Proceedings of the National Academy of Sciences of the United States of America 2020
  • “...levels of growth on xylan ( 39 ), and pentose transporters xat-1 (NCU01132) and xyt-1 (NCU05627) ( 43 ) ( Fig. 5 ). CRE-1 binding peaks were not detected in the promoter of the major transcriptional regulator of xylan utilization, xlr-1 , although CRE-1 binding sites...”
  • “...NCU06026 (quinate permease), NCU05897 ( sut-28 ), NCU10021 ( hgt-1 ), NCU00821 (sugar transporter), and NCU05627 (high-affinity glucose transporter ght-1 ). The remaining set of 21 genes included a number of carbon metabolic enzymes and 5 genes encoding proteins of unknown function ( Dataset S5 )....”
• Control of Development, Secondary Metabolism and Light-Dependent Carotenoid Biosynthesis by the Velvet Complex of Neurospora crassa
  Bayram, Genetics 2019
  • “...process DNA catabolic process NCU09685 4.133 -- NCU01808 NCU05627 4.047 4.0174 -- Transmembrane transport proteins that are known to form complexes in order to...”
• Alternative Oxidase Transcription Factors AOD2 and AOD5 of Neurospora crassa Control the Expression of Genes Involved in Energy Production and Metabolism
  Qi, G3 (Bethesda, Md.) 2017
  • “...in the absence of AOD2 ( Figure 9D ), while two (NCU04899, malate dehydrogenase and NCU05627, a glucose transporter) showed decreased expression in the absence of either AOD2 or AOD5 ( Figure 9E ). One gene (NCU02623, mitochondrial hypoxia response) shows only increased expression in the...”
  • “...AOD5 + and Cm NCU04899 (malate dehydrogenase) 2+, 5+ N Na AOD5 + and Cm NCU05627 (high affinity glucose transporter 2+, 5+ N Na FN1/2+3/8+6/7 NCU05995 (ubiquitin) No effect Y Y FN3/8+4/5+6/7 NCU06211 (malate dehydrogenase) No effect Y Y FN1/2+3/8+6/7 NCU09144 (hypo) 5 N d Na...”
• A fungal transcription factor essential for starch degradation affects integration of carbon and nitrogen metabolism
  Xiong, PLoS genetics 2017
  • “...value less than 1e-20 identified 14 genes likely encoding transporters. Four of them, hgt-1 (NCU10021), NCU05627, NCU04963, and NCU04537 are annotated as sugar transporter genes ( Fig 2C ). hgt-1 shows high affinity glucose transport activity [ 19 ], while NCU05627 ( xyt-1 ) has xylose...”
• Transcriptional comparison of the filamentous fungus Neurospora crassa growing on three major monosaccharides D-glucose, D-xylose and L-arabinose
  Li, Biotechnology for biofuels 2014
  • “...here, including one glucose transporter GLT-1 (NCU01633) and two novel pentose transporters, XAT-1 (NCU01132), XYT-1 (NCU05627). One transcription factor associated with the regulation of hemicellulase genes, HCR-1 (NCU05064) was also characterized in the present study. Conclusions We conducted the first transcriptome analysis of Neurospora crassa grown...”
  • “...149.95 5.65 NCU04963 High-affinity glucose transporter 4.91 128.69 402.90 NCU04537 Monosaccharide transporter 1.06 3.35 410.00 NCU05627 High affinity glucose transporter ght1 4.47 48.96 244.36 NCU00450 Sucrose transporter 28.78 52.91 23.15 NCU00801 MFS lactose permease 6.10 25.15 24.96 NCU00988 MFS quinate transporter 0.18 47.98 0.86 NCU01494 MFS...”
• Identification of the CRE-1 cellulolytic regulon in Neurospora crassa
  Sun, PloS one 2011
  • “...Five additional genes in this set encoded predicted sugar transporters, (NCU01633, NCU04537, NCU10021, NCU00821, and NCU05627), one encoded a nucleoside transporter (NCU08148), several genes had annotation suggesting a role in alternative carbon source utilization (e.g. pyruvic acid), and 26 genes encoded putative or hypothetical proteins. No...”
• Systems biology of the qa gene cluster in Neurospora crassa
  Tang, PloS one 2011
  • “...is also the more gradual response of the qa-y and a putative carbohydrate metabolism gene (NCU05627). The pronounced delay in kinetic response to QA can be seen in the transcription factor (NCU03643) and a gene (NCU09873) encoding a phosphoenolpyruvate carboxykinase involved in glycolysis/glucanogenesis [51] . The...”
• More

MGG_00040 high-affinity glucose transporter ght2 from Pyricularia oryzae 70-15
37% identity, 86% coverage

• Diterpene Biosynthesis in Rice Blast Fungus Magnaporthe
  Shahi, Frontiers in fungal biology 2022
  • “...oxidases and/or cytochromes P450 (MGG_00023, MGG_00024 & MGG_00031), dehydrogenase (MGG_00017); transcription factor (MGG_00032), and transporter (MGG_00040) ( Supplementary Figure 9 ). The biochemical characterization also showed conservation of product formation [pimara-8(9), 15-diene] and functionality of MoDiTPS2 among M. oryzae pathotypes ( Supplementary Figure 5 ). These...”

CH_124310 high-affinity glucose transporter ght2 from Magnaporthe grisea 70-15 (see paper)
37% identity, 86% coverage

FGSG_05042, XP_011323525 hypothetical protein from Fusarium graminearum PH-1
36% identity, 87% coverage

• FgFAD12 Regulates Vegetative Growth, Pathogenicity and Linoleic Acid Biosynthesis in Fusarium graminearum
  Zhang, Journal of fungi (Basel, Switzerland) 2024
  • “...RNA-seq data, decreased expression levels of genes in the Fgfad12 mutant, including FGSG_02279, FGSG_04745 and FGSG_05042, played roles in plant infection [ 49 , 69 , 70 ]. The reduced expression of these genes may also contribute to defects of Fgfad12 mutant in plant infection. In...”
• lncRsp1, a long noncoding RNA, influences Fgsp1 expression and sexual reproduction in Fusarium graminearum
  Wang, Molecular plant pathology 2022
  • “...RESULTS 2.1 Identification of lncRsp1 and Fgsp1 Based on the sequence analysis of the fulllength FGSG_05042 mRNA, the open reading frame (ORF) was determined to encode a protein of 534 amino acids (GenBank accession no. XP_011323525). NCBI domain analysis indicated that the protein contains a sugar...”
  • “...frame (ORF) was determined to encode a protein of 534 amino acids (GenBank accession no. XP_011323525). NCBI domain analysis indicated that the protein contains a sugar transport domain and two MFS conserved domains. Therefore, FGSG_05042 was designated as Fgsp1 (Figure 1a ). Transmembrane domain prediction (...”

TC 2.A.1.1.68 / A3M0N3 The Glucose Transporter/Sensor Rgt2 from Pichia stipitis (see paper)
XP_001386588 glucose transporter/sensor from Scheffersomyces stipitis CBS 6054
37% identity, 86% coverage

• substrates: glucose
• Genetic basis of the highly efficient yeast Kluyveromyces marxianus: complete genome sequence and transcriptome analyses
  Lertwattanasakul, Biotechnology for biofuels 2015
  • “...Ps_XUT1, XP_001385583; Ps_XUT2, XP_001387242; Ps_XUT3, XP_001387138; Ps_XUT4, XP_001386715; Ps_XUT5, XP_001385962; Ps_XUT6, XP_001386589; Ps_XUT7, XP_001387067; Ps_RGT2, XP_001386588; Ps_SLT1, XP_001383774; Kl_KHT1/RAG1, XP_453656; Kl_KHT2, GN107317; Kl_KHT3, XP_454897; Kl_FRT1, XP_454356; Kl_HGT1, XP_451484; Kl_HXT1, XP_455078; Kl_HXT14, XP_454897; Kl_HXT2, XP_453960; Kl_HXT3, XP_453088; Sc_HXT4/LGT1, NP_011960; Kl_STL1, XP_456249; Kl_RAG4, XP_455315; Kl_LAC12, XP_452193; Ca_HXT6, XP_719472....”

CTRG_06249 hypothetical protein from Candida tropicalis MYA-3404
36% identity, 89% coverage

• Unveiling superior phenol detoxification and degradation ability in <i>Candida tropicalis</i> SHC-03: a comparative study with <i>Saccharomyces cerevisiae</i> BY4742
  Li, Frontiers in microbiology 2024
  • “...MFS transporter 1.40 CTRG_06081 MFS transporter 6.29 CTRG_05012 MFS transporter 2.11 CTRG_06100 MFS transporter 4.76 CTRG_06249 MFS transporter 1.65 CTRG_00968 MFS transporter 1.86 CTRG_05562 MFS transporter 6.56 CTRG_01806 MFS transporter 2.06 CTRG_04977 MFS transporter 1.38 CTRG_06212 peptide transporter PTR2 5.43 CTRG_01125 choline transport protein 2.42 CTRG_04615...”

TC 2.A.1.1.51 / Q2MEV7 Glucose/xylose: H+ symporter, Gsx1 from Candida intermedia (see paper)
GXS1 / CAI44932.1 glucose/xylose symporter 1 from [Candida] intermedia (see paper)
37% identity, 90% coverage

• substrates: H+, Xylose, glucose
• Advances in fungal sugar transporters: unlocking the potential of second-generation bioethanol production.
  Pereira, Applied microbiology and biotechnology 2025
  • “...C. intermedia Leandro et al. ( 2006 ); Young et al. ( 2011 ) GXS1 Q2MEV7 Glucose, xylose, galactose, fructose, mannose, and ribose C. intermedia Leandro et al. ( 2006 ); Young et al. ( 2011 ) XylHP Q64L87 Glucose, xylose, galactose, fructose, and mannose D....”
• Optimizing pentose utilization in yeast: the need for novel tools and approaches.
  Young, Biotechnology for biofuels 2010
  • “...TMB3201 - Candida intermedia Gxf1 Q2MDH1 YEplac195 [ 72 ] TMB3201 + Candida intermedia Gxs1 Q2MEV7 YEplac195 [ 72 ] TMB3201 + Chlorella kessleri Hup1 P15686 p4H7 [ 64 ] TMB3201 - Escherichia coli XylE P0AGF4 p4H7 [ 64 ] TMB3201 - Pichia stipitis SUT1 O94155...”

HGT12 potential sugar sensor or transporter from Candida albicans (see 4 papers)
XP_720385 Hgt12p from Candida albicans SC5314
Q8J2J7 Putative glucose sensor protein from Candida albicans
36% identity, 89% coverage

• CharProtDB CGD description: glucose, fructose, mannose transporter; major facilitator superfamily; role in macrophage-induced hyphal growth; detected at germ tube plasma membrane by mass spectrometry; Snf3p-induced; 12 probable transmembrane segments
• The Candida albicans gene HGT12 (orf19.7094) encodes a hexose transporter.
  Luo, FEMS immunology and medical microbiology 2007 (PubMed)
  • GeneRIF: The HGT12 gene encodes a fructose, glucose, and mannose transporter.
  • GeneRIF: The C. albicans gene HGT12, which is specifically expressed during macrophage infection, encodes a protein that transports fructose, glucose and mannose.
• Do mitochondria use efflux pumps to protect their ribosomes from antibiotics?
  Islam, Microbiology (Reading, England) 2023
  • “...ABC O42765, 7.8E^6 A0A1P8ATY7, 6.7E^12 Q8WW24, 1.4E^14 [ 79, 112 ] HXT13, NCU01633 Q1K4S3 MFS Q8J2J7, 2.1E^85 P23586, 1.2E^52 P11168, 2.6E^48 [ 79 ] NCU04809 Q756M6 MFS T2AWG3, 0.0014 Q8GYF4, 1.4E^24 B3KT41, 0.0022 [ 79 ] NCU09551 Q7S2B0 MFS G1UAY0, 2.3E^6 Q56ZZ7, 2.3E^7 Q8NBP5, 8.4E^9 [...”

AFUA_2G14590, Afu2g14590 MFS monosaccharide transporter, putative from Aspergillus fumigatus Af293
35% identity, 89% coverage

• Broad-spectrum antimicrobial activities of a food fermentate of Aspergillus oryzae
  Choi, Microbiology spectrum 2024
  • “...ABC multidrug transporter 1.38 AFUA_5G11980 MFS efflux transporter 1.33 AFUA_6G00440 Putative cation diffusion facilitator 1.27 AFUA_2G14590 Putative MFS monosaccharide transporter 1.16 AFUA_8G06760 Putative MFS transporter 1.09 DAN repair AFUA_3G12280 Translin Putative recombination hotspot-binding protein 1.43 AFUA_1G07000 Rad26 Putative DNA repair protein 1.13 AFUA_2G16260 Ase1 Putative microtubule-associated...”
• Expression profile analysis reveals that Aspergillus fumigatus but not Aspergillus niger makes type II epithelial lung cells less immunological alert
  Escobar, BMC genomics 2018
  • “...Aspni7|1,098,546 8.69 Up Afu1g15260 6.04 Up Aspni7|1,182,543 14.4 Up Afu1g15300 3.02 Up Aspni7|1,206,763 87.12 Up Afu2g14590 7.36 Up Aspni7|1,143,598 3.65 Up Afu2g15650 23.66 Up Aspni7|1,104,467 21.14 Up Afu3g07810 4.36 Up Aspni7|1,136,064 3.23 Up Afu4g03390 6.27 Up Aspni7|1,161,552 14.33 Up Afu4g12590 15.18 Up Aspni7|1,117,353 48.25 Up Afu4g12920...”
• Evolutionary Analysis of Sequence Divergence and Diversity of Duplicate Genes in Aspergillus fumigatus
  Yang, Evolutionary bioinformatics online 2012
  • “...2.24 [2.13, 1.11] Afu6g11610 2.61 [2.07, 0.63] Afu1g00310 2.26 [1.61, 0.07] Afu3g07160 2.51 [2.18, 0.85] Afu2g14590 2.26 [2.17, 1.13] Afu2g02110 2.53 [1.87, 0.19] Afu7g06400 2.29 [2.16, 1.08] Afu8g05910 2.38 [2.08, 0.87] Afu3g03080 2.29 [2.12, 1.05] Afu6g14540 2.57 [2.12, 0.76] Afu1g11560 2.34 [2.15, 1.04] Afu3g14820 4.04 [1.80,...”
• Dual organism transcriptomics of airway epithelial cells interacting with conidia of Aspergillus fumigatus
  Oosthuizen, PloS one 2011
  • “...PkaR 2.62E-02 1.76 Afu4g12950 PX domain protein 2.74E-02 2.11 Afu2g11900 pyruvate dehydrogenase kinase 2.87E-02 2.45 Afu2g14590 MFS monosaccharide transporter, putative 3.05E-02 1.98 Afu3g00900 alpha-amylase AmyA 3.80E-02 1.62 Afu6g03730 prpd protein 4.08E-02 1.58 A general concordance was found between our microarray data and RT-qPCR data ( Figure...”

PDIP_03090 MFS monosaccharide transporter, putative from Penicillium digitatum
36% identity, 89% coverage

• Transcriptome Analysis of mfs2-Defective Penicillium digitatum Mutant to Reveal Importance of Pdmfs2 in Developing Fungal Prochloraz Resistance
  Cuan, Microorganisms 2024
  • “...1.04 / MFS23 (PDIP_36610) / / 2.72 2.50 MFS24 (PDIP_40610) / / 1.77 / MFS25 (PDIP_03090) 1.71 1.07 1.38 / MFS26 (PDIP_64100) / / 1.53 1.42 MFS27 (PDIP_55370) / / 1.22 1.47 MFS28 (PDIP_70440) / / 1.26 / MFS29 (PDIP_67290) / / 1.13 / MFS30 (PDIP_09580)...”

NCU04963 high-affinity glucose transporter from Neurospora crassa OR74A
Q7S3Q4 High-affinity glucose transporter from Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
37% identity, 86% coverage

• Revisiting 2-Deoxyglucose Resistance in Neurospora crassa: Insights into Transcriptional Regulation of Hexose Transporters, Sugar Metabolism and Possible Modulation by Mating Type
  Pandey, 2023
• The F-box protein gene exo-1 is a target for reverse engineering enzyme hypersecretion in filamentous fungi
  Gabriel, Proceedings of the National Academy of Sciences of the United States of America 2021 (secret)
• Evaluating the circadian rhythm and response to glucose addition in dispersed growth cultures of Neurospora crassa
  Kelliher, Fungal biology 2020
  • “...components of System I: glt-1 (NCU01633), and of System II: hgt-1 and hgt-2 (NCU10021 and NCU04963) ( Wang et al., 2017 ). The K m values for all three transporters fall within the ranges of earlier work ( Wang et al., 2017 ). Gene expression levels...”
  • “...and high affinity (Km 0.1 mM) glucose transporters in low environmental glucose concentrations. Interestingly, hgt-2 (NCU04963) is reported to be a clock-controlled gene from fungal discs cultured in Bird 1.8% glucose ( Hurley et al., 2014 ). Single knockouts of hgt-2 (FGSC18806) or hgt-1 (FGSC22818) have...”
• The regulatory and transcriptional landscape associated with carbon utilization in a filamentous fungus
  Wu, Proceedings of the National Academy of Sciences of the United States of America 2020
  • “...relative to WT were bound by CRE-1. These MFS sugar transporters included NCU04537 (monosaccharide transporter), NCU04963 (high-affinity glucose transporter), NCU06026 (quinate permease), NCU05897 ( sut-28 ), NCU10021 ( hgt-1 ), NCU00821 (sugar transporter), and NCU05627 (high-affinity glucose transporter ght-1 ). The remaining set of 21 genes...”
• Deletion of the middle region of the transcription factor ClrB in Penicillium oxalicum enables cellulase production in the presence of glucose
  Gao, The Journal of biological chemistry 2019 (secret)
• A fungal transcription factor essential for starch degradation affects integration of carbon and nitrogen metabolism
  Xiong, PLoS genetics 2017
  • “...less than 1e-20 identified 14 genes likely encoding transporters. Four of them, hgt-1 (NCU10021), NCU05627, NCU04963, and NCU04537 are annotated as sugar transporter genes ( Fig 2C ). hgt-1 shows high affinity glucose transport activity [ 19 ], while NCU05627 ( xyt-1 ) has xylose transporting...”
  • “..., the starch-active LPMO (NCU08746), gh13-6 and 19 transporter genes including hgt-1 , xyt-1 , NCU04963, and NCU04537 ( Fig 3C ). Seventeen TF genes in the starch regulon were also down regulated in the col-26 mutant, including tah-1 , tah-3 , vad-2 , ada-5 ,...”
• Identification and characterization of the glucose dual-affinity transport system in Neurospora crassa: pleiotropic roles in nutrient transport, signaling, and carbon catabolite repression
  Wang, Biotechnology for biofuels 2017
  • “...crassa . One low-affinity glucose transporter, GLT-1 (NCU01633), and two high-affinity transporters, HGT-1/-2 (NCU10021 and NCU04963), were identified as the major components of systems I and II, respectively. Simultaneous deletion of hgt - 1/ - 2 (strain 2hgt ) resulted in a notable increase in cellulolytic...”
  • “...putative sucrose transporter NCU00450, the high-affinity glucose transporter hgt - 1 [ 40 ], and NCU04963 (designated as high-affinity glucose transporter hgt - 2 ; see the next paragraph). The glucose transporter glt - 1 was the only transporter that was constantly expressed on high glucose...”
• Understanding the Role of the Master Regulator XYR1 in Trichoderma reesei by Global Transcriptional Analysis
  Dos, Frontiers in microbiology 2016
  • “...from T. reesei and other species ( Saccharomyces cerevisiae YHR094C, YHR092C, YDR343C; Neurospora crassa NCU00821, NCU04963, NCU08114, NCU10021; Aspergillus nidulans AN3199, AN6831; Aspergillus oryzae AO090103000130, AO090038000233; Aspergillus niger XP_001397059.2; Escherichia coli YP006127731.1; Metarhizium anisopliae GQ167043.1, EFY97396.1, EFY94560.1; Talaromyces marneffei XP002152585.1; Talaromyces stipitatus XP002484658.1; Candida albicans 19.13383,...”
• More
• Advances in fungal sugar transporters: unlocking the potential of second-generation bioethanol production
  Pereira, Applied microbiology and biotechnology 2025
  • “...( 2020 ) HGT-1 Q7S0I5 Glucose N. crassa Wang et al. ( 2017a ) HGT-2 Q7S3Q4 Glucose N. crassa Wang et al. ( 2017a ) GLT-1 Q1K4S3 Glucose and xylose N. crassa Li et al. ( 2014 ); Wang et al. ( 2017a ) NCU00809 Q7SEC5...”

XP_449525 hypothetical protein from Candida glabrata CBS 138
35% identity, 91% coverage

• Phylogenetic and Transcripts Profiling of Glucose Sensing Related Genes in Candida glabrata
  Ng, Jundishapur journal of microbiology 2015
  • “...XP_445530 564 62.4 HXT2/10 CAGL0D02640 XP_445530 564 62.4 HXT2/10 CAGL0I00286 XP_447265 555 61.7 HXT14 CAGL0M04103 XP_449525 531 59.0 Table 2. Details of Glucose Sensing-Related Genes of Saccharomyces cerevisiae Target Gene Name Systematic Name Accession Number No. of Amino Acids Molecular Mass, kDa SNF3 YDL194W CAA98771 884...”

Q6CCJ1 YALI0C08943p from Yarrowia lipolytica (strain CLIB 122 / E 150)
36% identity, 83% coverage

• Functional survey for heterologous sugar transport proteins, using Saccharomyces cerevisiae as a host
  Young, Applied and environmental microbiology 2011
  • “...calculated using a solution algo- 3313 Q6C2L7 Q6CCU6 Q6CCJ1 YALI0C06424 YALI0C08943 A3GHF2 XUT7 YALI0F06776 A3M0N4 XUT6 Q6CFJ6 A3LY79 XUT5 Q6CG30 A3M0B9 XUT4...”

XP_006966515 uncharacterized protein from Trichoderma reesei QM6a
G0RN44 Predicted protein from Hypocrea jecorina (strain QM6a)
35% identity, 89% coverage

• Key amino acid residues govern the substrate selectivity of the transporter Xltr1p from <i>Trichoderma reesei</i> for glucose, mannose, and galactose
  Ma, Engineering microbiology 2024
  • “...unless otherwise noted. 2.2 Gene constructs and site-directed mutagenesis The gene encoding Xltr1p (GenBank ID: XP_006966515) was amplified from T. reesei QM6a (ATCC 13631) using primers harboring homologous arms and ligated into the pJFE3 vector to obtain the recombinant plasmid pJFE3-Xltr1p. Mutants were generated using a...”
  • “...reesei , XP_006967659.1; Tr Str3 from Trichoderma reesei , EGR49690.1; Xltr1p from Trichoderma reesei , XP_006966515.1; Sc GAL2 from saccharomyces cerevisiae , NP_013182.1). (B) Prediction of the evolutionary conservation of Xltr1p amino acid sequences using Consurf ( https://predictprotein.org/ ). Fig. 1 Fig. 2 Substrateprotein docking analyses....”
• Advances in fungal sugar transporters: unlocking the potential of second-generation bioethanol production.
  Pereira, Applied microbiology and biotechnology 2025
  • “...) Xlt1 A0A024SJF7 Xylose and L-arabinose T. reesei Havukainen et al. ( 2021a ) Xltr1 G0RN44 Glucose, mannose, fructose, and xylose T. reesei Jiang et al. ( 2020 ) Mfs A0A024S949 Cellobiose, lactose, galactose, and mannose T. reesei Wang et al. ( 2022a ) Gst A0A024S5D9...”

An15g03940, XP_001396930 uncharacterized protein from Aspergillus niger
35% identity, 88% coverage

• Advances in fungal sugar transporters: unlocking the potential of second-generation bioethanol production
  Pereira, Applied microbiology and biotechnology 2025
  • “...XP_025453682 Glucose, galactose, mannose, and sucrose A. niger Sloothaak et al. ( 2015 ) MstH XP_001396930 Glucose, fructose, galactose, mannose, and sucrose A. niger Sloothaak et al. ( 2015 ) XltA XP_026623817 Glucose, xylose, galactose, and mannose A. niger Sloothaak et al. ( 2016b ) MstC/HxtB...”
• ERV14 receptor impacts mycelial growth via its interactions with cell wall synthase and transporters in Aspergillus niger
  Zheng, Frontiers in microbiology 2023
  • “...screening. Family Protein accession Gene ID Description MFS family CAK47634 An02g03540 Fructose transmembrane transporter CAK97262 An15g03940 Monosaccharide transporter CAK37108 An01g07860 Sulfate transmembrane transporter ABC family CAK43073 An17g01770 ATPase-coupled transmembrane transporter F-ATPase family CAK37765 An02g08020 H + -transporting ATPase lipid-binding protein P-ATPase family CAK41966 An14g02290 ATPase-coupled cation...”
• Evaluation of Aspergillus niger Six Constitutive Strong Promoters by Fluorescent-Auxotrophic Selection Coupled with Flow Cytometry: A Case for Citric Acid Production
  Lu, Journal of fungi (Basel, Switzerland) 2022
  • “...glucose uptake, and glycolysis, such as amyA (An12g06930), glaA (An03g06550), mstC (An02g03540), mstG (An05g01290), mstH (An15g03940), pfkB (An07g02100), and ppcA (An11g02550) ( Table 2 ). As to intracellular citrate transportation, mitochondrial citrate/malate carrier protein CtpA (An11g11230) was also synergistically upregulated ( Table 2 ). Meanwhile, with...”
  • “...affinity glucose transporter 1.25 1.58 1.26 An05g01290 mstG High affinity glucose transporter 1.25 1.39 1.11 An15g03940 mstH High affinity glucose transporter 2.73 5.75 2.11 An04g06910 amyR Transcription factor 2.35 2.59 1.10 An08g02260 pgkA Phosphoglycerate kinase 1.32 1.37 1.04 An11g02550 ppcA Phosphoenolpyruvate carboxykinase 2.57 4.30 1.67 An07g02100...”
• In Silico Analysis of Putative Sugar Transporter Genes in Aspergillus niger Using Phylogeny and Comparative Transcriptomics
  Peng, Frontiers in microbiology 2018
  • “...sensors Rgt2 and Snf3 ( Gancedo, 2008 ), which cluster together with A. niger mstH (An15g03940). This gene is a homolog of A. nidulans HxtB ( Dos Reis et al., 2013 ), which has been suggested to be a low affinity glucose transporter that is involved...”
• The amyR-deletion strain of Aspergillus niger CICC2462 is a suitable host strain to express secreted protein with a low background
  Zhang, Microbial cell factories 2016
  • “...110.6 3.27 5.08 2.14E285 Serine-type Carboxypeptidase F An08g04490 215.81 17.92 3.59 0 Endoprotease Sugar transporter An15g03940 1891.82 158.73 3.58 0 Glucose transporter rco-3 An12g07450 372.55 6.95 5.74 0 Sugar transporter An01g00850 117.57 2.28 5.69 0 Sugar transporter An02g00590 258.7 14.23 4.18 0 Sugar transporter Table6 Positions...”
  • “...None None None None aspartic endopeptidase (AP1) An07g08030 None None None None Serine-type carboxypeptidase F An15g03940 554 to 567 None None None Glucose transporter rco-3 An12g07450 None None 702 to 715 885 to 898 867 to 880 Sugar transporter An01g00850 None None 758 to 771 None...”
• Metabolic activity in dormant conidia of Aspergillus niger and developmental changes during conidial outgrowth
  Novodvorska, Fungal genetics and biology : FG & B 2016
  • “...encoding putative glucose/hexose transporters ( Pel et al., 2007 ) transcription of 5 genes (An02g03540, An15g03940, An05g01290, An16g08940, An02g01270) was highly upregulated at T1. The most upregulated was the homolog of A. nidulans mstE , (An02g03540) encoding a low affinity glucose transporter. Transcription of mstA encoding...”
  • “...An01g09290 85.1 17.6 Neutral trehalase, treB a An02g03540 15.8 489.9 Low affinity glucose transporter, mstE An15g03940 4.0 336.7 Monosaccharide transporter An05g01290 2.8 324.2 Monosaccharide transporter An16g08940 5.1 118.8 Monosaccharide transporter An02g01270 1.6 25.8 Monosaccharide transporter An12g07450 1.6 9.5 High affinity sugar/H+symporter, mstA An02g01560 0.1 1.4 GPCR...”
• Genome-wide expression analysis upon constitutive activation of the HacA bZIP transcription factor in Aspergillus niger reveals a coordinated cellular response to counteract ER stress
  Carvalho, BMC genomics 2012
  • “...uptake An02g03540 mstC strong similarity to hexose transport protein HXT3 S. cerevisiae 2 2 2 An15g03940 strong similarity to monosaccharide transporter Mst-1 A. muscaria 2.5 2 1.7 An09g04810 strong similarity to high affinity glucose transporter HGT1 - K. lactis 5 10 10 An11g01100 strong similarity to...”
• Identification of InuR, a new Zn(II)2Cys6 transcriptional activator involved in the regulation of inulinolytic genes in Aspergillus niger
  Yuan, Molecular genetics and genomics : MGG 2008
  • “...dependent on InuR. Genome-wide expression analysis revealed, three additional putative sugar transporters encoding genes (An15g04060, An15g03940 and An17g01710), which were strongly induced by sucrose in an InuR dependent way. In silico analysis of the promoter sequences of strongly InuR regulated genes suggests that InuR might bind...”
  • “...the seven sucrose induced InuR dependant genes: An12g08280 (InuE), An11g03200 (InuA), An08g11070 (SucA), An15g04060, An15g00310, An15g03940, and An17g01710 were obtained from the CBS513.88 strain. The 1.0kb promoter regions were analyzed on both strands using DNA Analyzer module of Phylosopher 6.5.1 (Genedata A.G., Basel, Switzerland) using the...”
• More

SS1G_05456 hypothetical protein from Sclerotinia sclerotiorum 1980 UF-70
34% identity, 89% coverage

• Exploring the Symbiotic Mechanism of a Virus-Mediated Endophytic Fungus in Its Host by Dual Unique Molecular Identifier-RNA Sequencing
  Qu, mSystems 2021
  • “...rapeseed SWEET11 gene ( BnaA06g16330D ) and two upregulated S. sclerotiorum glucose transporter genes ( SS1G_05456 , SS1G_08425 ). For rice, OsSWEET11 could be induced by Xanthomonas oryzae and led to glucose efflux. Then, X. oryzae could take up glucose and multiply ( 52 ). Although...”

Pc12g02080 uncharacterized protein from Penicillium rubens
36% identity, 86% coverage

• Functional characterization of a Penicillium chrysogenum mutanase gene induced upon co-cultivation with Bacillus subtilis
  Bajaj, BMC microbiology 2014
  • “...HGT1 . (Pc18g00150; Pc21g19660; Pc22g09740 and Pc21g19770) and the glucose transporter rco-3 from Neurospora crassa (Pc12g02080) were found in this cluster (Additional file 1 : Table S1). Transcriptional responses of P. chrysogenum genes involved in secondary metabolite production to co-cultivation with B. subtilis P. chrysogenum is...”

SS1G_06023 hypothetical protein from Sclerotinia sclerotiorum 1980 UF-70
35% identity, 86% coverage

• Changes in the Sclerotinia sclerotiorum transcriptome during infection of Brassica napus
  Seifbarghi, BMC genomics 2017
  • “...- 2.1 - 2.5 2.4 SS1G_09710 MFS sugar transporter - - 2.7 2.6 4.8 6.5 SS1G_06023 MFS monosaccharide transporter 6.9 6.7 7.0 4.9 - - SS1G_10125 MFS monosaccharide transporter 2.1 2.4 - - - - SS1G_06620 MFS monosaccharide transporter - - - - 2.4 - SS1G_07618...”

Q6BTD8 DEHA2D01474p from Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
33% identity, 91% coverage

• Functional survey for heterologous sugar transport proteins, using Saccharomyces cerevisiae as a host
  Young, Applied and environmental microbiology 2011
  • “...stipitis B5RSN0 DEHA2A14300 P0AGF4 Q6BW54 DEHA2B14278 xylE Q6BTD8 Q2MEV7 GXS1 DEHA0D02167 Q2MDH1 Q6AWX0 At5g17010 GXF1 Q0WWW9 P22144 At5g59250 P31867 XYL2...”

CNAG_03438 hexose transporter from Cryptococcus neoformans var. grubii H99
31% identity, 88% coverage

• Comparative Ecology of Capsular Exophiala Species Causing Disseminated Infection in Humans
  Song, Frontiers in microbiology 2017
  • “...et al., 2002 PV08_06497T0 HMPREF1120_06227T0 CNAG_03322 UXS1 Xylosolation defect Moyrand et al., 2002 N/A N/A CNAG_03438 HXT1 Hyper Chikamori and Fukushima, 2005 N/A N/A CNAG_03582 RIM20 Hypo Meara et al., 2010b PV08_05544T0 HMPREF1120_02658T0 CNAG_03670 IRE1 Hypo Cheon et al., 2011 PV08_04820T0 HMPREF1120_00610T0 CNAG_03818 SSK1 Hyper Bahn...”
• The glucose sensor-like protein Hxs1 is a high-affinity glucose transporter and required for virulence in Cryptococcus neoformans
  Liu, PloS one 2013
  • “...and investigated their expressions under different glucose conditions. Our qRT-PCR results showed that two gene (CNAG_03438, HXT1; CNAG_04920, HXT5 ) were induced by both low and high glucose concentrations, with a significantly higher induction in HXT1 . Meanwhile, HXT2 (CNAG_06290) was induced only by the high...”
• The transcriptional response of Cryptococcus neoformans to ingestion by Acanthamoeba castellanii and macrophages provides insights into the evolutionary adaptation to the mammalian host
  Derengowski, Eukaryotic cell 2013
  • “...CNAG_05929 CNAG_02288 CNAG_07367 CNAG_04795 CNAG_07387 CNAG_03438 Sugar transporter Sugar transporter bodown198 Sugar transporter Glucose transporter...”
• The Cryptococcus neoformans capsule: a sword and a shield
  O'Meara, Clinical microbiology reviews 2012
  • “...Cpl1 Capsule-associated protein Uge1 CNAG_03158 CNAG_03322 CNAG_03438 Cmt1 Uxs1 Hxt1 CNAG_03644 Cas3 CNAG_03695 Cas41 CNAG_03735 Cap4 CNAG_04312 CNAG_04320...”
• Toward an integrated model of capsule regulation in Cryptococcus neoformans
  Haynes, PLoS pathogens 2011
  • “...0.81 0.56 Capsule CNAG_03644 CAS3 Cas3 4.21 7.69 CNAG_05264 NSTA YJL216C alpha-amylase AmyA 2.06 1.97 CNAG_03438 HXT1 HXT2 hexose transporter 1.15 1.35 CNAG_02797 CPL1 pria protein 1.01 0.65 CNAG_07937 CAS1 O-acetyltransferase 0.60 0.41 CNAG_04312 MAN1 PMI40 mannose-6-phosphate isomerase 0.57 0.28 CNAG_07554 CAP10 capsule associated protein 0.43...”

ECDD_ASPRU / K0E3U9 Major facilitator-type transporter ecdD from Aspergillus rugulosus (Emericella rugulosa) (see paper)
34% identity, 89% coverage

K9H0P1 MFS monosaccharide transporter, putative from Penicillium digitatum (strain Pd1 / CECT 20795)
35% identity, 86% coverage

• Deciphering Molecular Determinants Underlying Penicillium digitatum's Response to Biological and Chemical Antifungal Agents by Tandem Mass Tag (TMT)-Based High-Resolution LC-MS/MS
  Citores, International journal of molecular sciences 2022
  • “...resistance were downregulated following treatments with -sarcin and BE27 such as the MFS transporter (AC: K9H0P1). Another transporter involved in zinc homeostasis (i.e., the ZIP Zinc transporter, AC: K9FYG6) was only downregulated upon BE27 treatment as well as the Antifungal protein AFP (AC: K9FGI7), a small...”
  • “...1.18 23 3 9 K9F4E2 ZIP Zinc transporter, putative 0.7 0.63 0.69 7 3 5 K9H0P1 MFS monosaccharide transporter, putative 0.66 0.64 0.71 5 3 10 K9FBR5 SurE domain-containing protein 0.62 0.74 1.12 26 6 20...”

NCU08180 high-affinity glucose transporter from Neurospora crassa OR74A
35% identity, 76% coverage

• Correlating sugar transporter expression and activities to identify transporters for an orphan sugar substrate
  Tamayo, Applied microbiology and biotechnology 2024
  • “...(AN25), while others are weakly expressed in all the induction conditions, such as NCU07054 and NCU08180 , suggesting a minor role under the tested conditions. Moreover, most genes (70%) are clearly downregulated in the presence of sucrose, indicating a repression by CCR. Some exceptions include the...”
• Transcriptional comparison of the filamentous fungus Neurospora crassa growing on three major monosaccharides D-glucose, D-xylose and L-arabinose
  Li, Biotechnology for biofuels 2014
  • “...23.97 NCU07861 Maltose transporter 0.54 1.05 0.67 NCU08152 High affinity glucose transporter 0.05 0.71 0.09 NCU08180 High-affinity glucose transporter 0.00 0.01 0.00 NCU08858 MFS alpha-glucoside transporter 24.76 36.86 37.86 NCU09321 Sucrose transporter 33.00 37.66 35.30 NCU09358 Hexose carrier protein 0.27 15.90 0.77 NCU11342 MFS hexose transporter...”

XP_042994564 uncharacterized protein from Ustilaginoidea virens
34% identity, 84% coverage

• The Identification, Characterization, and Functional Analysis of the Sugar Transporter Gene Family of the Rice False Smut Pathogen, Villosiclava virens
  Qin, International journal of molecular sciences 2024
  • “...75.55 12 Plasma membrane VvSTP6 XP_042994673 1 1899 632 8.76 70.19 12 Plasma membrane VvSTP7 XP_042994564 1 1761 586 7.01 62.84 12 Plasma membrane VvSTP8 XP_042996797 3 1584 527 9.22 57.39 12 Plasma membrane VvSTP9 XP_042998161 4 1656 551 6.98 60.17 12 Plasma membrane VvSTP10 XP_042994317...”

CNM02570 receptor from Cryptococcus neoformans var. neoformans JEC21
33% identity, 86% coverage

• Comparative hybridization reveals extensive genome variation in the AIDS-associated pathogen Cryptococcus neoformans
  Hu, Genome biology 2008
  • “...and CNM02600, were conserved in all of the strains (H99, Bt63, 125.91, and CBS7779). However, CNM02570, which encodes a putative receptor protein near to the telomere, was present in H99, Bt63, CBS7779, and WM626, but not in 125.91. Kavanaugh and coworkers [ 61 ] found that...”

FGSG_02641 hypothetical protein from Fusarium graminearum PH-1
33% identity, 89% coverage

• The adaptation of Fusarium culmorum to DMI Fungicides Is Mediated by Major Transcriptome Modifications in Response to Azole Fungicide, Including the Overexpression of a PDR Transporter (FcABC1)
  Hellin, Frontiers in microbiology 2018
  • “...Hypothetical protein 5.66 0.007 FCUL_06717 FgramPH1_01t15627 FGSG_04580 ATP binding cassette transporter 5.05 <0.001 FCUL_03752 FgramPH1_01t06339 FGSG_02641 Glucose transporter rco-3 4.7 0.004 FCUL_06619 FgramPH1_01t15371 FGSG_12251 Hypothetical protein 4.65 0.01 FCUL_11936 FgramPH1_01t06405 FGSG_02672 Ent-kaurene oxidase 4.59 <0.001 FCUL_05234 FgramPH1_01t12209 FGSG_03164 Hypothetical protein 4.26 <0.001 FCUL_09162 FgramPH1_01t21537 FGSG_11228 GMC...”

CNG01480 hexose transport-related protein from Cryptococcus neoformans var. neoformans JEC21
30% identity, 88% coverage

• Comprehensive genome-scale metabolic model of the human pathogen Cryptococcus neoformans: A platform for understanding pathogen metabolism and identifying new drug targets
  Tezcan, Frontiers in bioinformatics 2023
  • “...2 CNI03590 Phosphoenolpyruvate carboxykinase PPCK CNK00280 Phosphoglycerate mutase PGM 3 CNN00260 Sugar transporter GLCt1, GALt2 CNG01480 Hexose transport-related protein GLCt2, FRUt2, MANt2 4 CNJ01880 Ammonium transporter NH4t CNA02250 NH4t 5 CNF04620 Aminotran containing protein AATA3, PHETA1 CNB03180 AATA3, PHETA1 6 CNL06640 Phospho-2-dehydro-3-deoxyheptonate aldolase DDPA, DDPAm CND05120...”
• ALL2, a Homologue of ALL1, Has a Distinct Role in Regulating pH Homeostasis in the Pathogen Cryptococcus neoformans
  Jain, Infection and immunity 2016
  • “...CNC04510 CNG04630 CNJ01450 CNE01880 CNF01220 CNF00350 CNG01480 CNC03220 CNI03490 CNC01890 CNE05340 Sugar transporter Folic acid metabolism Sugar transporter...”

TC 2.A.1.1.117 / G4N740 Glucose transporter Rco-3 or MoST1. MoST1 plays a specific role in conidiation and mycelial melanization which is not shared by other hexose transporter family members in M. oryzae from Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
XP_003716272 glucose transporter rco-3 from Pyricularia oryzae 70-15
35% identity, 89% coverage

• substrates: glucose
• MoST1 encoding a hexose transporter-like protein is involved in both conidiation and mycelial melanization of Magnaporthe oryzae.
  Saitoh, FEMS microbiology letters 2014 (PubMed)
  • GeneRIF: MoST1 (MGG_03620) is involved in both conidiation and mycelial melanization.

Q6CCU6 YALI0C06424p from Yarrowia lipolytica (strain CLIB 122 / E 150)
35% identity, 89% coverage

• Functional survey for heterologous sugar transport proteins, using Saccharomyces cerevisiae as a host
  Young, Applied and environmental microbiology 2011
  • “...were calculated using a solution algo- 3313 Q6C2L7 Q6CCU6 Q6CCJ1 YALI0C06424 YALI0C08943 A3GHF2 XUT7 YALI0F06776 A3M0N4 XUT6 Q6CFJ6 A3LY79 XUT5 Q6CG30 A3M0B9...”

AO090003001556 No description from Aspergillus oryzae RIB40
35% identity, 89% coverage

• Comprehensive annotation of secondary metabolite biosynthetic genes and gene clusters of Aspergillus nidulans, A. fumigatus, A. niger and A. oryzae
  Inglis, BMC microbiology 2013
  • “...AO090003001097 cluster AO090003001097 - AO090003001090 - AO090003001106 AO090003001094 - AO090003001099 ECS ECS AO090003001545 cluster AO090003001545 AO090003001556 - AO090003001541 AO090003001552 - AO090003001535 AO090003001556 - AO090003001537 ECS ECS AO090005000688 cluster AO090005000688 AO090005000688 - AO090005000693 AO090005000681 - AO090005000696 AO090005000687 - AO090005000695 FA ECS AO090005000798 cluster AO090005000798 - AO090005000791 -...”

METBIDRAFT_79721 general substrate transporter from Metschnikowia bicuspidata var. bicuspidata NRRL YB-4993
36% identity, 87% coverage

• Potential Strategies Applied by <i>Metschnikowia bicuspidata</i> to Survive the Immunity of Its Crustacean Hosts
  Zhang, Pathogens (Basel, Switzerland) 2025
  • “...acid transportation ( METBIDRAFT_70890 and METBIDRAFT_75879 ), transportation by major facilitator-type transporters ( METBIDRAFT_76181 and METBIDRAFT_79721 ), and others ( Table 1 ). Interestingly, the expression of METBIDRAFT_33390 , whose product is a transcriptional regulator homologous with the one mediating cell adherence in C. albicans ,...”
  • “...Multidrug resistance protein 1 METBIDRAFT_76577 2.92 0.000122001 Sugar (and other) transporter High-affinity glucose transporter HXT2 METBIDRAFT_79721 2.80 0.000389761 Sugar (and other) transporter Major facilitator-type transporter ecdD METBIDRAFT_79129 2.78 0.000217936 GPR1/FUN34/yaaH family Accumulation of dyads protein 2 METBIDRAFT_33390 2.73 0.000286938 Zinc finger, C2H2 type Transcriptional regulator of...”

CNBG_9639 uncharacterized protein from Cryptococcus deuterogattii R265
33% identity, 86% coverage

• Copy number variation contributes to cryptic genetic variation in outbreak lineages of Cryptococcus gattii from the North American Pacific Northwest
  Steenwyk, BMC genomics 2016
  • “...VGIIa isolates retain a single copy, while VGIIb and VGIIc isolates have experienced deletions ( CNBG_9639 , CNBG_2482 , CNBG_4491 , CNBG_2944 ) (Additional file 3 ). Functional analysis of CNV genes We performed enrichment analysis of genes overlapping CNVs to broadly characterize their functional associations....”

Pc21g21590 uncharacterized protein from Penicillium rubens
34% identity, 89% coverage

• Penicillin production in industrial strain Penicillium chrysogenum P2niaD18 is not dependent on the copy number of biosynthesis genes
  Ziemons, BMC biotechnology 2017
  • “...I. After PFGE, Southern analysis with four different probes ( adh-like (Pc21g21650), pcbC (Pc21g21380), rco3 (Pc21g21590), and exo84 (Pc21g21980)) revealed several differences (Fig. 1B, C ). For example, after restriction with both Pme I and Pac I, an additional signal with a size of about 97kb...”

AFUA_4G00800, Afu4g00800 MFS monosaccharide transporter, putative from Aspergillus fumigatus Af293
36% identity, 79% coverage

• Broad-spectrum antimicrobial activities of a food fermentate of Aspergillus oryzae
  Choi, Microbiology spectrum 2024
  • “...transporter 4.76 AFUA_8G02550 Putative MFS peptide transporter 4.40 AFUA_8G05710 mfsA Putative MFS sugar transporter 3.94 AFUA_4G00800 Putative monosaccharide transporter 3.55 AFUA_3G11790 Putative galactose-proton symport 3.06 AFUA_8G06870 Putative MFS sugar transporter 2.99 AFUA_8G02010 Putative MFS sugar transporter 2.95 AFUA_1G16690 Putative MFS sugar transporter 2.75 AFUA_4G02870 Putative 2-ketogluconate...”
• Investigation of Aspergillus fumigatus biofilm formation by various "omics" approaches
  Muszkieta, Frontiers in microbiology 2013
  • “...Hypothetical protein 3.1 1.63 2.78 1.47 AFUA_1G09510 GPI anchored protein, putative 3.55 1.83 2.76 1.46 AFUA_4G00800 MFS monosaccharide transporter, putative 7.39 2.89 2.73 1.45 AFUA_5G08030 Cellulase CelA, putative 2.23 1.16 2.69 1.43 AFUA_7G04290 Amino acid permease (Gap1), putative 3.43 1.78 2.68 1.42 AFUA_5G03010 Conserved hypothetical protein...”
• Evolutionary Analysis of Sequence Divergence and Diversity of Duplicate Genes in Aspergillus fumigatus
  Yang, Evolutionary bioinformatics online 2012
  • “...0.66 [1.82, 1.82] Afu7g06080 2.10 [2.18, 1.29] Afu2g10140 0.72 [1.46, 1.23] Afu3g14010 2.18 [2.16, 1.22] Afu4g00800 0.74 [1.80, 1.71] Afu4g00990 2.37 [2.12, 0.95] Afu5g06230 0.76 [1.82, 1.74] Afu4g03370 1.32 [1.81, 1.21] Afu2g11600 0.82 [1.82, 1.65] Afu1g13320 0.99 [1.83, 1.53] Afu5g13290 0.82 [1.82, 1.68] Afu2g15730 2.52 [1.86,...”
• Sub-telomere directed gene expression during initiation of invasive aspergillosis
  McDonagh, PLoS pathogens 2008
  • “...(Hxt8) 4.701754948 Afu3g14030 alkaline phosphatase 3.3131505 Afu5g14540 MFS monosaccharide transporter 4.683929957 Afu2g00490 glycosyl hydrolase 4.8648019 Afu4g00800 MFS monosaccharide transporter 4.678081027 Afu7g06380 maltase 5.0594343 Afu7g00780 MFS monocarboxylate transporter 4.659742223 Afu8g01050 lipase/esterase 2.7697017 Afu3g03320 MFS monocarboxylate transporter 4.62947329 Afu3g14910 extracellular signalling protein (factor C) 3.0355716 Afu3g03240 MFS monocarboxylate...”

XP_042998199 uncharacterized protein from Ustilaginoidea virens
34% identity, 86% coverage

• The Identification, Characterization, and Functional Analysis of the Sugar Transporter Gene Family of the Rice False Smut Pathogen, Villosiclava virens
  Qin, International journal of molecular sciences 2024
  • “...60.48 12 Plasma membrane VvSTP25 XP_042993458 1 1890 629 8.26 70.23 12 Plasma membrane VvSTP26 XP_042998199 4 1656 551 9 59.96 12 Plasma membrane VvSTP27 XP_042993861 1 1653 550 8.55 60.95 12 Plasma membrane VvSTP28 XP_042993876 1 1752 583 5.64 64.89 12 Plasma membrane VvSTP29 XP_043001720...”

VDAG_02979 high-affinity glucose transporter RGT2 from Verticillium dahliae VdLs.17
34% identity, 88% coverage

• Verticillium dahliae-Arabidopsis Interaction Causes Changes in Gene Expression Profiles and Jasmonate Levels on Different Time Scales
  Scholz, Frontiers in microbiology 2018
  • “...gene ( WAKL10 , Meier et al., 2010 ) were chosen for the plant and VDAG_02979 (a glucose transporter) and VDAG_06565 (poly-A-ribonuclease, PARN) for the fungus. In the RNA-seq analysis, the expression of WAKL10 was 56-fold induced in V. dahliae -infested plants compared to plants grown...”
  • “...for 24 h. Shown is the normalized fold expression ( SE, n = 3) of VDAG_02979 (A) and VDAG_06565 (PARN) (B) in VD -colonized WT, jar1, coi1-16 , and cyp94B3 plants. The expression level of GOIs in VD alone was used as control and set to...”

ATEG_07144 uncharacterized protein from Aspergillus terreus NIH2624
33% identity, 87% coverage

• Transcriptome Profiling-Based Analysis of Carbohydrate-Active Enzymes in Aspergillus terreus Involved in Plant Biomass Degradation
  Corrêa, Frontiers in bioengineering and biotechnology 2020
  • “...SH during the 48 h incubation period, namely ATEG_07791, ATEG_03475, ATEG_07105, ATEG_04988, ATEG_01556, ATEG_07124, ATEG_08653, ATEG_07144, ATEG_03527, ATEG_02489, ATEG_07114, ATEG_04070, ATEG_07053, ATEG_04137, ATEG_03190, and ATEG_05008. RT-qPCR Validation of in silico RNA-Seq Transcriptome Data Expression profiles for selected A. terreus CAZyme-encoding and other genes significantly up-regulated on...”

NCU02582, XP_965713 RCO3 from Neurospora crassa OR74A
33% identity, 82% coverage

• Revisiting 2-Deoxyglucose Resistance in Neurospora crassa: Insights into Transcriptional Regulation of Hexose Transporters, Sugar Metabolism and Possible Modulation by Mating Type
  Pandey, 2023
• Deletion of the col-26 Transcription Factor Gene and a Point Mutation in the exo-1 F-Box Protein Gene Confer Sorbose Resistance in Neurospora crassa
  Hirai, Journal of fungi (Basel, Switzerland) 2022
  • “...A NCU07788 mat A ; col -26:: Hyg r 11031 FGSC a sor -4 a NCU02582 mat a ; sor -4:: Hyg r 17928 FGSC a sor -4(DS(r)) A NCU02582 mat A ; sor -4(DS(r)) 1741 FGSC a hxk -2 a NCU00575 mat a ; hxk...”
• Glucose sensing and light regulation: A mutation in the glucose sensor RCO-3 modifies photoadaptation in Neurospora crassa.
  Olmedo, Fungal biology 2018 (PubMed)
  • GeneRIF: The mutation in rco-3 modifies the transcriptional response to light of several genes and leads to changes in photoadaptation without significantly changing the amount and regulation of WC-1.
• Transcriptional comparison of the filamentous fungus Neurospora crassa growing on three major monosaccharides D-glucose, D-xylose and L-arabinose
  Li, Biotechnology for biofuels 2014
  • “...sugar transporters: NCU00821 ( Xyp29 , D-xylose-specific transporter), NCU08114 ( cdt-2 , cellodextrin transport) and NCU02582 ( rco-3 , glucose transporter) [ 9 , 31 , 32 ], and 10 putative sugar transporters, which will be discussed later. In addition, 50 of 300 CAZy genes were...”
  • “...High affinity glucose transporter 23.68 38.96 16.02 NCU01868 MFS maltose permease malp 0.41 2.42 0.54 NCU02582 Rco3 9.65 42.90 12.30 NCU04310 Sugar transporter 9.68 26.59 12.88 NCU05350 Sugar transporter 0.37 10.25 0.55 NCU05585 MFS quinate transporter 1.01 47.89 1.52 NCU06026 Quinate permease 5.99 37.83 13.25 NCU06358...”
• Deciphering transcriptional regulatory mechanisms associated with hemicellulose degradation in Neurospora crassa
  Sun, Eukaryotic cell 2012
  • “...transporter genes (NCU00988, NCU01132, NCU02188, NCU02238, NCU02582, NCU05853, NCU06138, NCU06305, NCU06358, NCU08114, and NCU09027). In addition, 6...”

HPODL_03366 High-affinity glucose transporter SNF3 from Ogataea parapolymorpha DL-1
34% identity, 84% coverage

• Random Transfer of Ogataea polymorpha Genes into Saccharomyces cerevisiae Reveals a Complex Background of Heat Tolerance
  Seike, Journal of fungi (Basel, Switzerland) 2021
  • “...TT03-36 OGAPODRAFT_17428 SLM1 phosphatidylinositol 4,5-bisphosphate-binding protein TT03-37 OGAPODRAFT_15585 RPS26A ribosomal 40S subunit protein S26A TT03-38 HPODL_03366 SNF3 high-affinity glucose transporter SNF3 TT03-39 HPODL_03527 IDP1 isocitrate dehydrogenase (NADP(+)) TT03-40 (4) OGAPODRAFT_7594 SOM1 mitochondrial export protein Som1 TT03-41 HPODL_02149 ETR1 trans-2-enoyl-CoA reductase TT03-42 HPODL_04585 MYO5 myosin-5 TT03-43 HPODL_01873...”

NCU04537 monosaccharide transporter from Neurospora crassa OR74A
34% identity, 87% coverage

• Correlating sugar transporter expression and activities to identify transporters for an orphan sugar substrate
  Tamayo, Applied microbiology and biotechnology 2024
  • “...crassa . For d -mannose, putative monosaccharide transporters from cluster 1 (like XYT-1, FRT-1, HGT-2, NCU04537, HGT-1, QaY, NCU06358, GLT-1, NCU06384, and NCU06138) could be potential candidates, but likely also only by contributing with unspecific side activities. Lactose uptake assays of transporter candidates Following the previous...”
• The regulatory and transcriptional landscape associated with carbon utilization in a filamentous fungus
  Wu, Proceedings of the National Academy of Sciences of the United States of America 2020
  • “...( 25 ). Of the predicted sugar transporters in this clade, five unannotated MFS transporters (NCU04537, NCU05350, NCU05585, NCU06384, and NCU07607) had increased expression on unique sugars and complex carbon sources, suggesting potential involvement in catabolism of those carbon sources ( SI Appendix , Fig. S1...”
  • “...high-affinity glucose transporter, hgt-1 NCU10021 ( 35 ) and additional uncharacterized transporters (NCU00809, NCU06522, NCU09287, NCU04537, NCU01494, NCU06384, and NCU05897). An uncharacterized sugar transporter bound by CRE-1, sut-28 (NCU05897; annotated as a fucose permease; SI Appendix , Fig. S1 ), is a predicted ortholog of the...”
• Molecular Mechanisms of Chitosan Interactions with Fungi and Plants
  Lopez-Moya, International journal of molecular sciences 2019
  • “...deletion strain mutants confirms Lipase Class III, Monosaccharide transporter and Glutathione transferase encoding genes (NCU03639; NCU04537; NCU10521, respectively) as main chitosan targets in N. crassa [ 36 ]. They might play a role in membrane repair, assimilation of catabolites and buffering ROS surplus derived from chitosan...”
• Control of Development, Secondary Metabolism and Light-Dependent Carotenoid Biosynthesis by the Velvet Complex of Neurospora crassa
  Bayram, Genetics 2019
  • “...on 22 May 2021 Log2Fold change NCU10101 (llmG) NCU04537 NCU10761 (llmA) NCU03016 NCU00292 NCU00943 NCU08648 Table 2 Top 10 upregulated genes under standard...”
• A fungal transcription factor essential for starch degradation affects integration of carbon and nitrogen metabolism
  Xiong, PLoS genetics 2017
  • “...1e-20 identified 14 genes likely encoding transporters. Four of them, hgt-1 (NCU10021), NCU05627, NCU04963, and NCU04537 are annotated as sugar transporter genes ( Fig 2C ). hgt-1 shows high affinity glucose transport activity [ 19 ], while NCU05627 ( xyt-1 ) has xylose transporting activity [...”
  • “...starch-active LPMO (NCU08746), gh13-6 and 19 transporter genes including hgt-1 , xyt-1 , NCU04963, and NCU04537 ( Fig 3C ). Seventeen TF genes in the starch regulon were also down regulated in the col-26 mutant, including tah-1 , tah-3 , vad-2 , ada-5 , and kal-1...”
• Regulated Forms of Cell Death in Fungi
  Gonçalves, Frontiers in microbiology 2017
  • “...Kontoyiannis, 2013a , b Chitosan N. crassa, Fusarium eumartii Nc : NCU03639 (class 3 lipase), NCU04537 (monosaccharide trans-porter), NCU10521 (gluta-thione S-transferase-4) Yes NA NA Palma-Guerrero et al., 2009 ; Terrile et al., 2014 ; Lopez-Moya et al., 2016 PLANT-DERIVED COMPOUNDS Camalexin Botrytis cinerea Bc : BcBir1...”
• Neurospora crassa transcriptomics reveals oxidative stress and plasma membrane homeostasis biology genes as key targets in response to chitosan
  Lopez-Moya, Molecular bioSystems 2016
  • “...NCU03639 encoding a class 3 lipase, involved in plasma membrane repair by lipid replacement and NCU04537 a MFS monosaccharide transporter related with assimilation of simple sugars, as main gene targets of chitosan. NCU10521, a glutathione S-transferase-4 involved in the generation of reducing power for scavenging intracellular...”
  • “...stress (NCU05134 and NCU08907) and a monosaccharide transporter perhaps involved in chitosan assimilation or detoxification (NCU04537, fold-induction 9.27 after 16h growing with chitosan). Besides, other genes related with sugars assimilation were also induces in presence of chitosan such as NCU01633 ( hxt13 ; Table S2 )....”
• Direct target network of the Neurospora crassa plant cell wall deconstruction regulators CLR-1, CLR-2, and XLR-1
  Craig, mBio 2015
  • “...in xylobiose or xylose utilization and a xylose/glucose transporter. In addition, other uncharacterized sugar transporters (NCU04537 and NCU05350) and two hypothetical proteins (NCU06490 and NCU07510) were in this gene set ( Table3 ). TABLE3 Genes upregulated and differentially expressed in the wild-type strains versus a xlr-1...”
  • “...a gh43-2 Xylosidase/arabinosidase NCU02343 gh51-1 Alpha- l -arabinofuranosidase NCU03322 GDSL family lipase NCU04401 Fructose-bisphosphate aldolase NCU04537 Monosaccharide transporter NCU04870 a ce1 - 1 Acetyl xylan esterase NCU05159 ce5 - 2 Acetyl xylan esterase NCU05350 Major facilitator transporter NCU06138 xy-31 Xylose transporter NCU06143 gh115-1 Putative glucuronidase NCU06490...”
• More

A2R055 Contig An12c0230, genomic contig from Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
An12g07450 uncharacterized protein from Aspergillus niger
34% identity, 84% coverage

• Advances in fungal sugar transporters: unlocking the potential of second-generation bioethanol production
  Pereira, Applied microbiology and biotechnology 2025
  • “...Tr69957 G0RW02 Cellobiose, xylose, and mannose T. reesei Nogueira et al. ( 2018 ) MstA A2R055 Glucose, xylose, fructose, and mannose A. niger vankuyk et al. ( 2004 ); Jrgensen et al. ( 2007 ) MstG XP_025453682 Glucose, galactose, mannose, and sucrose A. niger Sloothaak et...”
• The antifungal peptide AnAFP from Aspergillus niger promotes nutrient mobilization through autophagic recycling during asexual development
  Starke, Frontiers in microbiology 2024
  • “...1.1E-02 An15g03200 Thiamine transporter, mitochondrial membrane tpc1 1.12 3.9E-02 An12g00870 Malate permease ssu1 -1.08 4.9E-02 An12g07450 Hig-affinity sugar/H+ symporter mstA -1.25 1.2E-02 An15g07460 Oligopeptide transporter optG -1.58 3.2E-02 An08g05450 ATPase mdr4 -1.63 3.4E-02 An08g03850 Quinate permease qutD -1.81 4.8E-07 An12g04180 Aspartate transporter agtA -1.99 1.1E-02 An15g07190...”
• The amyR-deletion strain of Aspergillus niger CICC2462 is a suitable host strain to express secreted protein with a low background
  Zhang, Microbial cell factories 2016
  • “...215.81 17.92 3.59 0 Endoprotease Sugar transporter An15g03940 1891.82 158.73 3.58 0 Glucose transporter rco-3 An12g07450 372.55 6.95 5.74 0 Sugar transporter An01g00850 117.57 2.28 5.69 0 Sugar transporter An02g00590 258.7 14.23 4.18 0 Sugar transporter Table6 Positions of the possible amyR binding sites CGGN8CGG CGGN8AGG...”
  • “...None None Serine-type carboxypeptidase F An15g03940 554 to 567 None None None Glucose transporter rco-3 An12g07450 None None 702 to 715 885 to 898 867 to 880 Sugar transporter An01g00850 None None 758 to 771 None Sugar transporter An02g00590 None 857 to 870 602 to 615...”
• Metabolic activity in dormant conidia of Aspergillus niger and developmental changes during conidial outgrowth
  Novodvorska, Fungal genetics and biology : FG & B 2016
  • “...An05g01290 2.8 324.2 Monosaccharide transporter An16g08940 5.1 118.8 Monosaccharide transporter An02g01270 1.6 25.8 Monosaccharide transporter An12g07450 1.6 9.5 High affinity sugar/H+symporter, mstA An02g01560 0.1 1.4 GPCR An09g06510 6.1 2.8 GPCR An08g04110 1.4 4.8 GPCR An07g09280 4.7 17.4 GPCR An01g00400 0.8 1.2 GPCR An08g06130 8.6 89.2 GTP-binding...”
• Cytosolic streaming in vegetative mycelium and aerial structures of Aspergillus niger
  Bleichrodt, Studies in mycology 2013
  • “...5 Ubi4 - Saccharomyces cerevisiae An14g04920 1349 Triose-phosphate-isomerase tpiA from patent WO8704464-A - Aspergillus niger An12g07450 1332 Strong similarity to glucose permease Rgt2 - Saccharomyces cerevisiae An18g05640 1322 Strong similarity to hypothetical mold-specific protein MS8 - Ajellomyces capsulatus An01g02900 1299 Strong similarity to translation initiation factor...”
• Genome-wide expression analysis upon constitutive activation of the HacA bZIP transcription factor in Aspergillus niger reveals a coordinated cellular response to counteract ER stress
  Carvalho, BMC genomics 2012
  • “...10 An11g01100 strong similarity to high-affinity glucose transporter HGT1 - K. lactis 5 5 5 An12g07450 mstA Sugar/H+symporter 5 10 10 *Not significantly differentially expressed. The down-regulation of genes involved in starch degradation and uptake suggested that the HacA CA mutants growth may be severely affected...”
• The carbon starvation response of Aspergillus niger during submerged cultivation: insights from the transcriptome and secretome
  Nitsche, BMC genomics 2012
  • “...it can be assumed that these predicted sugar transporters comprise high-affinity sugar transporters. Indeed, mstA (An12g07450) and mstF (An02g00590) encoding two high-affinity sugar/H + symporters [ 32 ] were significantly upregulated at day 1 and 3 as well as day 1, 3 and 6, respectively. Furthermore,...”
• Transcriptome analysis of Aspergillus niger grown on sugarcane bagasse
  de, Biotechnology for biofuels 2011
  • “...encoding putative transporters that could be involved in carbohydrate transport, such as An1503940, An14g01600 and An12g07450 ( N. crassa NCU04963, NCU05853 and NCU10021, respectively), have increased mRNA accumulation in the presence of both SEB and Miscanthus (Additional file 5 , Table S5). Genes involved in the...”
• Aspergillus niger genome-wide analysis reveals a large number of novel alpha-glucan acting enzymes with unexpected expression profiles
  Yuan, Molecular genetics and genomics : MGG 2008
  • “...alpha-amylase AmyC An09g04810 18.470.44 P 6.460.35 P 2.520.02 P 2.9 7.4 0.003 Putative hexose transporter An12g07450 137.6013.00 P 51.5711.82 P 52.506.31 P 2.7 2.6 0.064 Sugar/H+ symporter MstA Energy An03g06270 4.720.29 P 1.590.14 A 0.200.25 A 3.3 25.6 0.035 Putative isoamyl alcohol oxidase An16g06010 5.181.55 P...”

TC 2.A.1.1.57 / Q8J0V1 High affinity (15 μM) glucose (monosaccharides including xylose):H+ symporter, MstA from Aspergillus niger
34% identity, 84% coverage

• substrates: Sugars
• Aspergillus niger membrane-associated proteome analysis for the identification of glucose transporters
  Sloothaak, Biotechnology for biofuels 2015
  • “...559.3 411.7 86.1 6.381.83 17.542.39 n.d MstH 1143191 535 420 75.7 8.51e31.14e3 n.d. n.d. MstA (Q8J0V1) 1101809 364.4 364.7 85.6 4.830.51 2.010.29 n.d. 1180703 339.2 346.3 97.4 n.d. n.d. 1.370.14 MstD (Q8J0U8) 1188093 312.9 289.3 82.0 1.080.39 0.820.11 0.820.25 1144791 308.1 289.6 55.9 6.251.25 n.d. n.d....”

FVEG_01638 hypothetical protein from Fusarium verticillioides 7600
32% identity, 92% coverage

• Transcriptome changes in Fusarium verticillioides caused by mutation in the transporter-like gene FST1
  Niu, BMC microbiology 2015
  • “...verticillioides genome with the yeast ITR1p sequence identified eight genes with high sequence similarity (FVEG_01519, FVEG_01638, FVEG_02081, FVEG_03992, FVEG_06504, FVEG_07757, FVEG_11293, and FVEG_12687). The sequence of FST1 was not identified by the search. Among the eight identified genes, expression was significantly down-regulated in fst1 for FVEG_06504...”

Q5AYG1 Major facilitator superfamily (MFS) profile domain-containing protein from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
34% identity, 84% coverage

• Advances in fungal sugar transporters: unlocking the potential of second-generation bioethanol production.
  Pereira, Applied microbiology and biotechnology 2025
  • “...XP_026623817 Glucose, xylose, galactose, and mannose A. niger Sloothaak et al. ( 2016b ) MstC/HxtB Q5AYG1 Glucose, xylose, fructose, galactose, and mannose A. nidulans dos Reis et al. ( 2013 ); Forment et al. ( 2014 ); dos Reis et al. ( 2016 ); dos Reis...”

VDAG_00974 low-affinity glucose transporter HXT3 from Verticillium dahliae VdLs.17
34% identity, 82% coverage

• Dual Transcriptome Analysis Reveals the Changes in Gene Expression in Both Cotton and <i>Verticillium dahliae</i> During the Infection Process
  Li, Journal of fungi (Basel, Switzerland) 2024
  • “...Mutant in Other Pathogens Pathogen Species Reference VDAG_00395 Reduced virulence Magnaporthe oryzae [ 45 ] VDAG_00974 Reduced virulence Colletotrichum higginsianum [ 46 ] VDAG_01121 Reduced virulence Beauveria bassiana [ 47 ] VDAG_01774 Loss of pathogenicity Parastagonospora nodorum No data VDAG_01922 Reduced virulence Magnaporthe oryzae [ 48...”

AFUA_6G03060, Afu6g03060 MFS monosaccharide transporter, putative from Aspergillus fumigatus Af293
35% identity, 84% coverage

• Broad-spectrum antimicrobial activities of a food fermentate of Aspergillus oryzae
  Choi, Microbiology spectrum 2024
  • “...MFS monosaccharide transporter 2.25 AFUA_2G12500 Putative MFS multidrug transporter 2.25 AFUA_3G01840 Putative MFS transporter 2.25 AFUA_6G03060 Putative MFS monosaccharide transporter 2.14 AFUA_4G03750 Putative phthalate transporter 2.05 AFUA_6G03720 Putative MFS allantoate transporter 2.02 AFUA_4G00150 Putative MFS maltose transporter 2.01 AFUA_5G02840 Putative MFS sugar transporter 1.88 AFUA_7G06390 MalP...”
• Expression profile analysis reveals that Aspergillus fumigatus but not Aspergillus niger makes type II epithelial lung cells less immunological alert
  Escobar, BMC genomics 2018
  • “...3.07 Up Afu6g02280 (aspf3) 2.41 Up Aspni7|1,143,258 2.97 Down Afu6g02520 2.01 Up Aspni7|1,172,785 3.90 Up Afu6g03060 18.45 Up Aspni7|1,143,191 14.30 Up Afu6g11430 (aldA) 3.61 Up Aspni7|1,148,193 3.09 Up Afu6g13330 7.53 Up Aspni7|1,148,295 20.67 Up Afu7g05920 2.03 Up Aspni7|1,173,782 5.76 Up Afu1g01370 Switched off Down Aspni7|1,161,822 Switched...”
• Transcriptional and proteomic analysis of the Aspergillus fumigatus ΔprtT protease-deficient mutant
  Hagag, PloS one 2012
  • “...AFUA_6G11840 sodium:bile acid symporter involved in azole resistance 5.4 AFUA_4G01230 amino acid transporter, putative 5.2 AFUA_6G03060 MFS monosaccharide transporter 5.0 AFUA_1G12240 MFS peptide transporter, putaitve 4.6 AFUA_5G11020 ammonium transporter 4.3 Oxidoreductase activity, GO:0016491 P =0.04 AFUA_8G00480 2 phytanoyl-CoA dioxygenase family protein 41.9 AFUA_8G00560 2 cytochrome P450,...”
• The temporal dynamics of differential gene expression in Aspergillus fumigatus interacting with human immature dendritic cells in vitro
  Morton, PloS one 2011
  • “...dehydrogenase AFUA_4G00610 aryl-alcohol dehydrogenase AFUA_3G11430 Arginase AFUA_5G14330 12-oxophytodienoate reductase Oxidation of fatty acids (p: 0.054) AFUA_6G03060 MFS monosaccharide transporter AFUA_1G14540 oxidoreductase, short-chain dehydrogenase/reductase family AFUA_2G04060 NADHflavin oxidoreductase AFUA_5G09400 carbonyl reductase AFUA_2G01440 mitochondrial carrier protein AFUA_3G03410 enoyl-CoA hydratase/isomerase family protein AFUA_1G04720 C-8 sterol isomerase (Erg-1) Disease, virulence...”
  • “...AFUA_3G01580 GMC oxidoreductase AFUA_5G14660 GABA permease AFUA_4G00610 aryl-alcohol dehydrogenase AFUA_6G00630 MFS transporter AFUA_5G14330 12-oxophytodienoate reductase AFUA_6G03060 MFS monosaccharide transporter AFUA_2G04060 NADHflavin oxidoreductase AFUA_4G00830 MFS peptide transporter Lipid/fatty acid transport (p: 0.089) Transport facilities (p: 0.078) AFUA_2G01440 mitochondrial carrier protein AFUA_6G00630 MFS transporter AFUA_1G04720 C-8 sterol isomerase...”
• Exploring temporal transcription regulation structure of Aspergillus fumigatus in heat shock by state space model
  Do, BMC genomics 2009
  • “...Copper amine oxidase, putative AFU4G12010 2-oxoacid dehydrogenases acyltransferase, putative 2(+) AFU6G03730 2-methyl citrate dehydratase, putative AFU6G03060 MFS monosaccharide transporter, putative 2(+) AFU6G02860 Isocitratelyase AFU6G03730 2-methylcitrate dehydratase, putative 2(+) AFU4G11310 Fructose-1,6-bisphosphatase Fbp1, putative AFU6G02860 Isocitrate lyase 2(+) AFU7G01000 Aldehyde dehydrogenase, putative AFU3G01450 3-methyl-2-oxobutanoate dehydrogenase, putative 2(+) AFU6G14200...”
• Sub-telomere directed gene expression during initiation of invasive aspergillosis
  McDonagh, PLoS pathogens 2008
  • “...extracellular signalling protein (factor C) 3.0355716 Afu3g03240 MFS monocarboxylate transporter 4.628176816 Afu8g01130 alpha-galactosidase C 2.8084929 Afu6g03060 monosaccharide transporter 4.576610248 Afu4g01070 acid phosphatase 3.4709519 Afu5g01160 monosaccharide transporter 4.53846138 Afu7g05610 glucanase 3.7652613 Afu4g13080 monosaccharide transporter 4.316438927 Afu4g00870 antigenic cell wall galactomannoprotein 2.8100298 Afu7g05830 MFS sugar transporter 4.069715654 Afu6g02980...”

PGTG_18584 uncharacterized protein from Puccinia graminis f. sp. tritici CRL 75-36-700-3
32% identity, 90% coverage

• Identification of promising host-induced silencing targets among genes preferentially transcribed in haustoria of Puccinia
  Yin, BMC genomics 2015
  • “...silencing included three predicted amino acid transporters (PGTG_16914, PGTG_07026 and PGTG_00315) and two sugar transporters (PGTG_18584 and PGTG_21065) and seven other genes predicted to encode transporter-like proteins. Of these, only two genes appeared important to fungal development in our silencing assays, one of which was the...”
• Obligate biotrophy features unraveled by the genomic analysis of rust fungi
  Duplessis, Proceedings of the National Academy of Sciences of the United States of America 2011
  • “...PGTG_01889 PGTG_15889 PGTG_15122 PGTG_12200 PGTG_15888 PGTG_18584 Wheat/urediniospores Function Mlp ID GenBank accession no. Wheat Urediniospores Fold-change...”

SS1G_08425 hypothetical protein from Sclerotinia sclerotiorum 1980 UF-70
31% identity, 90% coverage

• Transcriptome Analysis Reveals the Complex Molecular Mechanisms of Brassica napus-Sclerotinia sclerotiorum Interactions
  Xu, Frontiers in plant science 2021
  • “...For instance, the expression level of SS1G_05572 (gene 6935) was upregulated at 48 hpi, while SS1G_08425 (gene 7888) was significantly downregulated compared with 0 hpi, which suggested unknown and diverse functions for these MFS genes ( Figure 7 ). Figure 7 Differential changed genes involved in...”
• Exploring the Symbiotic Mechanism of a Virus-Mediated Endophytic Fungus in Its Host by Dual Unique Molecular Identifier-RNA Sequencing
  Qu, mSystems 2021
  • “...gene ( BnaA06g16330D ) and two upregulated S. sclerotiorum glucose transporter genes ( SS1G_05456 , SS1G_08425 ). For rice, OsSWEET11 could be induced by Xanthomonas oryzae and led to glucose efflux. Then, X. oryzae could take up glucose and multiply ( 52 ). Although the mechanism...”

NCU06358 high affinity glucose transporter RGT2 from Neurospora crassa OR74A
32% identity, 80% coverage

• Correlating sugar transporter expression and activities to identify transporters for an orphan sugar substrate
  Tamayo, Applied microbiology and biotechnology 2024
  • “...d -mannose, putative monosaccharide transporters from cluster 1 (like XYT-1, FRT-1, HGT-2, NCU04537, HGT-1, QaY, NCU06358, GLT-1, NCU06384, and NCU06138) could be potential candidates, but likely also only by contributing with unspecific side activities. Lactose uptake assays of transporter candidates Following the previous global analyses of...”
• Identification and characterization of the glucose dual-affinity transport system in Neurospora crassa: pleiotropic roles in nutrient transport, signaling, and carbon catabolite repression
  Wang, Biotechnology for biofuels 2017
  • “...presence of adequate glucose (0.5%; Fig. 4 d). Some other putative sugar transporters, such as NCU06358 and xyt - 1 (Fig. 4 d), were synchronously induced, indicating they have redundant roles in glucose uptake. In contrast, no significant increase in glt - 1 expression was found...”
  • “...resulting in synergistically elevated expression (ten- to 30-fold) of hgt - 1/ - 2 and NCU06358 (Additional file 14 : Figure S9). Because the derepression of high-affinity glucose transporters hgt - 1/ - 2 was not affected in the rco - 3 mutant, RCO-3 might act...”
• Transcriptional comparison of the filamentous fungus Neurospora crassa growing on three major monosaccharides D-glucose, D-xylose and L-arabinose
  Li, Biotechnology for biofuels 2014
  • “...10.25 0.55 NCU05585 MFS quinate transporter 1.01 47.89 1.52 NCU06026 Quinate permease 5.99 37.83 13.25 NCU06358 High affinity glucose transporter RGT2 1.71 51.82 18.50 NCU06384 MFS sugar transporter 0.08 2.88 1.11 NCU06522 MFS maltose permease 1.35 3.39 1.98 NCU07054 Sugar transporter 4 0.03 0.41 0.14 NCU07169...”
• Deciphering transcriptional regulatory mechanisms associated with hemicellulose degradation in Neurospora crassa
  Sun, Eukaryotic cell 2012
  • “...NCU02188, NCU02238, NCU02582, NCU05853, NCU06138, NCU06305, NCU06358, NCU08114, and NCU09027). In addition, 6 pentose-phosphate pathway (PPP) genes (NCU01328,...”

CH_124126 hexose transporter 2 from Magnaporthe grisea 70-15 (see paper)
35% identity, 75% coverage

SS1G_13734 hypothetical protein from Sclerotinia sclerotiorum 1980 UF-70
38% identity, 69% coverage

• Transcriptional and Small RNA Responses of the White Mold Fungus Sclerotinia sclerotiorum to Infection by a Virulence-Attenuating Hypovirus
  Lee, Viruses 2018
  • “...37.8-fold and 18.8-fold, respectively, in SsHV2-L-infected cultures. The expression of S. sclerotiorum hexose transporter 2 (SS1G_13734) was upregulated 89.3-fold by SsHV2-L infection. In Trial #1, 958 coding regions differed significantly; 471 were upregulated and 487 were downregulated ( Table S2a ). The same trial also found...”
• Changes in the Sclerotinia sclerotiorum transcriptome during infection of Brassica napus
  Seifbarghi, BMC genomics 2017
  • “...- - 3.2 2.2 Sugar transporters SS1G_04841 hexose transporter 4.1 2.9 - - - - SS1G_13734 hexose transporter HXT13 - 2.1 - - - - SS1G_04273 hexose transporter - - - - 6.1 15.8 SS1G_12412 hexose transporter - - 2.1 - 2.5 2.4 SS1G_09710 MFS sugar...”

MAA_02398 monosaccharide transporter from Metarhizium robertsii ARSEF 23
33% identity, 88% coverage

• The Sugar Transporter MST1 Is Involved in Colonization of Rhizosphere and Rhizoplane by Metarhizium robertsii
  Dai, mSystems 2021
  • “...In our previous RNA-Seq analysis ( 13 , 14 ), we noticed that a gene (MAA_02398) was highly expressed during symbiotic growth on Arabidopsis thaliana roots, saprophytic growth in nutrient-rich SDY medium (Sabouraud dextrose broth supplemented with 1% yeast extract), and infection of insects. MAA_02398 is...”
  • “...acids, which has 12 transmembrane domains as predicted by TMHMM version 2.0 ( 15 ). MAA_02398 is designated MST1 as it is a m ono s accharide t ransporter (see below). BLASTP analysis showed that homologs of MST1 were widely found in many plant-associated fungi such...”

SS1G_06620 hypothetical protein from Sclerotinia sclerotiorum 1980 UF-70
32% identity, 86% coverage

• Changes in the Sclerotinia sclerotiorum transcriptome during infection of Brassica napus
  Seifbarghi, BMC genomics 2017
  • “...6.7 7.0 4.9 - - SS1G_10125 MFS monosaccharide transporter 2.1 2.4 - - - - SS1G_06620 MFS monosaccharide transporter - - - - 2.4 - SS1G_07618 MFS monosaccharide transporter - - - - - 2.1 SS1G_08794 MFS sucrose transporter - - 2.6 - - - SS1G_04208...”

PODANS_1_22840 uncharacterized protein from Podospora anserina S mat+
32% identity, 87% coverage

• Involvement of PaSNF1 in Fungal Development, Sterigmatocystin Biosynthesis, and Lignocellulosic Degradation in the Filamentous Fungus Podospora anserina
  Li, Frontiers in microbiology 2020
  • “...identified as a high-affinity glucose transporter ( Baruffini et al., 2006 ), and PODANS_5_480 and PODANS_1_22840 ( MstA ) showed the capability of transporting monosaccharides including xylose ( Jorgensen et al., 2007 ). However, none of the transcription factors known to directly regulate cellulase gene expression...”

CNAG_04931 hypothetical protein from Cryptococcus neoformans var. grubii H99
35% identity, 72% coverage

• The glucose sensor-like protein Hxs1 is a high-affinity glucose transporter and required for virulence in Cryptococcus neoformans
  Liu, PloS one 2013
  • “...of hexose transporters ( Fig. 1B ). Both Hxs1 (CNAG_03772; 553 amino acids) and Hxs2 (CNAG_04931; 428 amino acids) are much smaller than Snf3 or Rgt2 in S. cerevisiae. Interestingly, neither of them has the long C-terminal tail and the conserved C-terminal domains (R1 and R2)...”

CNAG_03772 glucose transporter from Cryptococcus neoformans var. grubii H99
30% identity, 89% coverage

• The Dynamics of Cryptococcus neoformans Cell and Transcriptional Remodeling during Infection
  Freitas, Cells 2022
  • “...the host from the pre-culture in a rich medium (YPD). We did note increased HXS1 (CNAG_03772) transcripts at the early stage, and this high-affinity glucose transporter is regulated by glucose and involved in fungal virulence [ 64 ]. In this context, the level of glucose in...”
• Identification of Pathogen Genomic Differences That Impact Human Immune Response and Disease during Cryptococcus neoformans Infection
  Gerstein, mBio 2019
  • “...following genes of known function: LIV11 (CNAG_05422), encoding a virulence protein of unknown function; HSX1 (CNAG_03772), encoding a high-affinity glucose transporter; PTP2 (CNAG_05155), encoding a protein tyrosine phosphatase; and SPT8 (CNAG_06597), encoding a predicted saga histone acetyltransferase complex component. FIG4 Clade-specific variants. (A) Variants that are...”
• Investigation of Cryptococcus neoformans magnesium transporters reveals important role of vacuolar magnesium transporter in regulating fungal virulence factors
  Suo, MicrobiologyOpen 2018
  • “...Mg v H99) b Description CNAG_03502 4.28 3.44 Magnesium transporter CNAG_02489 1.20 2.37 Alcohol dehydrogenase CNAG_03772 0.92 2.28 Glucose transporter CNAG_07788 1.62 1.98 Unknown CNAG_05212 2.08 1.72 Unknown CNAG_07819 1.33 1.64 Unknown CNAG_05487 1.65 1.61 Unknown CNAG_07845 1.84 1.41 Unknown CNAG_05874 1.55 1.20 Unknown CNAG_00679 1.32...”
  • “...an extremely important regulator of C. neoformans virulence. Interestingly, the expression of the glucose transporter (CNAG_03772) is repressed when Mgt2 expression is inhibited. It is likely that the mgt2 mutant activates the cAMPPKA pathway via intracellular glucose deficiency, which in turns, causes capsule structure induction and...”
• Galectin-3 impacts Cryptococcus neoformans infection through direct antifungal effects
  Almeida, Nature communications 2017
  • “...XM_012191495.1 4.66 0.0407 1.3 33.0 CNAG_00680 Kinetochore protein Nuf2, variant XM_012191826.1 4.39 0.0000 3.9 81.8 CNAG_03772 Glucose transporter XM_012191299.1 4.17 0.0000 6.9 126.2 CNAG_00393 1,4-alpha-glucan-branching enzyme XM_012198536.1 3.82 0.0000 1.2 16.8 CNAG_07874 Sugar transporter XM_012196714.1 3.81 0.0000 12.0 170.1 CNAG_04621 Glycogen(starch) synthase, variant XM_012192450.1 3.58 0.0000...”
• Transmembrane transporter expression regulated by the glucosylceramide pathway in Cryptococcus neoformans
  Singh, BMC research notes 2015
  • “...All the six genes we identified, viz siderochrome-iron transporter (CNAG_02083), monosaccharide transporter (CNAG_05340), glucose transporter (CNAG_03772), membrane protein (CNAG_03912), membrane transport protein (CNAG_00539), and sugar transporter (CNAG_06963), are membrane-localized and have significantly altered gene expression levels. Therefore, we hypothesize that these genes function either independently or...”
  • “...5-ACGCCGATGGATTATTACTAGC-3, reverse: 5-CGACCTAGCAGTTCCGAAAG-3; CNAG_06963 (Sugar-transporter), forward: 5-TGGTCCTATCGGTGACTACTCT-3, reverse: 5-GCCAACTTGAGACACAAGCA-3; CNAG_05340 (Monosaccharide-transporter), forward: 5-AGGGATCGTTAGCTTTTGGTATG-3, reverse: 5-GGAAAATTGTTCGAGGACGA-3; CNAG_03772 (Glucose-transporter), forward: 5-GGACTGGTGTCAACTTCATTTTC-3, reverse: 5-CGACACCAATGATACCGACA-3; CNAG_00334 (Heat-shock-protein), forward: 5-GAGTCGAGATCATCGCCAAC-3, reverse: 5-TTAACGTCAGCGTCGTCGTA-3; CNAG_03780 (Prcdna95), forward: 5-AAGGGTGTCGTTGCCTTCTAC-3, reverse: 5-ATAGCCAAAACCCTCCATCC-3; CNAG_00092 (Mitochondrial-protein), forward: 5-GACCCAAGACCATCTTCTTCT-3, reverse: 5-GCAGCGAGGGAGTAGTTGAC-3; CNAG_01307 (Endoplasmic-reticulum-protein), forward: 5-AGCGAAACTTGTACTTGACAGG-3, reverse: 5-GCCATACTCGGCATTCTGTT-3; CNAG_01150...”
• Rapid mapping of insertional mutations to probe cell wall regulation in Cryptococcus neoformans
  Esher, Fungal genetics and biology : FG & B 2015
  • “...Singleton -- Chromosome 1 1752283-1752786 45 Promoter Pair CNAG_00674 Chromosome 2 774969-775175 15 CDS Singleton CNAG_03772 Chromosome 2 991283-991766 10 CDS Pair CNAG_03844 Chromosome 3 596973-597253 12 CDS Pair CNAG_02857 Chromosome 3 754720-754915 10 CDS Pair CNAG_02793 Chromosome 3 1050456-1050652 19 CDS Pair CNAG_02676 Chromosome 3...”
• The glucose sensor-like protein Hxs1 is a high-affinity glucose transporter and required for virulence in Cryptococcus neoformans
  Liu, PloS one 2013
  • “...12 transmembrane domains, a typical structure of hexose transporters ( Fig. 1B ). Both Hxs1 (CNAG_03772; 553 amino acids) and Hxs2 (CNAG_04931; 428 amino acids) are much smaller than Snf3 or Rgt2 in S. cerevisiae. Interestingly, neither of them has the long C-terminal tail and the...”
• The transcriptional response of Cryptococcus neoformans to ingestion by Acanthamoeba castellanii and macrophages provides insights into the evolutionary adaptation to the mammalian host
  Derengowski, Eukaryotic cell 2013
  • “...Transport CNAG_07869 CNAG_05662 CNAG_01384 CNAG_01936 CNAG_03772 CNAG_03910 CNAG_03060 CNAG_01925 CNAG_05685 CNAG_05929 CNAG_02288 CNAG_07367 CNAG_04795...”
• More

CNB02680 glucose transporter from Cryptococcus neoformans var. neoformans JEC21
31% identity, 89% coverage

• Pleiotropy and epistasis within and between signaling pathways defines the genetic architecture of fungal virulence
  Roth, PLoS genetics 2021
  • “...markers inserted at intergenic regions flanking the QTL. The chosen intergenic regions were between genes CNB02680 and CNB02690 at approximately 797,055797,281 kb on the left and between genes CNB03490 and CNB03500 at approximately 1,047,1381,047,346 kb on the right of the chromosome 2 QTL for the NAT...”
  • “...QTL-L and QTL-R refer to intergenic regions on chromosome 2 at 797,055797,281 bp, between genes CNB02680 and CNB02690 and at 1,047,1381,047,346 bp, between genes CNB03490 and CNB03500 , respectively in the XL280 a strain background [ 211 ]. (PDF) Click here for additional data file. S2...”
• Cryptococcus neoformans mediator protein Ssn8 negatively regulates diverse physiological processes and is required for virulence
  Wang, PloS one 2011
  • “...data not shown). In addition, we also examined the expressions of HXT (a hexose transporter, CNB02680) and SNF1 in the C. neoformans MAT strains including three ssn8 mutants in YPD liquid medium. Elevated transcript levels of these genes were detected in the mutants ( Table S1...”
• Metabolic adaptation in Cryptococcus neoformans during early murine pulmonary infection
  Hu, Molecular microbiology 2008
  • “...25 CND01120 XM_570351 fatty acid beta-oxidation- related protein Transporters TATACGATTT 26 0 612 143 2 CNB02680 XM_568855 monosaccharide transporter, HXT1 CCCATCGTAT 82 0 136 79 24 CNM02430 XM_568258 plasma membrane iron permease, CFT1 CTTGACAGCG 0 5 42 46 0 CNF02960 XM_571371 acetate transporter, ADY2 TATCTGATTT 19...”
• Identification of Cryptococcus neoformans temperature-regulated genes with a genomic-DNA microarray
  Kraus, Eukaryotic cell 2004
  • “...2.8 2.8 2.7 2.7 2.7 2.5 2.2 LYS2 CNB02680 CND03740 CNF00610 CNJ00670 CNG03520 CNG04460 CNG01070 CNG03440 CNG04330 PAK1 CNG01610 CNM01490 CNG02710 MDR1 CNG01350...”

G0RIJ1 Predicted protein from Hypocrea jecorina (strain QM6a)
34% identity, 84% coverage

• Advances in fungal sugar transporters: unlocking the potential of second-generation bioethanol production.
  Pereira, Applied microbiology and biotechnology 2025
  • “...( 2016b ) GLT1 G0RGR7 Glucose T. reesei Havukainen et al. ( 2021b ) STP1 G0RIJ1 Glucose, fructose, galactose, mannose, cellobiose, xylose, and L-arabinose T. reesei Zhang et al. ( 2013 ); Wang et al. ( 2015 ); Zhang et al. ( 2015 ) Tr44175 G0R8J4...”

Q7S0I5 MFS monosaccharide transporter from Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
NCU10021 MFS monosaccharide transporter from Neurospora crassa OR74A
33% identity, 84% coverage

• Advances in fungal sugar transporters: unlocking the potential of second-generation bioethanol production
  Pereira, Applied microbiology and biotechnology 2025
  • “...2017 ); Hassan et al. ( 2019 ); Havukainen et al. ( 2020 ) HGT-1 Q7S0I5 Glucose N. crassa Wang et al. ( 2017a ) HGT-2 Q7S3Q4 Glucose N. crassa Wang et al. ( 2017a ) GLT-1 Q1K4S3 Glucose and xylose N. crassa Li et al....”
• Do mitochondria use efflux pumps to protect their ribosomes from antibiotics?
  Islam, Microbiology (Reading, England) 2023
  • “...79 ] NCU09551 Q7S2B0 MFS G1UAY0, 2.3E^6 Q56ZZ7, 2.3E^7 Q8NBP5, 8.4E^9 [ 78 ] NCU10021 Q7S0I5 MFS Q8J2J7, 8.1E^102 Q9FMX3, 2.3E^55 Q96QE2, 2.8E^41 [ 78 ] *Information gathered from NCBI Protein BLAST, algorithm: PSI-BLAST ( https://www.ncbi.nlm.nih.gov/ ) and HMMER phmmer, Database: Reference Proteomes ( http://hmmer.org/ )...”
• Revisiting 2-Deoxyglucose Resistance in Neurospora crassa: Insights into Transcriptional Regulation of Hexose Transporters, Sugar Metabolism and Possible Modulation by Mating Type
  Pandey, 2023
• Do mitochondria use efflux pumps to protect their ribosomes from antibiotics?
  Islam, Microbiology (Reading, England) 2023
  • “...[ 79 ] NCU09551 Q7S2B0 MFS G1UAY0, 2.3E^6 Q56ZZ7, 2.3E^7 Q8NBP5, 8.4E^9 [ 78 ] NCU10021 Q7S0I5 MFS Q8J2J7, 8.1E^102 Q9FMX3, 2.3E^55 Q96QE2, 2.8E^41 [ 78 ] *Information gathered from NCBI Protein BLAST, algorithm: PSI-BLAST ( https://www.ncbi.nlm.nih.gov/ ) and HMMER phmmer, Database: Reference Proteomes ( http://hmmer.org/...”
• Adaptation to glucose starvation is associated with molecular reorganization of the circadian clock in Neurospora crassa
  Szőke, eLife 2023
  • “...tetrahydroxynaphthalene reductase NCU08457 eas 49 73 n.s. hydrophobin NCU09873 acu-6 39 12 2.9 phosphoenolpyruvate carboxykinase NCU10021 hgt-1 35 56 1.4 monosacharide transporter NCU08755 gh3-3 28 38 n.s. beta-glucosidase NCU00762 gh5-1 21 n.s . n.s . endoglucanase NCU08114 cdt-2 21 11 n.s . hexose transporter Using the...”
• The F-box protein gene exo-1 is a target for reverse engineering enzyme hypersecretion in filamentous fungi
  Gabriel, Proceedings of the National Academy of Sciences of the United States of America 2021 (secret)
• Evaluating the circadian rhythm and response to glucose addition in dispersed growth cultures of Neurospora crassa
  Kelliher, Fungal biology 2020
  • “...as major components of System I: glt-1 (NCU01633), and of System II: hgt-1 and hgt-2 (NCU10021 and NCU04963) ( Wang et al., 2017 ). The K m values for all three transporters fall within the ranges of earlier work ( Wang et al., 2017 ). Gene...”
• The regulatory and transcriptional landscape associated with carbon utilization in a filamentous fungus
  Wu, Proceedings of the National Academy of Sciences of the United States of America 2020
  • “...transporter clade ( SI Appendix , Fig. S1 ), including one high-affinity glucose transporter, hgt-1 NCU10021 ( 35 ) and additional uncharacterized transporters (NCU00809, NCU06522, NCU09287, NCU04537, NCU01494, NCU06384, and NCU05897). An uncharacterized sugar transporter bound by CRE-1, sut-28 (NCU05897; annotated as a fucose permease; SI...”
  • “...included NCU04537 (monosaccharide transporter), NCU04963 (high-affinity glucose transporter), NCU06026 (quinate permease), NCU05897 ( sut-28 ), NCU10021 ( hgt-1 ), NCU00821 (sugar transporter), and NCU05627 (high-affinity glucose transporter ght-1 ). The remaining set of 21 genes included a number of carbon metabolic enzymes and 5 genes encoding...”
• A fungal transcription factor essential for starch degradation affects integration of carbon and nitrogen metabolism
  Xiong, PLoS genetics 2017
  • “...cut-off value less than 1e-20 identified 14 genes likely encoding transporters. Four of them, hgt-1 (NCU10021), NCU05627, NCU04963, and NCU04537 are annotated as sugar transporter genes ( Fig 2C ). hgt-1 shows high affinity glucose transport activity [ 19 ], while NCU05627 ( xyt-1 ) has...”
• Identification and characterization of the glucose dual-affinity transport system in Neurospora crassa: pleiotropic roles in nutrient transport, signaling, and carbon catabolite repression
  Wang, Biotechnology for biofuels 2017
  • “...fungus N. crassa . One low-affinity glucose transporter, GLT-1 (NCU01633), and two high-affinity transporters, HGT-1/-2 (NCU10021 and NCU04963), were identified as the major components of systems I and II, respectively. Simultaneous deletion of hgt - 1/ - 2 (strain 2hgt ) resulted in a notable increase...”
• More

PODANS_5_480 uncharacterized protein from Podospora anserina S mat+
33% identity, 85% coverage

• Involvement of PaSNF1 in Fungal Development, Sterigmatocystin Biosynthesis, and Lignocellulosic Degradation in the Filamentous Fungus Podospora anserina
  Li, Frontiers in microbiology 2020
  • “...) was identified as a high-affinity glucose transporter ( Baruffini et al., 2006 ), and PODANS_5_480 and PODANS_1_22840 ( MstA ) showed the capability of transporting monosaccharides including xylose ( Jorgensen et al., 2007 ). However, none of the transcription factors known to directly regulate cellulase...”

XP_042994317 uncharacterized protein from Ustilaginoidea virens
32% identity, 81% coverage

• The Identification, Characterization, and Functional Analysis of the Sugar Transporter Gene Family of the Rice False Smut Pathogen, Villosiclava virens
  Qin, International journal of molecular sciences 2024
  • “...57.39 12 Plasma membrane VvSTP9 XP_042998161 4 1656 551 6.98 60.17 12 Plasma membrane VvSTP10 XP_042994317 1 1599 532 6.9 58.27 12 Plasma membrane VvSTP11 XP_042995010 1 1722 573 8.17 61.47 12 Plasma membrane VvSTP12 XP_042995051 1 1611 536 9.04 57.44 12 Plasma membrane VvSTP13 XP_043001089...”

CNBG_0170 glucose transporter from Cryptococcus deuterogattii R265
31% identity, 80% coverage

• Transcriptional Analysis Allows Genome Reannotation and Reveals that Cryptococcus gattii VGII Undergoes Nutrient Restriction during Infection
  Ferrareze, Microorganisms 2017
  • “...a ribonucleotide transporter (ADP, ATP carrier protein; CNBG_4811; FPKM = 9360.59), and a glucose transporter (CNBG_0170; FPKM = 4905.2). However, transporters for other sugars, metals, and other compounds were found, suggesting that C. gattii responds to nutrient deprivation in infection conditions. 3.7. Nitrogen and Amino Acid...”

XP_455315 hypothetical protein from Kluyveromyces lactis NRRL Y-1140
29% identity, 67% coverage

• Genetic basis of the highly efficient yeast Kluyveromyces marxianus: complete genome sequence and transcriptome analyses
  Lertwattanasakul, Biotechnology for biofuels 2015
  • “...Kl_HGT1, XP_451484; Kl_HXT1, XP_455078; Kl_HXT14, XP_454897; Kl_HXT2, XP_453960; Kl_HXT3, XP_453088; Sc_HXT4/LGT1, NP_011960; Kl_STL1, XP_456249; Kl_RAG4, XP_455315; Kl_LAC12, XP_452193; Ca_HXT6, XP_719472. Genes for the initial catabolism of xylose, PPP, the conversion of PEP to ethanol, the mitochondrial conversion of acetaldehyde to acetyl-CoA and TCA cycle were relatively...”

TC 2.A.1.1.64 / B1PM37 The hexose sensor, Hxs1 (believed to be non-transporting) from Pichia angusta (Yeast) (Hansenula polymorpha) (see paper)
29% identity, 80% coverage

• substrates: Hexoses

CNBG_5746 galactose transporter from Cryptococcus deuterogattii R265
33% identity, 86% coverage

• Identification and Characterization of an Intergenic "Safe Haven" Region in Human Fungal Pathogen Cryptococcus gattii
  Li, Journal of fungi (Basel, Switzerland) 2022
  • “...and CNBG_5898 on chromosome 4; and Candidate 3the 4073 bp intergenic region between CNBG_5745 and CNBG_5746 on chromosome 4. 3.2. Insertion of Foreign DNA into the Candidate 1 or the Candidate 2 Site Has No Significant Impact on the Expression of the Neighboring Genes Our selection...”
  • “...CNBG_5897 and CNBG_5898 in the two selected transformants for candidate 2, and of CNBG_5745 and CNBG_5746 in the two selected transformants for candidate 3. The transcript level of CNBG_3433 and CNBG_3434 in the selected transformants for candidate 1 site showed no apparent difference compared to those...”

Q6BW54 DEHA2B14278p from Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
31% identity, 63% coverage

• Functional survey for heterologous sugar transport proteins, using Saccharomyces cerevisiae as a host
  Young, Applied and environmental microbiology 2011
  • “...B5RUJ3 DEHA2F19140 S. stipitis B5RSN0 DEHA2A14300 P0AGF4 Q6BW54 DEHA2B14278 xylE Q6BTD8 Q2MEV7 GXS1 DEHA0D02167 Q2MDH1 Q6AWX0 At5g17010 GXF1 Q0WWW9 P22144...”

RGT2_YEAST / Q12300 High glucose sensor RGT2; Low-affinity glucose receptor RGT2; Low-affinity transporter-like sensor RGT2; Restores glucose transport protein 2 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 4 papers)
TC 2.A.1.1.19 / Q12300 Glucose transporter and low affinity sensor, Rgt2p (regulates glucose transport in conjunction with Snf3p). Rgt2 generates an intracellular signal in response to glucose that leads to inhibition of the Rgt1 transcriptional repressor and consequently to derepression of HXT genes encoding glucose transporters. They have unusually long C-terminal tails that bind to Mth1 and Std1, paralogous proteins that regulate the function of the Rgt1 transcription factor from Saccharomyces cerevisiae (Baker's yeast) (see 4 papers)
RGT2 / RF|NP_010143.1 high-affinity glucose transporter RGT2 from Saccharomyces cerevisiae
NP_010143, YDL138W Plasma membrane glucose receptor, highly similar to Snf3p; both Rgt2p and Snf3p serve as transmembrane glucose sensors generating an intracellular signal that induces expression of glucose transporter (HXT) genes from Saccharomyces cerevisiae
NP_010143 glucose sensor from Saccharomyces cerevisiae S288C
31% identity, 62% coverage

• function: Low-affinity high glucose sensor that is part of the sensor/receptor-repressor (SSR) glucose-signaling pathway, which detects extracellular glucose and induces expression of glucose transporters that bring glucose into the cell (PubMed:14755054, PubMed:27630263, PubMed:9564039). The transporter-like sensor generates an intracellular signal in the presence of high levels of glucose to promote high glucose-induced expression of HXT1 (PubMed:9564039). Binding of glucose to the RGT2 transmembrane domain activates a downstream signaling cascade, leading to phosphorylation of the RGT1 corepressors MTH1 and STD1, targeting them for SCF(Grr1)-dependent ubiquitination and degradation. Depletion of the corepressors robs RGT1 of its ability to repress expression of HXT genes, leading to accumulation of glucose transporters in the plasma membrane (PubMed:27630263, PubMed:8901598). Even though RGT2 is similar to glucose transporters, it appears to be unable to transport glucose (PubMed:9564039).
  subunit: Interacts with YCK1 (PubMed:14755054). Interacts with MTH1 and STD1 (PubMed:27630263).
• substrates: glucose
  tcdb comment: Scharff-Poulsen et al. 2018 showed that the C-terminal tail of Rgt2 is not responsible for its inability to transport glucose. RGT2 mutations that cause constitutive signal generation alter evolutionarily-conserved amino acids in the transmembrane spanning regions involved in maintaining an outward-facing conformation or the substrate binding site. These mutations may cause Rgt2 to adopt inward-facing or occluded conformations that generate the glucose signal
• A Rab escort protein regulates the MAPK pathway that controls filamentous growth in yeast
  Jamalzadeh, Scientific reports 2020
  • “...wall/stress response; RSC3 has a paralog, RSC30, that arose from the whole genome duplication NA YDL138W RGT2 Restores Glucose Transport 12 <0.1 Plasma membrane high glucose sensor that regulates glucose transport low affinity sesnor that contains 12 predicted transmembrane segments and a long C-terminal tail required...”
• Extensive Copy Number Variation in Fermentation-Related Genes Among Saccharomyces cerevisiae Wine Strains
  Steenwyk, G3 (Bethesda, Md.) 2017
  • “..., HXT8 / YJL214W , HXT10 / YFL011W , HXT16 / YJR158W , RGT2 / YDL138W , and SNF3 / YDL194W ) of the HXT gene family ( Figure 3 ). Interestingly, all remaining 10 members of the HXT gene family were not CN variable. Altogether,...”
• Acetylated Deoxynivalenol Generates Differences of Gene Expression that Discriminate Trichothecene Toxicity
  Suzuki, Toxins 2016
  • “...in this study. Systematic Name Gene Symbol Localization Description YKL038W RGT1 nucleus Glucose-responsive transcription factor YDL138W RGT2 plasma membrane Plasma membrane glucose sensor YDL194W SNF3 plasma membrane Plasma membrane low glucose sensor YHR094C HXT1 plasma membrane Low-affinity glucose transporter YMR011W HXT2 plasma membrane High-affinity glucose transporter...”
• Phylogenetic and Transcripts Profiling of Glucose Sensing Related Genes in Candida glabrata
  Ng, Jundishapur journal of microbiology 2015
  • “...Accession Number No. of Amino Acids Molecular Mass, kDa SNF3 YDL194W CAA98771 884 96.7 RGT2 YDL138W CAA65621 763 83.1 RGT1 YKL038W CAA81873 1170 128.2 MIG1 YGL035C CAA96736 504 55.6 HXT1 YHR094C DAA06789 570 63.3 HXT2 YMR011W DAA09909 541 59.8 HXT3 YDR345C DAA12185 567 62.6 HXT4 YHR092C...”
• Genome-wide integration on transcription factors, histone acetylation and gene expression reveals genes co-regulated by histone modification patterns
  Natsume-Kitatani, PloS one 2011
  • “...MIG2 (NP_011306), MOF (NP_115564), MSN2 (NP_013751), MSN4 (NP_012861), MTH1 (NP_010563), PIM1 (NP_002639), RAP1 (NP_014183), RGT2 (NP_010143), SIR2 (NP_010242), SNF3 (NP_010087) and SUP2 (NP_010457). Implementation The source code of our method, which was implemented in MATLAB ( http://www.mathworks.com/ ), is available from the supporting page for this...”
• Catabolite repression of Aox in Pichia pastoris is dependent on hexose transporter PpHxt1 and pexophagy
  Zhang, Applied and environmental microbiology 2010
  • “...for CaHgt4, CAA75114 for KlRag4, NP_010087 for ScSnf3, and NP_010143 for ScRgt2. cerevisiae and also implied a special role for PpHxt2 in sugar fermentation in...”
• Identification of hexose transporter-like sensor HXS1 and functional hexose transporter HXT1 in the methylotrophic yeast Hansenula polymorpha
  Stasyk, Eukaryotic cell 2008
  • “...XP_453656; KlRag4, CAA75114; ScHxt1, M82963; ScSnf3, NP_010087; and ScRgt2, NP_010143. 740 STASYK ET AL. EUKARYOT. CELL Hxs1 and Gcr1 and to which most of the...”
• Role of PUG1 in inducible porphyrin and heme transport in Saccharomyces cerevisiae
  Protchenko, Eukaryotic cell 2008
  • “...49.1 2.3 1.9 36.1 4.0 2.3 14.1 3.3 2.1 28.0 2.5 1.5 YDL138W RGT2 12 3.4 3.5 3.6 3.2 YPL189W GUP2 10 2.3 2.6 3.0 2.3 6 2.8 2.0 2.8 2.4 Hexose transporter...”
• More
• Multiple roles for the cytoplasmic C-terminal domains of the yeast cell surface receptors Rgt2 and Snf3 in glucose sensing and signaling.
  Kim, Scientific reports 2024
  • GeneRIF: Multiple roles for the cytoplasmic C-terminal domains of the yeast cell surface receptors Rgt2 and Snf3 in glucose sensing and signaling.
• Genetic Analysis of Signal Generation by the Rgt2 Glucose Sensor of Saccharomyces cerevisiae.
  Scharff-Poulsen, G3 (Bethesda, Md.) 2018
  • GeneRIF: RGT2 constitutive mutations alter evolutionarily-conserved amino acids in the transmembrane spanning regions of Rgt2. They cause Rgt2 to adopt inward-facing or occluded conformations that generate the glucose signal.
• The glucose metabolite methylglyoxal inhibits expression of the glucose transporter genes by inactivating the cell surface glucose sensors Rgt2 and Snf3 in yeast.
  Roy, Molecular biology of the cell 2016
  • GeneRIF: Rgt2 and Snf3 glucose sensors are primary targets of methylglyoxal, which causes degradation of the Rgt2 and Snf3.
• Disruption of Snf3/Rgt2 glucose sensors decreases lifespan and caloric restriction effectiveness through Mth1/Std1 by adjusting mitochondrial efficiency in yeast.
  Choi, FEBS letters 2015 (PubMed)
  • GeneRIF: Mth1 and Std1, which are downstream effectors of the Snf3/Rgt2 pathway, were required for viability through mitochondrial function but not fermentative metabolism
• Biochemical evidence for glucose-independent induction of HXT expression in Saccharomyces cerevisiae.
  Pasula, FEBS letters 2007
  • GeneRIF: RGT2-1 promotes ubiquitination and subsequent degradation of Mth1 and Std1 regardless of the presence of glucose.

E6RCH7 High-affinity glucose transporter of the major facilitator superfamily, putative Hxt4p from Cryptococcus gattii serotype B (strain WM276 / ATCC MYA-4071)
32% identity, 86% coverage

• Phenotypic characteristics and transcriptome profile of Cryptococcus gattii biofilm
  Tavares, Scientific reports 2019
  • “...process Ergosterol biosynthetic process CGB_J0030W 4,798 ADV24539 High-affinity glucose transporter of the major facilitator superfamily E6RCH7 High-affinity glucose transporter of the major facilitator superfamily Transmembrane transport CGB_F0090C 14,363 ADV22816 Monocarboxylic acid transporter E6R7J0 Monocarboxylic acid transporter Transmembrane transport Ion transmembrane transport CGB_M2010W 9,461 ADV25506 dUTP diphosphatase...”

An11g05280 uncharacterized protein from Aspergillus niger
30% identity, 82% coverage

• Comparative transcriptome analysis reveals different strategies for degradation of steam-exploded sugarcane bagasse by Aspergillus niger and Trichoderma reesei
  Borin, BMC genomics 2017
  • “...relation to A. niger , eight putative xylose transporter genes were found upregulated, including xltB (An11g05280). The product of xltB transports xylose with the highest specificity described so far [ 67 ]. Additionally, recently some transporters have been reported to be involved in the induction of...”

SNF3_YEAST / P10870 Low glucose sensor SNF3; High-affinity glucose receptor SNF3; High-affinity transporter-like sensor SNF3; Sucrose nonfermenting protein 3 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 5 papers)
TC 2.A.1.1.17 / P10870 Glucose transporter from Saccharomyces cerevisiae (see 7 papers)
NP_010087 glucose sensor from Saccharomyces cerevisiae S288C
NP_010087, YDL194W Plasma membrane glucose sensor that regulates glucose transport; has 12 predicted transmembrane segments; long cytoplasmic C-terminal tail is required for low glucose induction of hexose transporter genes HXT2 and HXT4 from Saccharomyces cerevisiae
30% identity, 56% coverage

• function: High-affinity low glucose sensor that is part of the sensor/receptor-repressor (SSR) glucose-signaling pathway, which detects extracellular glucose and induces expression of glucose transporters that bring glucose into the cell (PubMed:8901598, PubMed:9564039). The transporter-like sensor generates an intracellular signal in the presence of low levels of glucose to promote low glucose- induced expression of HXT2 (PubMed:9564039). Binding of glucose to the SNF3 transmembrane domain activates a downstream signaling cascade, leading to phosphorylation of the RGT1 corepressors MTH1 and STD1, targeting them for SCF(Grr1)-dependent ubiquitination and degradation. Depletion of the corepressors robs RGT1 of its ability to repress expression of HXT genes, leading to accumulation of glucose transporters in the plasma membrane (By similarity). SNF3 is involved as well in the transport of mannose and fructose (PubMed:20014043). Even though SNF3 is similar to glucose transporters, it appears to be unable to transport glucose (PubMed:9564039).
• substrates: glucose
• Multiple roles for the cytoplasmic C-terminal domains of the yeast cell surface receptors Rgt2 and Snf3 in glucose sensing and signaling.
  Kim, Scientific reports 2024
  • GeneRIF: Multiple roles for the cytoplasmic C-terminal domains of the yeast cell surface receptors Rgt2 and Snf3 in glucose sensing and signaling.
• The glucose metabolite methylglyoxal inhibits expression of the glucose transporter genes by inactivating the cell surface glucose sensors Rgt2 and Snf3 in yeast.
  Roy, Molecular biology of the cell 2016
  • GeneRIF: Rgt2 and Snf3 glucose sensors are primary targets of methylglyoxal, which causes degradation of the Rgt2 and Snf3.
• Disruption of Snf3/Rgt2 glucose sensors decreases lifespan and caloric restriction effectiveness through Mth1/Std1 by adjusting mitochondrial efficiency in yeast.
  Choi, FEBS letters 2015 (PubMed)
  • GeneRIF: Mth1 and Std1, which are downstream effectors of the Snf3/Rgt2 pathway, were required for viability through mitochondrial function but not fermentative metabolism
• Amino acid residues involved in ligand preference of the Snf3 transporter-like sensor in Saccharomyces cerevisiae.
  Dietvorst, Yeast (Chichester, England) 2010 (PubMed)
  • GeneRIF: This study reveals that Snf3, in addition to glucose, also senses fructose and mannose, as well as the glucose analogues 2-deoxyglucose, 3-O-methylglucoside and 6-deoxyglucose.
• Conditions with high intracellular glucose inhibit sensing through glucose sensor Snf3 in Saccharomyces cerevisiae.
  Karhumaa, Journal of cellular biochemistry 2010 (PubMed)
  • GeneRIF: Snf3 apparent affinity for glucose was lowest when the intracellular glucose concentration was high. The results conform to an alternating-access model for transporter-like sensors
• Loss of IRA2 suppresses the growth defect on low glucose caused by the snf3 mutation in Saccharomyces cerevisiae.
  Ramakrishnan, FEMS yeast research 2007 (PubMed)
  • GeneRIF: Suppression of the snf3 mutant phenotype by deletion of IRA2 was confirmed.
• TranCEP: Predicting the substrate class of transmembrane transport proteins using compositional, evolutionary, and positional information.
  Alballa, PloS one 2020
  • “...1203 columns, only 128 of them are informative (highlighted in shades of red). In (b) P10870 contains 884 residues, and the alignment of P10870 with other homologous sequences has 1312 columns, only 402 of them are informative. In (c) P11551 contains 438 residues, and the alignment...”
  • “...%Seq Num %Seq Num %Seq P39515 158 4 80 113 71.51 73 91.25 40 51.28 P10870 884 12 252 402 45.47 243 96.42 159 25.15 P11551 438 12 252 252 57.53 148 58.73 94 55.91 P0AAT4 415 5 105 208 50.12 41 39.05 167 53.87 The...”
• Comparative genomics of the white-rot fungi, Phanerochaete carnosa and P. chrysosporium, to elucidate the genetic basis of the distinct wood types they colonize
  Suzuki, BMC genomics 2012
  • “...NcNCU08114 (XP_963873.1), NcRco3 (CAE76420), Pp_115604 (EED81359), Ps_ABN65648.2 (ABN65648.2), PsSut1 (AAD00266), ScHxt1 (M82963), ScHxt7 (NP_010629), ScSnf3 (P10870), SpGht1 (Q9P3U6), Tm-CAZ81962.1 (CAZ81962.1), TrHxt1 (AAR23147), TrXlt1 (shown enlarged; AY818402), TrHxt2 (DQ852622; Ruohonen and Margolles-Clark, unpublished). The sequences were aligned using MAFFT, and the tree was drawn by FigTree. In...”
• Major facilitator superfamily
  Pao, Microbiology and molecular biology reviews : MMBR 1998
  • “...P38156 P15685 P18631 X96876 Q10710 P38142 S58778 U32274 P43562 Z72626 P40441 P47186 P10870 P39932 GB SP GB SP SP SP SP SP SP SP SP SP SP SP SP SP SP GB SP GB SP...”
• Identifier Mapping in Cytoscape
  Treister, F1000Research 2018
  • “...Cytoscape can be loaded from the Starter Panel and provides gene identifiers of the form YDL194W. These are actually Ensembl-supported identifiers for Yeast, distinct from the typical ENSXXXG00000123456 form as presented in Table 1 . This presents a special case that users will need to be...”
• Widespread Cumulative Influence of Small Effect Size Mutations on Yeast Quantitative Traits
  Hua, Cell systems 2018
  • “...the raw data. These genes are: GAL4 (YPL248C), GCN4 (YEL009C), GAL80 (YML051W), GAL1 (YBR020W), SNF3 (YDL194W), STI1 (YOR027W), REG1 (YDR028C), GAL3 (YDR009W), SNF2 (YOR290C), HSC82 (YMR186W) . This is important when calculating the explained heritability for top N genes (see main text). One of our main...”
• Extensive Copy Number Variation in Fermentation-Related Genes Among Saccharomyces cerevisiae Wine Strains
  Steenwyk, G3 (Bethesda, Md.) 2017
  • “...HXT10 / YFL011W , HXT16 / YJR158W , RGT2 / YDL138W , and SNF3 / YDL194W ) of the HXT gene family ( Figure 3 ). Interestingly, all remaining 10 members of the HXT gene family were not CN variable. Altogether, examination of the HXT family...”
• Acetylated Deoxynivalenol Generates Differences of Gene Expression that Discriminate Trichothecene Toxicity
  Suzuki, Toxins 2016
  • “...Description YKL038W RGT1 nucleus Glucose-responsive transcription factor YDL138W RGT2 plasma membrane Plasma membrane glucose sensor YDL194W SNF3 plasma membrane Plasma membrane low glucose sensor YHR094C HXT1 plasma membrane Low-affinity glucose transporter YMR011W HXT2 plasma membrane High-affinity glucose transporter YHR092C HXT4 plasma membrane High-affinity glucose transporter The...”
• Genome-Wide Transcription Study of Cryptococcus neoformans H99 Clinical Strain versus Environmental Strains
  Movahed, PloS one 2015
  • “...# BUD8 Bud-site-selection protein 8 40.5 37.5 62.5 0.0267 CNAG_03433T0_1016 15.3 15.4 10.7 0.0116 CNAG_03772T0_1438 NP_010087 SNF3 High-affinity glucose transporter SNF3 15.2 8.0 5.5 0.0113 CNAG_03477T0_50 NP_010667.1 RGA2 Rho GTPase-activating protein 2 13.6 7.2 11.9 0.0150 CNAG_05426T0_545 NP_013064.1 # PRP19 E3 ubiquitin-protein ligase PRP19 13.1 5.2...”
• Phylogenetic and Transcripts Profiling of Glucose Sensing Related Genes in Candida glabrata
  Ng, Jundishapur journal of microbiology 2015
  • “...Target Gene Name Systematic Name Accession Number No. of Amino Acids Molecular Mass, kDa SNF3 YDL194W CAA98771 884 96.7 RGT2 YDL138W CAA65621 763 83.1 RGT1 YKL038W CAA81873 1170 128.2 MIG1 YGL035C CAA96736 504 55.6 HXT1 YHR094C DAA06789 570 63.3 HXT2 YMR011W DAA09909 541 59.8 HXT3 YDR345C...”
• Improved production of a heterologous amylase in Saccharomyces cerevisiae by inverse metabolic engineering
  Liu, Applied and environmental microbiology 2014
  • “...SNV Description M715 YBR018C YBR026C YBR120C YBR295W YKR105C YDL194W YDR050C YGR047C YGR083C YHL038C YKL148C GAL7 ETR1 CBP6 PCA1 NA SNF3 TPI1 TFC4 GCD2 CBP2...”
• Genome-wide integration on transcription factors, histone acetylation and gene expression reveals genes co-regulated by histone modification patterns
  Natsume-Kitatani, PloS one 2011
  • “...MSN2 (NP_013751), MSN4 (NP_012861), MTH1 (NP_010563), PIM1 (NP_002639), RAP1 (NP_014183), RGT2 (NP_010143), SIR2 (NP_010242), SNF3 (NP_010087) and SUP2 (NP_010457). Implementation The source code of our method, which was implemented in MATLAB ( http://www.mathworks.com/ ), is available from the supporting page for this paper: http://www.bic.kyoto-u.ac.jp/pathway/natsume/hm_detector.htm . Results...”
• More

MST8_ORYSJ / Q94EC4 Sugar transport protein MST8; Monosaccharide transporter 8; OsMST8; Sugar:proton symporter MST8 from Oryza sativa subsp. japonica (Rice) (see 2 papers)
32% identity, 83% coverage

• function: Mediates active uptake of hexoses by sugar:proton symport (By similarity). May play an important role in transporting monosaccharides during anther development (Probable).

CNAG_05387 galactose transporter from Cryptococcus neoformans var. grubii H99
32% identity, 86% coverage

• Antifungal activity of eumelanin-inspired indoylenepheyleneethynylene against <i>Cryptococcus neoformans</i>
  Conn, Frontiers in microbiology 2023
  • “...Gene ID Gene name Log2foldChange p -adjusted Gene description CNAG_01683 STL1 2.362044974 0* Sugar transporter CNAG_05387 1.891607373 0* MFS glucose transporter mfs1 CNAG_01577 2.794167594 0* NADP-specific glutamate dehydrogenase CNAG_06150 2.515378205 0* Heat shock protein 902 CNAG_04630 YAP2 1.495267376 0* Hypothetical protein CNAG_01750 1.7658259 0* Heat shock...”
• A PAS Protein Directs Metabolic Reprogramming during Cryptococcal Adaptation to Hypoxia
  Zhao, mBio 2021
  • “...of Pas2 in regulating hypoxia-induced metabolic reprogramming. For instance, the genes involved in glycolysis ( CNAG_05387 and CNAG_06290 ), fermentation ( CNAG_01955 , CNAG_04659 , and CNAG_07745 ), gluconeogenesis ( CNAG_04217 ), the PPP ( CNAG_04025 and CNAG_06923 ), and the TCA cycle ( CNAG_06374 )...”
• Galectin-3 impacts Cryptococcus neoformans infection through direct antifungal effects
  Almeida, Nature communications 2017
  • “...Atg18 XM_012191442.1 3.12 0.0000 2.4 21.4 CNAG_00598 Nicotinamide mononucleotide permease XM_012198344.1 2.87 0.0000 281.5 2069.0 CNAG_05387 Galactose transporter XM_012191781.1 2.84 0.0000 3.5 25.2 CNAG_03666 Acyl-CoA dehydrogenase XM_012193765.1 2.82 0.0001 0.5 3.3 CNAG_00865 Maltose O -acetyltransferase partial XM_012192132.1 2.80 0.0000 8.7 61.1 CNAG_03876 Ras family protein XM_012194860.1...”
• The glucose sensor-like protein Hxs1 is a high-affinity glucose transporter and required for virulence in Cryptococcus neoformans
  Liu, PloS one 2013
  • “...HXT1 . Meanwhile, HXT2 (CNAG_06290) was induced only by the high glucose concentration, while HXT3 (CNAG_05387) was induced only by low glucose condition ( Fig. 3 ). The changes of transcription level of other tested HXT homologs, HXT4 (CNAG_06521), HXT6 (CNAG_06963) and HXT7 (CNAG_03432), were not...”

Pc22g09740 uncharacterized protein from Penicillium rubens
29% identity, 96% coverage

• Functional characterization of a Penicillium chrysogenum mutanase gene induced upon co-cultivation with Bacillus subtilis
  Bajaj, BMC microbiology 2014
  • “...genes with similarity to the Kluyveromyces lactis high-affinity glucose transporter gene HGT1 . (Pc18g00150; Pc21g19660; Pc22g09740 and Pc21g19770) and the glucose transporter rco-3 from Neurospora crassa (Pc12g02080) were found in this cluster (Additional file 1 : Table S1). Transcriptional responses of P. chrysogenum genes involved in...”

MAA_02403 hexose transporter from Metarhizium robertsii ARSEF 23
31% identity, 81% coverage

• Carbon translocation from a plant to an insect-pathogenic endophytic fungus
  Behie, Nature communications 2017
  • “...MST2 during plant root colonization 25 . Metarhizium has three identified monosaccharide transporters (accession numbers: MAA_02403, MAA_03088, MAA_07773), and while these transporters have not been characterized in terms of specific function or location, BLAST analyses show sequence identities with sugar transporters in other root colonizing fungi...”

SNF3 glucose sensor from Candida albicans (see paper)
XP_723173 glucose sensor from Candida albicans SC5314
30% identity, 65% coverage

• CharProtDB CGD description: glucose and galactose sensor; fermentation, filamentation, virulence roles; in 20-member C. albicans glucose transporter family, extended C terminus; high-glucose repressed; induced in macrophage, repressed in biofilm
• Comparative genomics of the white-rot fungi, Phanerochaete carnosa and P. chrysosporium, to elucidate the genetic basis of the distinct wood types they colonize
  Suzuki, BMC genomics 2012
  • “...of corresponding sequences are: AnHyp1 (XP_682442.1), AnHyp2 (XP_660070.1), AnMstA (CAC80843), Ao_BAE58341.1 (BAE58341.1), CaHgt1 (CAA76406), CaHgt4 (XP_723173), CaHgt11 (XP_719597), CiGxf1 (AJ937350), CiGxs1 (AJ875406), GzHyp1 (EAA74528), HpGcr1 (AAR88143), KlHgt1 (XP_451484), KlRag1 (XP_453656), KlRag4 (CAA75114), Lb_EDR07962 (EDR07962), NcHyp1 (XP_328858), NcHxt3 (CAD21508), NcNCU00801(EAA34565.1), NcNCU08114 (XP_963873.1), NcRco3 (CAE76420), Pp_115604 (EED81359), Ps_ABN65648.2...”
• Catabolite repression of Aox in Pichia pastoris is dependent on hexose transporter PpHxt1 and pexophagy
  Zhang, Applied and environmental microbiology 2010
  • “...for HpGcr1, CAI44932 for CiGxs1, EU476007 for HpHxs1, XP_723173 for CaHgt4, CAA75114 for KlRag4, NP_010087 for ScSnf3, and NP_010143 for ScRgt2. cerevisiae and...”
• Identification of hexose transporter-like sensor HXS1 and functional hexose transporter HXT1 in the methylotrophic yeast Hansenula polymorpha
  Stasyk, Eukaryotic cell 2008
  • “...are as follows: AnMSTA, AAL89822; CaHgt4, XP_723173; CaHgt12, XP_888662; CiGxs1, CAI44932; CiGxf1, CAI77652; HpGcr1, AAR88143; HpHxt1, EU476006; HpHxs1,...”

Q9P841 Galactose/glucose transporter (Fragment) from Candida albicans
58% identity, 30% coverage

• Recombinant Actifensin and Defensin-d2 Induce Critical Changes in the Proteomes of Multidrug-Resistant Pseudomonas aeruginosa and Candida albicans
  Gbala, Microbiology spectrum 2022
  • “...-methyltransferase Down Non 2 tr/ KAF6063297 /A0A8H6BW35_CANAX ATP synthase F1 subunit Down Down 3 tr/ Q9P841 /Q9P841_CANAX Galactose/glucose transporter Down Non 4 tr/ Q0ZIF4 /Q0ZIF4_CANAX ATP synthase subunit Down Down 5 tr/ EEQ41957 /C4YG33_CANAW MMS5_N domain-containing protein Down Non 6 tr/ EEQ44166 /C4YPM7_CANAW Uncharacterized protein Up...”

Afu2g05190 MFS monosaccharide transporter, putative from Aspergillus fumigatus Af293
30% identity, 81% coverage

• Evolutionary Analysis of Sequence Divergence and Diversity of Duplicate Genes in Aspergillus fumigatus
  Yang, Evolutionary bioinformatics online 2012
  • “...1.43 [0.77, 2.58] Afu1g16080 2.53 [0.27, 3.04] Afu5g14990 2.78 [2.06, 0.45] Afu5g00280 2.43 [0.27, 2.94] Afu2g05190 0.61 [1.22, 2.18] Afu7g01690 2.41 [0.35, 3.07] Afu8g05220 2.61 [2.09, 0.65] Afu3g00670 2.39 [0.59, 3.44] Afu5g13060 2.60 [2.05, 0.60] Afu6g12820 2.37 [2.06, 6.42] Afu2g12200 0.65 [1.79, 1.77] Afu6g02420 2.35 [2.02,...”

CNAG_06521 hypothetical protein from Cryptococcus neoformans var. grubii H99
32% identity, 86% coverage

• The glucose sensor-like protein Hxs1 is a high-affinity glucose transporter and required for virulence in Cryptococcus neoformans
  Liu, PloS one 2013
  • “...( Fig. 3 ). The changes of transcription level of other tested HXT homologs, HXT4 (CNAG_06521), HXT6 (CNAG_06963) and HXT7 (CNAG_03432), were not significant (<2 fold). The transcription level of each HXT gene tested was not altered significantly by the lack of HXS1 (<2 fold) when...”

XP_026623817 general substrate transporter from Aspergillus welwitschiae
31% identity, 87% coverage

• Advances in fungal sugar transporters: unlocking the potential of second-generation bioethanol production
  Pereira, Applied microbiology and biotechnology 2025
  • “...Glucose, fructose, galactose, mannose, and sucrose A. niger Sloothaak et al. ( 2015 ) XltA XP_026623817 Glucose, xylose, galactose, and mannose A. niger Sloothaak et al. ( 2016b ) MstC/HxtB Q5AYG1 Glucose, xylose, fructose, galactose, and mannose A. nidulans dos Reis et al. ( 2013 );...”

SS1G_07132 hypothetical protein from Sclerotinia sclerotiorum 1980 UF-70
29% identity, 84% coverage

• Changes in the Sclerotinia sclerotiorum transcriptome during infection of Brassica napus
  Seifbarghi, BMC genomics 2017
  • “...- - - 7.2 10.6 SS1G_08467 MFS sugar transporter - - - - 2.9 2.5 SS1G_07132 MFS sugar transporter - - - - 8.3 6.3 SS1G_01759 MFS sugar transporter - - - - - 2.8 SS1G_14316 MFS sugar transporter - - - - - 6.1 SS1G_06402...”

An06g00560 uncharacterized protein from Aspergillus niger
31% identity, 87% coverage

• In Silico Analysis of Putative Sugar Transporter Genes in Aspergillus niger Using Phylogeny and Comparative Transcriptomics
  Peng, Frontiers in microbiology 2018
  • “...(An14g04280) ( Sloothaak et al., 2014 ) and the D -xylose transporter encoding gene xltA (An06g00560) ( Sloothaak et al., 2016b ) were also clearly induced by their corresponding sugars. Interestingly, several transporters lacking solid experimental proof of function also had highly specific expression profiles. For...”
  • “...et al., 2013 ), in which An03g01620 and An08g01720 were also affected by AraR, while An06g00560 ( xltA ) was under control of XlnR. While some of the transporters appear to be under control of the same regulators (e.g., XlnR, AmyR, and RhaR) that control polysaccharide...”
• Construction of an improved Aspergillus niger platform for enhanced glucoamylase secretion
  Fiedler, Microbial cell factories 2018
  • “...metabolism and calcium signalling, also four genes supposedly related to carbon catabolism were differentially expressed: An06g00560 (ortholog of the Saccharomyces cerevisiae Hxt13p hexose transporter) and An12g00160 (ortholog of the Saccharomyces cerevisiae Mae1 malic enzyme) were both up-regulated, whereas An16g01770 (predicted xylose reductase) and An07g01340 (predicted phosphoenolpyruvate...”
• RNA-sequencing reveals the complexities of the transcriptional response to lignocellulosic biofuel substrates in Aspergillus niger
  Pullan, Fungal biology and biotechnology 2014
  • “...38.20 1.72 676.84 <0.01 TID_38375 An08g04040 transmembrane transporter activity 0.53 7.98 0.84 32.31 <0.01 TID_55668 An06g00560 transmembrane transporter activity 0.19 24.08 0.30 263.55 <0.01 TID_180069 An07g02540 transmembrane transporter activity 0.10 2.05 0.75 43.05 <0.01 TID_197549 An02g08230 transmembrane transporter activity 0.26 18.83 0.09 146.66 <0.01 TID_54095 An18g01700...”
• The transcriptomic signature of RacA activation and inactivation provides new insights into the morphogenetic network of Aspergillus niger
  Kwon, PloS one 2013
  • “...permease An18g01220 Dal5 oligopeptide transporter An13g01760 Opt1 An15g07460 Opt1 oligopeptide transporter An11g01040 Opt1 hexose/glucose transporter An06g00560 Hxt13 An09g04810 amino acid transporter An03g00430 galactose transporter An01g10970 Gal2 FAD transporter into endoplasmatic reticulum, CWI-related An01g09050 Flc2 Protein trafficking GTPase activating protein involved in protein trafficking An01g02860 Gyp8 An15g01560...”
• Uncovering the genome-wide transcriptional responses of the filamentous fungus Aspergillus niger to lignocellulose using RNA sequencing
  Delmas, PLoS genetics 2012
  • “...38375 An08g04040 Similarity to quinate transport protein QutD - Aspergillus nidulans 1.7 141.9 2.9 55668 An06g00560 Similarity to hexose transporter Hxt13 - Saccharomyces cerevisiae 0.6 124.0 3.7 180069 An07g02540 Similarity to carboxylic acid transport protein Jen1 - Saccharomyces cerevisiae 1.5 108.6 2.0 197549 An02g08230 Similarity to...”
• Analysis of variance components reveals the contribution of sample processing to transcript variation
  van, Applied and environmental microbiology 2009
  • “...An09g03300 An03g00500 An15g01500 An11g01100 An03g01620 An06g00560 An01g10920 An01g03740 An12g00030 An07g03140 An02g03590 Signal sequence predicted Yes Yes...”

NCU06138 quinate permease from Neurospora crassa OR74A
30% identity, 82% coverage

• Correlating sugar transporter expression and activities to identify transporters for an orphan sugar substrate
  Tamayo, Applied microbiology and biotechnology 2024
  • “...transporters from cluster 1 (like XYT-1, FRT-1, HGT-2, NCU04537, HGT-1, QaY, NCU06358, GLT-1, NCU06384, and NCU06138) could be potential candidates, but likely also only by contributing with unspecific side activities. Lactose uptake assays of transporter candidates Following the previous global analyses of the sugar transportome of...”
• Independent metabolism of oligosaccharides is the keystone of synchronous utilization of cellulose and hemicellulose in Myceliophthora
  Liu, PNAS nexus 2024
  • “...xylose transporter Mycth_96047, with a high identity with the xylose and glucose transporter encoded by NCU06138 in N. crassa ( 40 ), showed a high expression level under xylose, xylobiose, and xylan conditions, while it was strongly inhibited by glucose (Fig. 4 C). Additionally, the expression...”
• The transcription factor PDR-1 is a multi-functional regulator and key component of pectin deconstruction and catabolism in Neurospora crassa
  Thieme, Biotechnology for biofuels 2017
  • “...(NCU04130), the glycerol-3-phosphate O -acyltransferase chol - 6 (NCU05985), the quinate permease mfs - 19 (NCU06138), the endo-1,4--xylanase gh11 - 2 (NCU07225), the fumarylacetoacetate hydrolase fah - 2 (NCU07506), the mitochondrial triosephosphate isomerase emp - 19 (NCU10106), a glyoxalase (NCU11253), and four hypothetical proteins (NCU01700, NCU01871,...”
  • “...2 1 C13 NCU05037 put . lra4 4 C1 NCU05985 chol - 6 1 C1 NCU06138 mfs - 19 1 C13 NCU07225 gh11 - 2 1 C13 NCU07506 fah - 2 3 C1 NCU08475 Hypothetical protein 2 C1 NCU09033 pdr - 1 5 C1 NCU09034 put....”
• Direct target network of the Neurospora crassa plant cell wall deconstruction regulators CLR-1, CLR-2, and XLR-1
  Craig, mBio 2015
  • “...1 Acetyl xylan esterase NCU05159 ce5 - 2 Acetyl xylan esterase NCU05350 Major facilitator transporter NCU06138 xy-31 Xylose transporter NCU06143 gh115-1 Putative glucuronidase NCU06490 Hypothetical protein NCU07225 a gh11-2 Endo-1,4--xylanase NCU07510 Hypothetical protein NCU08114 a cdt-2 Cellodextrin/xylodextrin transporter NCU08189 gh10-2 Endo-1,4--xylanase NCU08384 xyr-1 Xylose reductase NCU09652...”
• Transcriptional comparison of the filamentous fungus Neurospora crassa growing on three major monosaccharides D-glucose, D-xylose and L-arabinose
  Li, Biotechnology for biofuels 2014
  • “...1045.02 NCU00809 MFS monosaccharide transporter 7.07 314.73 6.64 NCU01132 MFS monosaccharide transporter 0.46 280.94 0.87 NCU06138 Quinate permease 0.74 213.95 75.43 NCU05897 L-fucose permease 1.10 179.47 315.45 NCU05853 MFS sugar transporter 2.36 149.95 5.65 NCU04963 High-affinity glucose transporter 4.91 128.69 402.90 NCU04537 Monosaccharide transporter 1.06 3.35...”
  • “...well-characterized so far, although limited analysis has been performed on five of them; NCU04963 and NCU06138 have the capability to transport both xylose and glucose, whereas very weak xylose transportation activity was detected in a recombinant yeast strain harboring NCU02188, NCU04537 or NCU09287 [ 9 ]....”
• Deciphering transcriptional regulatory mechanisms associated with hemicellulose degradation in Neurospora crassa
  Sun, Eukaryotic cell 2012
  • “...(NCU00988, NCU01132, NCU02188, NCU02238, NCU02582, NCU05853, NCU06138, NCU06305, NCU06358, NCU08114, and NCU09027). In addition, 6 pentose-phosphate pathway...”
  • “...NCU09652, -xylosidase, gh43-5), and two transporter genes (NCU06138 and NCU08114). Other genes encode proteins with a potential role in hemicellulose...”
• Systems analysis of plant cell wall degradation by the model filamentous fungus Neurospora crassa
  Tian, Proceedings of the National Academy of Sciences of the United States of America 2009
  • “...(NCU00801, NCU00988, NCU01231, NCU04963, NCU05519, NCU05853, NCU05897, NCU06138, NCU08114, and NCU10021) and 23 putative or hypothetical proteins. Of the 117...”

BBA_03013 hexose transporter from Beauveria bassiana ARSEF 2860
30% identity, 87% coverage

• Nuclear Ssr4 Is Required for the In Vitro and In Vivo Asexual Cycles and Global Gene Activity of Beauveria bassiana
  Shao, mSystems 2020
  • “...the pentose phosphate pathway and the Calvin cycle ( 38 ), six hexose transporters (BBA_05766, BBA_03013, BBA_00397, BBA_09477, BBA8728, and BBA5674) critical for glucose uptake ( 39 ), and most of the glycosyl hydrolases (BBA_03946, BBA_05847, BBA_09379, and BBA_08796) involved in the hydrolysis of glycosidic bonds,...”

VDAG_08381 galactose-proton symporter from Verticillium dahliae VdLs.17
32% identity, 80% coverage

• Identification of sugar transporter genes and their roles in the pathogenicity of Verticillium dahliae on cotton
  Chen, Frontiers in plant science 2023
  • “...transporters and are capable of acquisition of monosaccharide and disaccharide substrates, including glucose, galactose (VDAG_01215, VDAG_08381 and VDAG_05443), xylose (VDAG_03925), alpha-glucoside, lactose and maltose. It was notable that several genes encoding inositol transporters and quinine permeases were identified from V. dahliae . The function of these...”

Afu1g03530 MFS sugar transporter, putative from Aspergillus fumigatus Af293
30% identity, 80% coverage

• Transcriptome and secretome analysis of Aspergillus fumigatus in the presence of sugarcane bagasse
  de, BMC genomics 2018
  • “...Database (AspGD; http://www.aspgd.org ) [ 32 ]. Three orthologous genes encoding possible putative xylose transporters (Afu1g03530, Afu4g14610, and Afu6g14442) and five related to cellobiose transporters (Afu3g01670, Afu6g14500, Afu6g14560, Afu7g05100, and Afu8g04480) have been identified in N. crassa , A. oryzae, A. niger , and A. nidulans...”
  • “...xylose with an increase in up to 25-fold. On the other hand, the expression of Afu1g03530 increased to 250-, 180-, 25-, 60-, 200-, and 5-fold after 3, 6, 12, 18, 24, and 48h, respectively (Fig. 4b ). These results lead us to speculate that both genes...”

G0RRR0 Predicted protein from Hypocrea jecorina (strain QM6a)
29% identity, 79% coverage

• Advances in fungal sugar transporters: unlocking the potential of second-generation bioethanol production.
  Pereira, Applied microbiology and biotechnology 2025
  • “...A0A024SH75 Cellobiose, glucose, lactose, and sophorose T. reesei Havukainen et al. ( 2021b ) STR1 G0RRR0 Glucose, xylose, fructose, galactose, mannose, and L-arabinose T. reesei Sloothaak et al. ( 2016b ) STR3 G0RKF0 Glucose, xylose, fructose, galactose, and mannose T. reesei Sloothaak et al. ( 2016b...”

LOC103837770 sugar transport protein 7 from Brassica rapa
31% identity, 82% coverage

• Morphological characteristics and transcriptome analysis at different anther development stages of the male sterile mutant MS7-2 in Wucai (Brassica campestris L.)
  Wang, BMC genomics 2021
  • “...SBT3.1 LOC103837935 BraA09g011690.3C Down SHT spermidine hydroxycinnamoyl transferase-like LOC103874054 BraA06g029650.3C Down SHT spermidine hydroxycinnamoyl transferase-like LOC103837770 BraA09g010490.3C Down STP7 sugar transport protein 7-like LOC103862797 BraA04g000830.3C Down VGDH2 probable pectinesterase/pectinesterase inhibitor VGDH2 LOC103873153 BraA06g018600.3C Up BT2 BTB/POZ and TAZ domain-containing protein 2 LOC103844692 BraA10g000080.3C Up SPL8 squamosa...”

MST3_ORYSJ / Q7EZD7 Sugar transport protein MST3; Monosaccharide transporter 3; OsMST3; Sugar:proton symporter MST3 from Oryza sativa subsp. japonica (Rice) (see paper)
29% identity, 86% coverage

• function: Mediates active uptake of hexoses by sugar:proton symport. Can transport glucose, xylose and 3-O-methylglucose. May be involved in the accumulation of monosaccharides required for cell wall synthesis during root development.

FGSG_04700 hypothetical protein from Fusarium graminearum PH-1
32% identity, 81% coverage

• Relocation of genes generates non-conserved chromosomal segments in Fusarium graminearum that show distinct and co-regulated gene expression patterns
  Zhao, BMC genomics 2014
  • “...9 FGSG_04698 Hypothetical protein - - - 10 FGSG_04699 Hypothetical protein - - - 11 FGSG_04700 MFS monosaccharide transporter FVEG_10988 Fvchr 9 9.16E-83 12 FGSG_04701 ARCA-like protein - - - 13 FGSG_04702 NAD binding oxidoreductase FVEG_10989 Fvchr 9 1.58E-55 14 FGSG_04703 Alcohol dehydrogenase FVEG_13775 Fvchr 10...”

CNAG_06963 sugar transporter from Cryptococcus neoformans var. grubii H99
29% identity, 88% coverage

• Antifungal activity of eumelanin-inspired indoylenepheyleneethynylene against <i>Cryptococcus neoformans</i>
  Conn, Frontiers in microbiology 2023
  • “...Bax inhibitor 1 CNAG_06244 1.988950832 8.28E-292 Hypothetical protein CNAG_03385 PCL103 2.953559223 3.29E-287 G1/S-specific cyclin PCL1 CNAG_06963 3.077006018 7.14E-276 Hexose transporter HXT10 CNAG_06623 1.979003167 9.43E-274 Myo-insitol (putative) CNAG_05741 2.013204228 3.10E-264 Hypothetical protein (from the Thioesterase-like superfamily) CNAG_04183 2.558639688 5.75E-257 Hypothetical protein CNAG_03198 1.552579938 2.75E-254 40S ribosomal protein...”
• Transmembrane transporter expression regulated by the glucosylceramide pathway in Cryptococcus neoformans
  Singh, BMC research notes 2015
  • “...transporter (CNAG_05340), glucose transporter (CNAG_03772), membrane protein (CNAG_03912), membrane transport protein (CNAG_00539), and sugar transporter (CNAG_06963), are membrane-localized and have significantly altered gene expression levels. Therefore, we hypothesize that these genes function either independently or in tandem with a structurally modified cell wall/plasma membrane resulting from...”
  • “...5-GCTTATCTTGCACTTACTGTCCTC-3, reverse: 5-TTTGGGAACAACGAGGTAGG-3; CNAG_03912 (Membrane-protein), forward: 5-GGTTTGCAAGGATTGATGCTTATC-3, reverse: 5-GTACGGTGGGTCAGAAAGGA-3; CNAG_00539 (Membrane-transport-protein), forward: 5-ACGCCGATGGATTATTACTAGC-3, reverse: 5-CGACCTAGCAGTTCCGAAAG-3; CNAG_06963 (Sugar-transporter), forward: 5-TGGTCCTATCGGTGACTACTCT-3, reverse: 5-GCCAACTTGAGACACAAGCA-3; CNAG_05340 (Monosaccharide-transporter), forward: 5-AGGGATCGTTAGCTTTTGGTATG-3, reverse: 5-GGAAAATTGTTCGAGGACGA-3; CNAG_03772 (Glucose-transporter), forward: 5-GGACTGGTGTCAACTTCATTTTC-3, reverse: 5-CGACACCAATGATACCGACA-3; CNAG_00334 (Heat-shock-protein), forward: 5-GAGTCGAGATCATCGCCAAC-3, reverse: 5-TTAACGTCAGCGTCGTCGTA-3; CNAG_03780 (Prcdna95), forward: 5-AAGGGTGTCGTTGCCTTCTAC-3, reverse: 5-ATAGCCAAAACCCTCCATCC-3; CNAG_00092...”
• The glucose sensor-like protein Hxs1 is a high-affinity glucose transporter and required for virulence in Cryptococcus neoformans
  Liu, PloS one 2013
  • “...3 ). The changes of transcription level of other tested HXT homologs, HXT4 (CNAG_06521), HXT6 (CNAG_06963) and HXT7 (CNAG_03432), were not significant (<2 fold). The transcription level of each HXT gene tested was not altered significantly by the lack of HXS1 (<2 fold) when compared to...”

C0PHL2 Monosaccharide transporter1 from Zea mays
29% identity, 85% coverage

• Key factors identified by proteomic analysis in maize (Zea mays L.) seedlings' response to long-term exposure to different phosphate levels
  Sun, Proteome science 2018
  • “...Purple acid phosphatase 2.2 1.84 0.62 A0A1D6KE94 Purple acid phosphatase 2.03 1.67 0.62 Carbohydrate transporters C0PHL2 Monosaccharide transporter 1 1.72 1.33 0.83 K7TK04 Carbohydrate transporter/ sugar porter 4.655 0.61 A0A1D6EP34 Sugar transport protein 14 1.4 0.78 B6TZY0 Facilitated glucose transporter member 8 1.38 0.77 ABC transporters...”
  • “...presented opposite expression patterns under LP and HP conditions (Table 2 ). For carbohydrate transporters, C0PHL2 (monosaccharide transporter1), K7TK04 (carbohydrate transporter/sugar porter), A0A1D6EP34 (sugar transport protein 14) and B6TZY0 (facilitated glucose transporter member 8), were increased under LP condition but suppressed under HP condition in the...”
• Comparative Proteomic and Physiological Analyses of Two Divergent Maize Inbred Lines Provide More Insights into Drought-Stress Tolerance Mechanisms
  Zenda, International journal of molecular sciences 2018
  • “...phosphate pathway 3 C4J0F8 Zm00001d038865 Uncharacterized protein 32.5 4 0.80 0.0090 0.81 0.0465 Ribosome 4 C0PHL2 Zm00001d018627 Monosaccharide transporter1 3.8 1 0.79 0.0051 1.69 0.0495 5 C0HDZ4 Zm00001d009084 SAM-dependent methyltransferase superfamily protein 14.1 2 0.73 0.0218 1.52 0.0245 For full description of the column items, please...”

LOC8155361 sugar transport protein 1 from Sorghum bicolor
28% identity, 89% coverage

• Transcriptome analysis of the impact of exogenous methyl jasmonate on the opening of sorghum florets
  Liu, PloS one 2021
  • “...GTACCCTCCTGGTCACTGCTC AACCACCTTGTTTCCCCTGAT 14 LOC110429834 TTACCTCTCGTTGACACCATC CACACCACATCCTTGCTTTAG 15 LOC8056099 ATTTGGGACCAGGCAGACATT GAGCACCAACAAACGCATCAC 16 LOC8083790 TAGCAAAAGATGTCAGTTTCAAGG GTAATCCCATCGTATTCTTCCAAAA 17 LOC8155361 CCACTTCAAGTTCGGCCTCTT AACCAGTGGGACTTCCAGACG Functional pathway analysis of DEGs Based on the results of DEGs detection, biological pathway classification and enrichment analysis was performed in KEGG. Total of 29,135 unigenes were used...”

Q64L87 Xylhp from Debaryomyces fabryi
31% identity, 81% coverage

• Advances in fungal sugar transporters: unlocking the potential of second-generation bioethanol production
  Pereira, Applied microbiology and biotechnology 2025
  • “...C. intermedia Leandro et al. ( 2006 ); Young et al. ( 2011 ) XylHP Q64L87 Glucose, xylose, galactose, fructose, and mannose D. hansenii Young et al. ( 2011 ) XUT1 A3LY10 Glucose, xylose, D-arabinose, L-arabinose, galactose, fructose, and mannose S. stipitis Young et al. (...”
• Machine learning and comparative genomics approaches for the discovery of xylose transporters in yeast
  Fiamenghi, Biotechnology for biofuels and bioproducts 2022
  • “...sequence alignment followed by comparison with the InterproScan results for Debaryomyces fabryi Xylhp (Uniprot accession Q64L87). Another interesting feature was GFV tripeptides, which are located on transmembrane portions of the transporters, but their direct relation to xylose transport is unclear. Nonetheless, all predicted transporters had this...”
  • “...aligning the xylose transporters and using the sequence of Xylhp from Debaryomyces fabryi (Uniprot accession Q64L87) to predict domains and important sites through Interproscan; then, the non-cytoplasmic domains and probable sugar binding sites were isolated from the alignment and the HMM profile was created. We assumed...”
• Functional survey for heterologous sugar transport proteins, using Saccharomyces cerevisiae as a host
  Young, Applied and environmental microbiology 2011
  • “...or reference YOUNG ET AL. Y. lipolytica A3LY10 Q64L87 xylHP XUT1 B5RUJ3 DEHA2F19140 S. stipitis B5RSN0 DEHA2A14300 P0AGF4 Q6BW54 DEHA2B14278 xylE Q6BTD8 Q2MEV7...”

LOC7486368 sugar transport protein 10 from Populus trichocarpa
30% identity, 82% coverage

• The genetic architecture of trait covariation in Populus euphratica, a desert tree
  Lu, Frontiers in plant science 2023
  • “...is active in mitochondria, organelle envelope and cytoplasm. Q2345(nn_np_11278, Linkage Group 4) is homologous with LOC7486368, the gene encoding sugar transport protein (STP) 10 in Poplus tricocarpa . STP is a plant-specific transport protein, which is responsible for absorbing glucose from the apoplast into plant cells....”

TC 2.A.1.1.40 / Q64L87 The xylose facilitator, Xylhp from Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
31% identity, 80% coverage

• substrates: Xylose

CNC00060 sugar transporter from Cryptococcus neoformans var. neoformans JEC21
29% identity, 88% coverage

• ALL2, a Homologue of ALL1, Has a Distinct Role in Regulating pH Homeostasis in the Pathogen Cryptococcus neoformans
  Jain, Infection and immunity 2016
  • “...2.21 2.02 2.08 2.05 2.03 Transmembrane transport CNC00060 CND05980 CND04690 CNI03510 CNH01210 CNC04510 CNG04630 CNJ01450 CNE01880 CNF01220 CNF00350 CNG01480...”

MST7_ORYSJ / Q94EC3 Sugar transport protein MST7; Monosaccharide transporter 7; OsMST7; Sugar:proton symporter MST7 from Oryza sativa subsp. japonica (Rice) (see paper)
30% identity, 86% coverage

• function: Mediates active uptake of hexoses by sugar:proton symport.

CTRG_00558 conserved hypothetical protein from Candida tropicalis MYA-3404
30% identity, 81% coverage

• Unveiling superior phenol detoxification and degradation ability in <i>Candida tropicalis</i> SHC-03: a comparative study with <i>Saccharomyces cerevisiae</i> BY4742
  Li, Frontiers in microbiology 2024
  • “...CTRG_02833 Uncharacterized MFS-type transporter 1.89 CTRG_04557 Uncharacterized MFS-type transporter 1.72 CTRG_03602 Uncharacterized MFS-type transporter 1.76 CTRG_00558 Uncharacterized MFS-type transporter 1.89 CTRG_04303 Uncharacterized MFS-type transporter 2.15 CTRG_06168 Uncharacterized MFS-type transporter 1.75 Transcription levels of the genes were represented by the values of log 2 (fold change) at...”

M1D4R5 Hexose transporter from Solanum tuberosum
32% identity, 83% coverage

• Enhanced stress resilience in potato by deletion of Parakletos
  Zahid, Nature communications 2024
  • “...M1B1N5 Chlorophyll a-b binding protein 2.4 Q2XPW1 Histone H2B 2.3 M1CN16 Transcription factor RF2b 2.2 M1D4R5 Hexose transporter 2.1 M1C8J8 3-oxoacyl-CoA synthase 2 M1BS09 Poly(RC)-binding protein 2 M0ZNA1 Pre-mRNA-splicing factor cwc23 1.9 Functional test of candidate proteins identifies Parakletos To assess the functional significance of the...”

FVEG_03992 hypothetical protein from Fusarium verticillioides 7600
29% identity, 81% coverage

• Transcriptome changes in Fusarium verticillioides caused by mutation in the transporter-like gene FST1
  Niu, BMC microbiology 2015
  • “...with the yeast ITR1p sequence identified eight genes with high sequence similarity (FVEG_01519, FVEG_01638, FVEG_02081, FVEG_03992, FVEG_06504, FVEG_07757, FVEG_11293, and FVEG_12687). The sequence of FST1 was not identified by the search. Among the eight identified genes, expression was significantly down-regulated in fst1 for FVEG_06504 (named ITR1...”

STP10_ARATH / Q9LT15 Sugar transport protein 10; AtSTP10; D-glucose-H(+) symport protein STP10; D-glucose-proton symporter STP10; Hexose transporter 10 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
TC 2.A.1.1.124 / Q9LT15 The high affinity sugar:H+ symporter (sugar uptake) porter of 514 aas and 12 TMSs, STP10. It transports glucose, galactose and mannose, and is therefore a hexose transporter (Rottmann et al. 2016). The 2.4 from Arabidopsis thaliana
NP_188628 Major facilitator superfamily protein from Arabidopsis thaliana
AT3G19940 sugar transporter, putative from Arabidopsis thaliana
28% identity, 87% coverage

• function: Hexose-H(+) symporter that catalyzes the high-affinity uptake of glucose, galactose and mannose (PubMed:26893494). Proton-coupled symporter responsible for the uptake of glucose from the apoplast into the cells (Probable).
  catalytic activity: D-glucose(out) + H(+)(out) = D-glucose(in) + H(+)(in) (RHEA:69556)
  catalytic activity: D-mannose(out) + H(+)(out) = D-mannose(in) + H(+)(in) (RHEA:69560)
  catalytic activity: D-galactose(in) + H(+)(in) = D-galactose(out) + H(+)(out) (RHEA:29019)
  disruption phenotype: No visible phenotype under normal growth conditions.
• substrates: Galactose, Hexoses, Mannose, glucose
  tcdb comment: Å structure with glucose bound has been solved, explaining high affinity sugar recognition (Paulsen et al. 2019). The results suggest a proton donor/acceptor pair that links sugar transport to proton translocation. It contains a Lid domain, conserved in all sugar transport proteins, that locks the mobile transmembrane domains through a disulfide bridge, and creates a protected environment which allows efficient coupling of the proton gradient to drive sugar uptake (Paulsen et al. 2019)
• Evolutionary balance between foldability and functionality of a glucose transporter
  Choi, Nature chemical biology 2022
  • “...transporter 1 (O97467), Staphylococcus epidermidis Glucose transporter (A0A0H2VG78) and Arabidopsis thaliana Sugar transport protein 10 (Q9LT15). The PDB accession number for structures for these reference proteins are 4ZWC (P11169), 4GBZ (P0AGF4), 6RW3 (O97467), 4LDS (A0A0H2VG78) and 6H7D (Q9LT15). Since the sequences are divergent and therefore difficult...”
  • “...4LDS and 6H7D). Also, The following UniProt IDs were used (P11169, P0AGF4, O97467, A0A0H2VG78 and Q9LT15). Code availability A program, written in LabView, to control the magnetic tweezers apparatus has been deposited in Github ( https://github.com/tyyoonlab/Science_aaw8208 ) and is available at Zenodo (doi:10.5281/zenodo.3528913). Codes for analyzing...”
• Utilization of AlphaFold2 to Predict MFS Protein Conformations after Selective Mutation.
  Xiao, International journal of molecular sciences 2022
  • “...To date, several structures of MFS proteins (UniProt ID: P0AA76, P0AEY8, P0AGF4, P02920, Q6MLJ0, and Q9LT15) have been found in both the outward- and inward-opening conformations [ 9 , 10 , 11 , 12 , 30 , 31 , 32 , 33 , 34 , 35...”
  • “...5AYM) for Q6MLJ0, 0.88 (inward, PDB ID: 7AAR) and 0.75 (outward, PDB ID: 7AAQ) for Q9LT15, and 0.39 (inward, PDB ID: 4ZP0) and 1.95 (outward, PDB ID: 6GV1) for P0AEY8. Most of these predicted structures, including mutants, have approximately 1 or less deviation from the experimentally...”
• Structural comparison of GLUT1 to GLUT3 reveal transport regulation mechanism in sugar porter family
  Custódio, Life science alliance 2021
  • “...), GLUT4 (UniProt P14672 ), rGLUT5 (UniProt P43427 ), bGLUT5 (UniProt P58353 ), atSTP10 (UniProt Q9LT15 ), XylE (UniProt P0AGF4 ), and GlcPse (UniProt A0A0H2VG78 ). Conserved residues are highlighted with gray-scale. Alpha helices as found in GLUT1 are represented above the sequence as colored tubes....”
• SLC22A14 is a mitochondrial riboflavin transporter required for sperm oxidative phosphorylation and male fertility.
  Kuang, Cell reports 2021
  • “...etal., 2019 ) revealed that both the human SLC22A14 and the A.thaliana STP10 (UniProt entry Q9LT15) belonged to the Major facilitator, sugar transporter-like protein family (IPR005828), strengthening our confidence that the correct template had been chosen. Finally, quality of the models was assessed using MolProbity (...”
• Crystal structure of the plant symporter STP10 illuminates sugar uptake mechanism in monosaccharide transporter superfamily
  Paulsen, Nature communications 2019
  • “...plant life. Methods Protein purification The gene encoding the Arabidopsis thaliana protein STP10 (Accession number Q9LT15 [ https://www.uniprot.org/uniprot/Q9LT15 ]) was introduced into an expression construct based on p423_GAL1 40 with a C-terminal purification tag containing a thrombin cleavage site and a deca-histidine tag. The primers used...”
• Molecular mechanism of sugar transport in plants unveiled by structures of glucose/H+ symporter STP10.
  Bavnhøj, Nature plants 2021 (PubMed)
  • GeneRIF: Molecular mechanism of sugar transport in plants unveiled by structures of glucose/H(+) symporter STP10.
• STP10 encodes a high-affinity monosaccharide transporter and is induced under low-glucose conditions in pollen tubes of Arabidopsis.
  Rottmann, Journal of experimental botany 2016
  • GeneRIF: A high-affinity glucose uptake system is induced in growing pollen tubes under low glucose conditions and that this regulation may occur through the hexokinase pathway. [AtSTP10]
• Phaseolus vulgaris STP13.1 is an H⁺-coupled monosaccharide transporter, present in source leaves and seed coats, with higher substrate affinity at depolarized potentials
  Pegler, Plant direct 2024
  • “...is presented as the mean standard error. Figure S1: Amino acid sequence alignment of AtSTP10 (At3g19940), AtSTP13 (At5G26340) BvSTP13 (Bevul.3G139500), MdSTP13a (MD13G1189100), MtSTP13.1 (Medtr5g006070), MtSTP13.2 (Medtr1g104780), PvSTP13.1 (Phvul.002G046800), PvSTP13.2 (Phvul.007G055100) and TaSTP13 (Traes_4DL_CFC191A06). Amino acid residues encased in a red box indicate residues participating in AtSTP10...”
• Calmodulin-Domain Protein Kinase PiCDPK1 Interacts with the 14-3-3-like Protein NtGF14 to Modulate Pollen Tube Growth
  Scheible, Plants (Basel, Switzerland) 2024
  • “...Epsin family of endocytic proteins Accessory proteins that facilitate vesicle biogenesis [ 41 ] A0A1S4AFS9 AT3G19940 Sugar Transport Protein 10 Sugar Transport Protein Glucose uptake in growing pollen tubes [ 42 ] A0A1S4AKF1 AT1G16010 Magnesium Transporter 2 Transmembrane magnesium transporter Tonoplast-targeted transporter for vacuolar accumulation of...”
• Exploring the genic resources underlying metabolites through mGWAS and mQTL in wheat: From large-scale gene identification and pathway elucidation to crop improvement
  Chen, Plant communications 2021
  • “...behind the accumulation of the metabolite sucrose ( Chen etal., 2020 ). Their orthologin Arabidopsis AT3G19940 , which is also known as STP10 , encodes a high-affinity hexose transporter ( Rottmann etal., 2016 ). These examples thus collectively demonstrate that the approach enables us to identify...”
• Plant glucose transporter structure and function
  Geiger, Pflugers Archiv : European journal of physiology 2020
  • “...developed pollen grain Plasma membrane Glucose, galactose, arabinose High [ 122 , 131 ] AtSTP10 At3g19940 Germinating pollen and growing pollen Plasma membrane Glucose, galactose, mannose, High [ 109 , 122 , 124 ] AtSTP11 At5g23270 Fully mature pollen and growing pollen tubes Plasma membrane Glucose,...”
• Metabolite-based genome-wide association study enables dissection of the flavonoid decoration pathway of wheat kernels
  Chen, Plant biotechnology journal 2020
  • “...respectively. The top hit of these candidates ( TraesCS4B01G371700 and TraesCS4D01G365800 ) in Arabidopsis ( AT3G19940 , also known as SPT10 ) encodes a highaffinity hexose transporter carrying glucose and other monosaccharides (Paulsen et al. , 2019 ; Rottmann et al. , 2016 ). Similarly, for...”
• Genome-Wide Identification and Expression Profiling of Sugar Transporter Protein (STP) Family Genes in Cabbage (Brassica oleracea var. capitata L.) Reveals their Involvement in Clubroot Disease Responses
  Zhang, Genes 2019
  • “...Bol014014 Scaffold000180 MF2 1551 516 56.15 6.89 33.77 101.67 0.54 cell membrane tPCK2 F AtSTP10 AT3G19940 1545 514 BoSTP10 Bol000549 Scaffold000531 MF1 1536 511 56.16 8.60 30.51 97.50 0.48 cell membrane tPCK7 Q AtSTP11 AT5G23270 1545 514 BoSTP11 Bol017091 C06 LF 1569 522 57.17 5.79 33.58...”
• Transcriptomic and proteomic approach to identify differentially expressed genes and proteins in Arabidopsis thaliana mutants lacking chloroplastic 1 and cytosolic FBPases reveals several levels of metabolic regulation
  Soto-Suárez, BMC plant biology 2016
  • “...: Table S4). Sugar transporter 2 (At1g07340) and three sugar transporter family proteins (At3g05155, At4g04760, At3g19940) were up-regulated in cyfbp rosettes, and only a mannitol transporter (At2g20780) was down-regulated. Finally, a carbohydrate transmembrane transporter (At1g08930) and two UDP-galactose transporters (At4g23010 and At3g59360) were up-regulated in cyfbp...”
• STP10 encodes a high-affinity monosaccharide transporter and is induced under low-glucose conditions in pollen tubes of Arabidopsis
  Rottmann, Journal of experimental botany 2016
  • “...microarray data furthermore indicate a rather high expression of the so far uncharacterized STP10 ( At3g19940 ) in pollen tubes. In the present paper, we describe the detailed characterization of the Arabidopsis monosaccharide transporter gene STP10 , which is expressed in pollen tubes and also in...”
• More

TC 2.A.1.1.50 / Q94AZ2 The glucose/fructose:H+ symporter, STP13 (sugar transport protein 13). Expressed in vascular tissues and induced during programmed cell death from Arabidopsis thaliana (Mouse-ear cress) (see 6 papers)
STP13 / RF|NP_198006.1 sugar transport protein 13 from Arabidopsis thaliana (see paper)
NP_198006 Major facilitator superfamily protein from Arabidopsis thaliana
AT5G26340 MSS1; carbohydrate transmembrane transporter/ hexose:hydrogen symporter/ high-affinity hydrogen:glucose symporter/ sugar:hydrogen symporter from Arabidopsis thaliana
30% identity, 91% coverage

• substrates: H+, fructose, glucose
  tcdb comment: Used to combat bacterial infection by competing with them for sugars by phosphorylation of STP13 by the BAK1 receptor kinase (Yamada et al. 2016)
• Transcriptional activation of SUGAR TRANSPORT PROTEIN 13 mediates biotic and abiotic stress signaling.
  Lee, Plant signaling & behavior 2021
  • GeneRIF: Transcriptional activation of SUGAR TRANSPORT PROTEIN 13 mediates biotic and abiotic stress signaling.
• Regulation of sugar transporter activity for antibacterial defense in Arabidopsis.
  Yamada, Science (New York, N.Y.) 2016 (PubMed)
  • GeneRIF: Stimulation of STP13 activity suppresses bacterial effector delivery, thereby reducing bacterial virulence.
• Expression of Arabidopsis sugar transport protein STP13 differentially affects glucose transport activity and basal resistance to Botrytis cinerea.
  Lemonnier, Plant molecular biology 2014 (PubMed)
  • GeneRIF: This study showed that STP13-deficient plants exhibited an enhanced susceptibility to B. cinerea and a reduced rate of glucose uptake.
• Monosaccharide absorption activity of Arabidopsis roots depends on expression profiles of transporter genes under high salinity conditions.
  Yamada, The Journal of biological chemistry 2011
  • GeneRIF: The results indicate that STP13 can reabsorb the monosaccharides that are released by damaged cells under high salinity conditions.
• Over-expression of STP13, a hexose transporter, improves plant growth and nitrogen use in Arabidopsis thaliana seedlings.
  Schofield, Plant, cell & environment 2009 (PubMed)
  • GeneRIF: Transgenic seedlings over-expressing STP13 had increased rates of glucose uptake, higher endogenous sucrose levels, accumulated more total C and biomass per plant, and and had higher levels of expression of the nitrate transporter NRT2.2.
• Differential Gene Expression Reveals Candidate Genes for Drought Stress Response in Abies alba (Pinaceae)
  Behringer, PloS one 2015
  • “...Q0DKW8 O . sativa subsp . japonica 5.63 STP13 - Sugar transport protein 13 - Q94AZ2 A . thaliana 5.52 RHA2A - E3 ubiquitin-protein ligase RHA2A a Q9ZT50 A . thaliana 5.36 GOLS1 - Galactinol synthase 1 - Q947G8 Solanum lycopersicum 4.94 LEA14-A a - LEA...”
• A comprehensive resource of drought- and salinity- responsive ESTs for gene discovery and marker development in chickpea (Cicer arietinum L.)
  Varshney, BMC genomics 2009
  • “...42 ]. The presence of protective compound such as 'sugar transport protein 13' (UniProt ID: Q94AZ2) during water stress conditions [ 43 ] in this cluster suggests a protective reaction to osmotic stress in sensitive genotypes as compared with tolerant genotypes. Similarly, the occurrence of 'glycine-rich...”
• Phaseolus vulgaris STP13.1 is an H⁺-coupled monosaccharide transporter, present in source leaves and seed coats, with higher substrate affinity at depolarized potentials
  Pegler, Plant direct 2024
  • “...as the mean standard error. Figure S1: Amino acid sequence alignment of AtSTP10 (At3g19940), AtSTP13 (At5G26340) BvSTP13 (Bevul.3G139500), MdSTP13a (MD13G1189100), MtSTP13.1 (Medtr5g006070), MtSTP13.2 (Medtr1g104780), PvSTP13.1 (Phvul.002G046800), PvSTP13.2 (Phvul.007G055100) and TaSTP13 (Traes_4DL_CFC191A06). Amino acid residues encased in a red box indicate residues participating in AtSTP10 binding of...”
• Comparison of the Effects of UV-C Light in the Form of Flash or Continuous Exposure: A Transcriptomic Analysis on <i>Arabidopsis thaliana</i> L
  Jazayeri, International journal of molecular sciences 2024
  • “...SURVIVAL 1 1.55 2.97 10 3 AT5G10380 RING1 RING/U-box superfamily protein 1.28 6.18 10 5 AT5G26340 MSS1 Major facilitator superfamily protein 1.20 4.13 10 3 AT5G50260 CEP1 Cysteine endopeptidase 1 1.99 7.10 10 3 ijms-25-13718-t005_Table 5 Table 5 The DEGs assigned to HSPs, HSFs, and their...”
• Identification and expression profiling of proline metabolizing genes in Arabidopsis thaliana and Oryza sativa to reveal their stress-specific transcript alteration
  Arabia, Physiology and molecular biology of plants : an international journal of functional plant biology 2021
  • “...F-box family protein (At2g27310), STP13 (At5g26340), alpha/betaHydrolases (At2g39420), kinase (At1g74360), Thioredoxin superfamily protein (At1g28480) Chl...”
• Membrane nanodomains and transport functions in plant
  Martinière, Plant physiology 2021
  • “...cell cultures Yoshida et al., 2013 Sugar Sugar transporter protein (STP) AT1G11260 (STP1); AT3G19930 (STP4); AT5G26340 (STP13) Whole plant/suspension cell cultures/leaves Minami et al., 2009 ; Keinath et al., 2010 ; Demir et al., 2013 Sugar (continued) Sucrose transporter (SUT) AT1G22710 (SUT1) Leaves Demir et al.,...”
• Leaf nodule endosymbiotic Burkholderia confer targeted allelopathy to their Psychotria hosts
  Georgiou, Scientific reports 2021
  • “...(AT2G36190), cwinv5 (AT3G13784), cwinv6 (AT5G11920), cinv1-4 (AT1G35580), cinv1-8 ( AT1G35580), cinv2 (AT4G09510), stp1-1 (AT1G11260), stp13-1 (AT5G26340) and the double mutants stp1 stp13 and stp1 stp4 were kindly provided by Diana Santelia (ETH Zurich, Switzerland); prc1 (AT5G64740) , cev1 (AT5G05170) and rsw1 (AT4G32410) were obtained from Clara...”
• Transcriptome analysis of Rafflesia cantleyi flower stages reveals insights into the regulation of senescence
  Mohd-Elias, Scientific reports 2021
  • “...Target of rapamycin (TOR) AT1G50030 Promote UN013404 ABC transporter AT5G06530 Unclear UN004449 Sugar transporter 14 AT5G26340 Unclear UN026074 Nitrate transporter AT1G32450 Unclear UN015723 Polyamine transporter AT1G31830 Unclear Redox regulation UN004263 Catalase (CAT) AT1G20630 Unclear UN012078 Superoxide dismutase (SOD) AT3G56350 Unclear UN037470 L-Ascorbate oxidase (ASO) AT1G76160 Unclear...”
• Transcriptome analysis of Pará rubber tree (H. brasiliensis) seedlings under ethylene stimulation
  Nakano, BMC plant biology 2021
  • “...bx012963 AT5G61520 AtSTP3 2.52 1.96 0.72 0 bx006914 AT5G26250 AtSTP8 1.85 0.26 2.76 1 bx027564 AT5G26340 AtSTP13 5.35 5.31 2.58 2 bx055460 AT1G77210 AtSTP14 3.04 3.23 2.81 H+-Symporter family for polyols and monosaccharides (plasma membrane) 0 bx046600 AT2G18480 AtPLT3 6.25 6.26 6.34 Putative monosaccharide transporter family...”
• Dynamic Development of White Lupin Rootlets Along a Cluster Root
  Le, Frontiers in plant science 2021
  • “...(HKT1) Potassium Profile 5 Lalb_Chr09g0332731 AT4G23700 Cation/H + exchanger 17 (CHX17) Sodium Profile 5 Lalb_Chr05g0210921 AT5G26340 Sugar transport protein 13 (STP13) Sugar Profile 6 Lalb_Chr06g0160591 AT5G26340 Sugar transport protein 13 (STP13) Sugar Profile 5 Lalb_Chr20g0123111 AT1G22150 Sulfate transporter 1;3 (Sultr1;3) Sulfate Profile 4 Lalb_Chr01g0018841 AT2G16850 Plasma...”
• More

CNAG_07641 monosaccharide transporter from Cryptococcus neoformans var. grubii H99
28% identity, 89% coverage

• Galectin-3 impacts Cryptococcus neoformans infection through direct antifungal effects
  Almeida, Nature communications 2017
  • “...partial XM_012192132.1 2.80 0.0000 8.7 61.1 CNAG_03876 Ras family protein XM_012194860.1 2.74 0.0000 1.3 9.1 CNAG_07641 Monosaccharide transporter XM_012194944.1 2.73 0.0000 106.2 709.0 CNAG_05685 Neutral amino acid transporter XM_012194030.1 2.72 0.0000 5.6 37.0 CNAG_01252 Thiosulfate/3-mercaptopyruvate sulfurtransferase XM_012191185.1 2.72 0.0000 1089.1 7234.7 CNAG_00162 Alternative oxidase, mitochondrial XM_012192590.1...”

Afu3g00430 high-affinity glucose transporter, putative from Aspergillus fumigatus Af293
30% identity, 81% coverage

• Sub-telomere directed gene expression during initiation of invasive aspergillosis
  McDonagh, PLoS pathogens 2008
  • “...transporter 3.497276152 Afu2g09030 secreted dipeptidyl peptidase 2.4191786 Afu3g12010 high-affinity hexose transporter 3.821050502 Afu6g11500 dipeptidase 2.8865489 Afu3g00430 high-affinity glucose transporter Antigens 3.2509899 Afu8g04480 hexose transporter protein 5.642295426 Afu4g09320 antigenic dipeptidyl-peptidase Dpp4 3.6472387 Afu6g06730 l-fucose permease 4.316438927 Afu4g00870 antigenic cell wall galactomannoprotein Amino acid transport 7.128239041 Afu4g09580 major...”

An04g10090 uncharacterized protein from Aspergillus niger
30% identity, 79% coverage

• Comprehensive annotation of secondary metabolite biosynthetic genes and gene clusters of Aspergillus nidulans, A. fumigatus, A. niger and A. oryzae
  Inglis, BMC microbiology 2013
  • “...- An04g09650 An04g09420 - An04g09600 An04g09510 - An04g09570 ECS ECS An04g10030 cluster An04g10030 An04g09890 - An04g10090 An04g09900 - An04g10100 - n/a n/a An05g01060 cluster An05g01060 An05g01020 - An05g01120 An05g00930 - An05g01140 An05g01060 - An05g01120 ECS ECS An06g01300 cluster An06g01300 An06g01290 - An06g01410 An06g01200 - An06g01390 An06g01290...”

I9W82_001057 HGT1 from Candida metapsilosis
30% identity, 85% coverage

• The Emerging Pathogen <i>Candida metapsilosis</i>: Biological Aspects, Virulence Factors, Diagnosis, and Treatment
  Gómez-Gaviria, Infection and drug resistance 2024
  • “...Nrg1 I9W82_004271 CORT_0F01430 CPAR2_300790 5e-42 93 Tup1 I9W82_001169 CORT_0B10590 CPAR2_109520 0 79 Immune evasion Hgt1 I9W82_001057 CORT_0B09440 CPAR2_108370 0 90 Msb2 I9W82_004931 CORT_0A09600 CPAR2_210290 5e-92 70 Pra1 No found No found No found - - Phospholipase and proteinase Lip5-8 I9W82_003269 I9W82_002019 CORT_0G03370 CORT_0B01380 CPAR2_703200 CPAR2_501220 0...”

STP1_ARATH / P23586 Sugar transport protein 1; Glucose transporter; Hexose transporter 1 from Arabidopsis thaliana (Mouse-ear cress) (see 8 papers)
TC 2.A.1.1.60 / P23586 The major hexose transporter, Htr1 (mediates the active uptake of hexoses by sugar:H+ symport. Can transport glucose, 3-O-methylglucose, fructose, xylose, mannose, galactose, fucose, 2-deoxyglucose and arabinose. Confers sensitivity to galactose in seedlings. Km=20 uM for glucose) from Arabidopsis thaliana (Mouse-ear cress) (see 14 papers)
STP1 / RF|NP_172592.1 sugar transport protein 1 from Arabidopsis thaliana (see paper)
NP_172592 sugar transporter 1 from Arabidopsis thaliana
AT1G11260 STP1 (SUGAR TRANSPORTER 1); carbohydrate transmembrane transporter/ sugar:hydrogen symporter from Arabidopsis thaliana
29% identity, 87% coverage

• function: Major hexose transporter. Mediates an active uptake of hexoses, by sugar/hydrogen symport. Can transport glucose, 3-O- methylglucose, fructose, xylose, mannose, galactose, fucose, 2- deoxyglucose and arabinose. Confers sensitivity to galactose in seedlings.
• substrates: Hexoses
• Sugar Transporter Protein 1 (STP1) contributes to regulation of the genes involved in shoot branching via carbon partitioning in Arabidopsis.
  Otori, Bioscience, biotechnology, and biochemistry 2019 (PubMed)
  • GeneRIF: Sugar Transporter Protein 1 (STP1) contributes to regulation of the genes involved in shoot branching via carbon partitioning in Arabidopsis
• Sugar regulation of SUGAR TRANSPORTER PROTEIN 1 (STP1) expression in Arabidopsis thaliana.
  Cordoba, Journal of experimental botany 2015
  • GeneRIF: STP1 transcript levels decrease more rapidly after the addition of low concentrations of sugars than the levels of other repressed genes. This regulation is exerted at the transcriptional level and is initiated by phosphorylatable sugars.
• Do mitochondria use efflux pumps to protect their ribosomes from antibiotics?
  Islam, Microbiology (Reading, England) 2023
  • “...4.1E^183# Q42093, 7.4E^205 O15439, 3.6E^213 [ 73 ] HXT2 High-affinity glucose transporter MFS|| KGR01337.1, 0** P23586, 1 .9E^54 Q96QE2, 6.5E^41 [ 40, 73 ] JEN1 Carboxylic acid transporter protein homologue MFS KGU09375.1, 9E^121** Q9SYQ1, 0.00014 A0A286YF51, 0.0019 [ 73 ] TPO1 Polyamine transporter 1 MFS G1UAY0,...”
  • “...7.8E^6 A0A1P8ATY7, 6.7E^12 Q8WW24, 1.4E^14 [ 79, 112 ] HXT13, NCU01633 Q1K4S3 MFS Q8J2J7, 2.1E^85 P23586, 1.2E^52 P11168, 2.6E^48 [ 79 ] NCU04809 Q756M6 MFS T2AWG3, 0.0014 Q8GYF4, 1.4E^24 B3KT41, 0.0022 [ 79 ] NCU09551 Q7S2B0 MFS G1UAY0, 2.3E^6 Q56ZZ7, 2.3E^7 Q8NBP5, 8.4E^9 [ 78 ]...”
• Plasma membrane aquaporins mediates vesicle stability in broccoli
  Martínez-Ballesta, PloS one 2018
  • “...585 64379,59 Peptide transporter PTR2 2,22 1 P83970 951 104618,27 Plasma membrane ATPase 2,42 3 P23586 522 57572,98 Sugar transport protein 1 2,30 Q9SZN1 487 54270,67 V-type proton ATPase subunit B2 2,87 1 O82226 747 85386,45 Cyclic nucleotide-gated ion channel 6 1,87 9 Cell growth and...”
• Microsome-associated proteome modifications of Arabidopsis seedlings grown on board the International Space Station reveal the possible effect on plants of space stresses other than microgravity
  Mazars, Plant signaling & behavior 2014
  • “...0.549 phosphatidylserine decarboxylase 3 Q9SZP6 AT4G38690 0.554 1-phosphatidylinositol phosphodiesterase-related protein Q8LDH5 0.585 endomembrane-associated protein Transporters P23586 AT1G11260 0.370 sugar transporter 1 Q8LGU1 AT3G21250 0.456 multidrug resistance-associated protein 6 Q56ZZ7 AT5G16150 0.523 Plastidic glucose transporter 4 Q53XH7 AT5G62670 0.553 H(+)-ATPase 11 Q94FB9 AT4G39850 0.559 ABC transporter D...”
• Proton-coupled sugar transport in the prototypical major facilitator superfamily protein XylE
  Wisedchaisri, Nature communications 2014
  • “...IolT (O34718); Arabidopsis thaliana inositol/H + symporter INT1 (Q8VZR6); Arabidopsis thaliana hexose/H + symporter STP1 (P23586); Parachlorella kessleri hexose/H + symporter HUP1 (P15686); Homo sapiens facilitated glucose transporter GLUT12 (Q8TD20); Homo sapiens H + /myo-inositol transporter GLUT13 (HMIT) (Q96QE2); Homo sapiens facilitated glucose transporter GLUT2 (P11168);...”
• Major facilitator superfamily
  Pao, Microbiology and molecular biology reviews : MMBR 1998
  • “...541 Accession no. Databaseb S38435 U43629 S25015 U38651 L08196 P23586 S25009 PIR GB PIR GB GB SP PIR U23453 Z69787 Z68296 Z68215 U41532 Z70683 U28737 Z66522...”
• Starch metabolism in guard cells: At the intersection of environmental stimuli and stomatal movement
  Dang, Plant physiology 2024
  • “...AT4G30190 GBF2 Gramene: AT4G01120 GBF2 Araport: AT4G01120 PHOT1 Gramene: AT3G45780 PHOT1 Araport: AT3G45780 STP1 Gramene: AT1G11260 STP1 Araport: AT1G11260 STP4 Gramene: At3g19930 STP4 Araport: At3g19930 AMY3 Gramene: AT1G69830 AMY3 Araport: AT1G69830 HXK1 Gramene: AT4G29130 HXK1 Araport: AT4G29130 BIK1 Gramene: AT2G39660 BIK1 Araport: AT2G39660 SUS3 Gramene: AT4G02280...”
• AlteredArabidopsis thalianasugar metabolism affects exudation, immune responses, and plant-microbe interactions
  Siffert, 2024
• Metabolome and Transcriptome Association Analysis Reveals Mechanism of Synthesis of Nutrient Composition in Quinoa (Chenopodium quinoa Willd.) Seeds
  Yang, Foods (Basel, Switzerland) 2024
  • “...in the carbon output of Arabidopsis thaliana [ 67 ]. The gene LOC110687202 (homologous gene AT1G11260) encodes a high-affinity sugar transporter in Arabidopsis thaliana, which is highly down-regulated and can transport a variety of hexose [ 68 ]. The sugar transporter encoded in quinoa is up-regulated,...”
• Genetic Determinants of Fiber-Associated Traits in Flax Identified by Omics Data Integration
  Kanapin, International journal of molecular sciences 2022
  • “...domain-containing protein 47 AT3G04070, anac047, NAC047 [ 69 ] transcription factor Lus10042516 sugar transporter 1 AT1G11260, STP1 [ 97 ] H+/monosaccharide cotransporter Chr9:18121668 Lus10029638 Lus10029639 GDSL-like lipase/acylhydrolase superfamily protein AT1G54790 [ 98 , 99 , 100 ] growth, biotic stress response, in cotton the GDSL (GhGDSL)...”
• Comparative transcriptomics reveals commonalities and differences in the genetic underpinnings of a floral dimorphism
  Potente, 2022
• Comparative transcriptomics reveals commonalities and differences in the genetic underpinnings of a floral dimorphism
  Potente, Scientific reports 2022
  • “...and comprised, among others, pveT_jg31090, homologous to A. thaliana Sugar Transporter 1 ( STP1 ; AT1G11260). Figure 4 Differential expression analysis in Primula . ( a ) Bar-plot showing the enriched GO terms among down-regulated DEGs in the P. veris style, ordered bottom-up by increasing adjusted...”
• Membrane nanodomains and transport functions in plant
  Martinière, Plant physiology 2021
  • “...(NAP) AT1G67940 (NAP3) Suspension cell cultures Yoshida et al., 2013 Sugar Sugar transporter protein (STP) AT1G11260 (STP1); AT3G19930 (STP4); AT5G26340 (STP13) Whole plant/suspension cell cultures/leaves Minami et al., 2009 ; Keinath et al., 2010 ; Demir et al., 2013 Sugar (continued) Sucrose transporter (SUT) AT1G22710 (SUT1)...”
• Leaf nodule endosymbiotic Burkholderia confer targeted allelopathy to their Psychotria hosts
  Georgiou, Scientific reports 2021
  • “...(AT1G55120), cwinv4 (AT2G36190), cwinv5 (AT3G13784), cwinv6 (AT5G11920), cinv1-4 (AT1G35580), cinv1-8 ( AT1G35580), cinv2 (AT4G09510), stp1-1 (AT1G11260), stp13-1 (AT5G26340) and the double mutants stp1 stp13 and stp1 stp4 were kindly provided by Diana Santelia (ETH Zurich, Switzerland); prc1 (AT5G64740) , cev1 (AT5G05170) and rsw1 (AT4G32410) were obtained...”
• More

CPAR2_108370 uncharacterized protein from Candida parapsilosis
30% identity, 85% coverage

• The Emerging Pathogen <i>Candida metapsilosis</i>: Biological Aspects, Virulence Factors, Diagnosis, and Treatment
  Gómez-Gaviria, Infection and drug resistance 2024
  • “...CORT_0F01430 CPAR2_300790 5e-42 93 Tup1 I9W82_001169 CORT_0B10590 CPAR2_109520 0 79 Immune evasion Hgt1 I9W82_001057 CORT_0B09440 CPAR2_108370 0 90 Msb2 I9W82_004931 CORT_0A09600 CPAR2_210290 5e-92 70 Pra1 No found No found No found - - Phospholipase and proteinase Lip5-8 I9W82_003269 I9W82_002019 CORT_0G03370 CORT_0B01380 CPAR2_703200 CPAR2_501220 0 74 Sap1-3...”
• Candida parapsilosis Mdr1B and Cdr1B Are Drivers of Mrr1-Mediated Clinical Fluconazole Resistance
  Doorley, Antimicrobial agents and chemotherapy 2022 (secret)

SS1G_09293 hypothetical protein from Sclerotinia sclerotiorum 1980 UF-70
28% identity, 91% coverage

• Changes in the Sclerotinia sclerotiorum transcriptome during infection of Brassica napus
  Seifbarghi, BMC genomics 2017
  • “...- - - - 11.8 SS1G_08982 MFS quinate transporter - - - - 18.9 26.1 SS1G_09293 MFS quinate transporter - - - - 3.5 2.9 SS1G_08981 MFS quinate transporter - - - - 49.3 38.4 SS1G_00139 MFS carbohydrate transporter - 3.1 2.2 2.0 - - SS1G_04149...”

7aaqA / Q9LT15 Sugar/h+ symporter stp10 in outward occluded conformation (see paper)
28% identity, 85% coverage