PaperBLAST
PaperBLAST Hits for SwissProt::Q1M0P5 Cystathionine gamma-synthase; CGS; O-succinylhomoserine (thiol)-lyase; EC 2.5.1.48 (Helicobacter pylori (Campylobacter pylori)) (380 a.a., MHMQTKLIHG...)
Show query sequence
>SwissProt::Q1M0P5 Cystathionine gamma-synthase; CGS; O-succinylhomoserine (thiol)-lyase; EC 2.5.1.48 (Helicobacter pylori (Campylobacter pylori))
MHMQTKLIHGGISEDATTGAVSVPIYQTSTYRQDAIGHHKGYEYSRSGNPTRFALEELIA
DLEGGVKGFAFASGLAGIHAVFSLLQSGDHVLLGDDVYGGTFRLFNKVLVKNGLSCTIID
TSDLSQIKKAIKPNTKALYLETPSNPLLKITDLAQCASVAKDHGLLTIVDNTFATPYYQN
PLLLGADIVVHSGTKYLGGHSDVVAGLVTTNNEALAQEIAFFQNAIGGVLGPQDSWLLQR
GIKTLGLRMQAHQKNALCVAEFLEKHPKVERVYYPGLPTHPNYELAKKQMRGFSGMLSFT
LKNDSEATPFVESLKLFILGESLGGVESLVGVPAFMTHACIPKTQREAAGIRDGLVRLSV
GIEHEQDLLEDLEQAFAKIS
Running BLASTp...
Found 250 similar proteins in the literature:
METB_HELPX / Q1M0P5 Cystathionine gamma-synthase; CGS; O-succinylhomoserine (thiol)-lyase; EC 2.5.1.48 from Helicobacter pylori (Campylobacter pylori) (see paper)
Q1M0P5 cystathionine gamma-synthase (EC 2.5.1.48) from Helicobacter pylori (see paper)
100% identity, 100% coverage
- function: Catalyzes the formation of L-cystathionine from O-succinyl-L- homoserine (OSHS) and L-cysteine, via a gamma-replacement reaction (By similarity). In the absence of thiol, catalyzes gamma-elimination to form 2-oxobutanoate, succinate and ammonia.
catalytic activity: O-succinyl-L-homoserine + L-cysteine = L,L-cystathionine + succinate + H(+) (RHEA:20397)
cofactor: pyridoxal 5'-phosphate (Binds 1 pyridoxal phosphate per subunit.)
subunit: Homotetramer.
metB / P56069 cystathionine gamma-lyase (EC 4.4.1.1) from Helicobacter pylori (strain ATCC 700392 / 26695) (see 2 papers)
P56069 Cystathionine gamma-synthase from Helicobacter pylori (strain ATCC 700392 / 26695)
HP0106 cystathionine gamma-synthase (metB) from Helicobacter pylori 26695
98% identity, 100% coverage
- Outer Membrane Vesicles Secreted by Helicobacter pylori Transmitting Gastric Pathogenic Virulence Factors
Wei, ACS omega 2022 - “...P96551 gltX1 199 O25684 HP_1043 200 O24886 fcl 201 O25671 fur 202 P66572 rpsE 203 P56069 metB 204 O25607 HP_0953 205 O25029 rhpA 206 O25756 AtpH 207 O25530 RfaD 208 P48285 eno 209 P66052 rplK 210 O25625 HP_0973 211 O25728 hcpC 212 P56089 glyA 213 O25729...”
- “...O25336 ligA 287 O25489 HP_0809 288 P56044 rplS 289 O26004 ilvE 290 P55971 gapA 291 P56069 metB 292 O25289 HP_0565 293 P56086 atpF 294 P48285 eno 295 O25152 CheW 296 O24946 SdaC 297 P56197 aroA 298 O25297 HP_0573 299 O25397 HP_0688 300 O25990 HP_1451 301 O24865...”
- Identification and functional analysis of the gene encoding methionine-gamma-lyase in Brevibacterium linens
Amarita, Applied and environmental microbiology 2004 - “...CGS_Bl (NP696324) CGS_Cg (NP601644) CGS_Cp (BAB79882) CGS_Hp (P56069) CGS_Sa (BAB41649) CGL_Hs (AAB24700) CGL_Rn (AAK52091) CGL_Ce (NP_495449) 41 Sequence of...”
- Molecular and functional analyses of the metC gene of Lactococcus lactis, encoding cystathionine beta-lyase
Fernández, Applied and environmental microbiology 2000 - “...from the following GenBank accession numbers: P56069 (Helicobacter pylori cystathionine -synthase [CGS-HPYL]), U93874 (B. subtilis cystathionine -lyase...”
- Delineation of the pH-Responsive Regulon Controlled by the Helicobacter pylori ArsRS Two-Component System
Loh, Infection and immunity 2021 (secret) - Carbon Fixation Driven by Molecular Hydrogen Results in Chemolithoautotrophically Enhanced Growth of Helicobacter pylori
Kuhns, Journal of bacteriology 2016 - “...HP0380 HP0309 HP0632 HP0485 HP1454 HP0468 HP0204 HP0106 HP0492 HP1262 HP1346 Phenylalanyl-tRNA synthetase, beta subunit (PheT) Cell division protein (FtsY)...”
- Sequence divergence and conservation in genomes of Helicobacter cetorum strains from a dolphin and a whale
Kersulyte, PloS one 2013 - “...Type II restriction enzyme M protein (HsdM) HP0104 HEL2216 2,3-cyclic-nucleotide 2-phosphodiesterase HP0105 HEL2077 S-ribosylhomocysteinase (LuxS) HP0106 HEL2078 Cystathionine gamma-synthase/cystathionine beta-lyase (MetB HP0309 HEL2219 N-carbomoyl-D-amino acid amidohydrolase (2) HP0311 HEL2220 Hypothetical protein HP0312 HEL2221 ATP-binding protein HP0338 HEL2222 Hypothetical protein HP0614 HEL2224 Hypothetical protein HP0630 HEL2096 NAD(P)H-quinone...”
- Analysis of Helicobacter pylori cagA promoter elements required for salt-induced upregulation of CagA expression
Loh, Infection and immunity 2012 - “...paralog MdaB FrxA GalU Pfr NrdA NusA PlpA HP0010 HP0106 HP0178 HP0197 HP0221 HP0289 HP0377 HP0516 HP0601 HP0609 HP0630 HP0642 HP0646 HP0653 HP0680 HP1514 HP1564...”
- Analysis of protein expression regulated by the Helicobacter pylori ArsRS two-component signal transduction system
Loh, Journal of bacteriology 2010 - “...1.51 0.005 1.47 0.006 HP0624 HP0090 HP0651 HP1453 HP0162 HP0106 HP0089 HP0238 HP1573 a Experiment 1 tested strains J99A and J99A (arsS::kan) (acid exposure for...”
- Quantitative effect of luxS gene inactivation on the fitness of Helicobacter pylori
Lee, Applied and environmental microbiology 2006 - “...3 end of hp0106 5-ATCCTTGTCAAGCCGTTATTGG 5-TTCAATAGCTATAAATTATTTAATAAGTA AGTGGTCTGAAGTGGGGGTTTGA 5-TTACTTATTAAATAATTTATAGCTATTGAA 5-CAATAATCGCATCAGATTGCAGTA...”
- Characterization of the ArsRS regulon of Helicobacter pylori, involved in acid adaptation
Pflock, Journal of bacteriology 2006 - “...HP0069 HP0070 HP0071 HP0072 HP0073 HP0294 HP1238 HP0106 HP0380 HP0755 JHP0062 JHP0063 JHP0064 JHP0065 JHP0066 JHP0067 JHP0068 JHP0279 JHP1159 JHP0098 JHP1001...”
- Expanded metabolic reconstruction of Helicobacter pylori (iIT341 GSM/GPR): an in silico genome-scale characterization of single- and double-deletion mutants
Thiele, Journal of bacteriology 2005 - “...HP1189 (ASAD) ................................................................................................................HP0106 (METB1r), HSERTA HP1227,...”
- More
4l0oH / P56069 Structure determination of cystathionine gamma-synthase from helicobacter pylori
96% identity, 100% coverage
- Ligand: pyridoxal-5'-phosphate (4l0oH)
jhp0098 putative CYSTATHIONINE GAMMA-SYNTHASE from Helicobacter pylori J99
94% identity, 100% coverage
- Analysis of protein expression regulated by the Helicobacter pylori ArsRS two-component signal transduction system
Loh, Journal of bacteriology 2010 - “...Pfs ProS TatD jhp0568, jhp0083, jhp0596, jhp1346, jhp0149, jhp0098, jhp0082, jhp0223, jhp1481, 0.71 1.51 1.61 2.43 0.19 0.41 1.37 0.78 0.55 0.009 0.000 0.001...”
- Characterization of the ArsRS regulon of Helicobacter pylori, involved in acid adaptation
Pflock, Journal of bacteriology 2006 - “...JHP0063 JHP0064 JHP0065 JHP0066 JHP0067 JHP0068 JHP0279 JHP1159 JHP0098 JHP1001 JHP0692 0.36 0.22 0.39 0.25 0.21 0.24 0.20 0.06 0.15 0.27 0.38 0.43 HP0240...”
- pH-regulated gene expression of the gastric pathogen Helicobacter pylori
Merrell, Infection and immunity 2003 - “...HP1050 HP0290 HP0380 HP0306 HP0755 HP1155 JHP1203 JHP0098 JHP0375 JHP0275 JHP1001 JHP0291 JHP0692 JHP1082 HP0743 HP0295 HP1119 HP1559 JHP0680 JHP0280 JHP1047...”
- Growth phase-dependent response of Helicobacter pylori to iron starvation
Merrell, Infection and immunity 2003 - “...0.3 0.5 0.3 0.5 JHP0122 JHP0098 JHP0099 JHP0570 JHP0594 JHP0615 3-Deoxy-D-arabino-heptulosonate-7-phosphate synthase, aroF Cystathionine gamma-synthase, metB...”
HSUHS1_RS06050 cystathionine gamma-synthase from Helicobacter suis HS1
79% identity, 99% coverage
EF0290 cystathionine beta-lyase from Enterococcus faecalis V583
70% identity, 99% coverage
- The Response of Enterococcus faecalis V583 to Chloramphenicol Treatment
Aakra, International journal of microbiology 2010 - “...Most of these genes (12) were upregulated at all time points. The cystathionine beta-lyase gene (EF0290) was downregulated at t0 and t90 and upregulated at t180. The chaperonin encoding genes (EF2633 and EF2634, groE operon) were downregulated at t0 and t180 and upregulated at t90. This...”
- “...Function logFC ML 1 logFC GP 2 logFC ML logFC GP logFC ML logFC GP EF0290 Cystathionine beta-lyase 0.45 0.46 1.66 1.36 1.07 0.97 EF0727 Conserved hypothetical protein TIGR00147 0.65 0.64 0.40 0.38 1.42 1.34 EF1527 P-binding protein 0.82 0.83 0.56 0.57 1.31 1.28 EF1694 Ribosomal...”
- Transcriptional response of Enterococcus faecalis V583 to erythromycin
Aakra, Antimicrobial agents and chemotherapy 2005 - “...groups/carriers Cell envelope Cell envelope Cell envelope Cell envelope Cell envelope EF0290 EF1565 EF2586 0.71 0.71 0 0 0 0.87 0 0 0.86 0 0 0 1.05 0 0 EF0849...”
- “...processes Cellular processes Cellular processes Cellular processes EF0105 EF0289 EF0290 EF0676 EF0891 EF0902 0 0 0.71 0 1.00 0.75 0 0 0 0 1.08 0.73 1.37 0...”
A2RM21 cystathionine gamma-lyase (EC 4.4.1.1); cysteine-S-conjugate beta-lyase (EC 4.4.1.13) from Lactococcus lactis (see 2 papers)
metC / RF|YP_001033049.1 cystathionine beta-lyase; EC 4.4.1.8 from Lactococcus lactis subsp. cremoris MG1363 (see 3 papers)
llmg_1776 cystathionine beta-lyase from Lactococcus lactis subsp. cremoris MG1363
66% identity, 99% coverage
GB|AAF14695.1 cystathionine beta-lyase; EC 4.4.1.8 from Austrochilidae (see paper)
66% identity, 99% coverage
MCCB_BACSU / O05394 Cystathionine gamma-lyase; Gamma-cystathionase; Homocysteine gamma-lyase; EC 4.4.1.1; EC 4.4.1.2 from Bacillus subtilis (strain 168) (see paper)
O05394 cystathionine beta-synthase (O-acetyl-L-serine) (EC 2.5.1.134) from Bacillus subtilis (see paper)
BSU27250 cystathionine beta-lyase from Bacillus subtilis subsp. subtilis str. 168
61% identity, 100% coverage
- function: Catalyzes the conversion of cystathionine to cysteine, and homocysteine to sulfide.
catalytic activity: L,L-cystathionine + H2O = 2-oxobutanoate + L-cysteine + NH4(+) (RHEA:14005)
catalytic activity: L-homocysteine + H2O = 2-oxobutanoate + hydrogen sulfide + NH4(+) + H(+) (RHEA:14501)
cofactor: pyridoxal 5'-phosphate
disruption phenotype: No visible phenotype. - A Survey of Pyridoxal 5'-Phosphate-Dependent Proteins in the Gram-Positive Model Bacterium Bacillus subtilis
Richts, Frontiers in molecular biosciences 2019 - “...Nakano et al., 2003 ; Choi et al., 2006 ; Even et al., 2006 MccB BSU27250 No 4.4.1.1 4L0O ( Helicobacter pylori , 61%) Cystathionine lyase/ homocysteine -lyase Methionine/ cysteine conversion SigA, Spx (+), CymR () MetC (52%), MetI (48%)/Trans-sulfuration enzyme family Nakano et al., 2003...”
B3TNN8 cystathionine gamma-lyase (subunit 2/2) (EC 4.4.1.1); cysteine-S-conjugate beta-lyase (EC 4.4.1.13) from Lacticaseibacillus casei (see paper)
GBO44_RS00380 trans-sulfuration enzyme family protein from Pediococcus acidilactici
59% identity, 96% coverage
- Identification of a species-specific aminotransferase in Pediococcus acidilactici capable of forming α-aminobutyrate
Wenger, AMB Express 2020 - “...FAM18098 was searched for genes encoding aminotransferases to follow this hypothesis. Six genes represented by GBO44_RS00380, GBO44_RS02360, GBO44_RS03135, GBO44_RS03485, GBO44_RS04865, and GBO44_RS09300 were annotated to encode amino acid aminotransferases (Fig. 2 ). BLAST searches were performed to obtain more clarity about the function of these aminotransferases....”
- “...and GBO44_RS09300 were not present in all 10 P. acidilactici strains. In addition, orthologs of GBO44_RS00380 were found in four P. pentosaceus genomes. Second, one of the remaining four aminotransferases, GBO44_RS02360, was predicted to be a glycine hydroxymethyltransferase, an enzyme that catalyzes the interconversion of glycine...”
T303_05425 trans-sulfuration enzyme family protein from Streptococcus thermophilus ASCC 1275
59% identity, 96% coverage
- Functional Genomic Analyses of Exopolysaccharide-Producing Streptococcus thermophilus ASCC 1275 in Response to Milk Fermentation Conditions
Wu, Frontiers in microbiology 2019 - “...pyruvate appears to be improved because of the up-regulated proteins (at least 4-fold) T303_05420 and T303_05425 in regards to the pH 5.5 adaptation; serine has been documented as a mild essential amino acid for the growth of Str. thermophilus ( Pastink et al., 2009 ). Pyruvate...”
- “...Methionine biosynthesis T303_05130 0.35 5-methyltetrahydropter oyltriglutamate-homocysteine methyltransferase Methionine biosynthesis T303_07020 0.34 Phosphoribosyl-ATP pyrophosphatase Histidine biosynthesis T303_05425 7.26 Cystathionine beta-lyase Cysteine catabolism T303_05420 4.25 Cysteine synthase Cysteine catabolism T303_03425 4.00 N -acetyl-gamma-glutamyl-phosphate reductase Arginine biosynthesis T303_03440 3.54 Acetylornithine aminotransferase Arginine biosynthesis T303_03435 2.42 Acetylglutamate kinase Arginine biosynthesis...”
STER_RS04385 trans-sulfuration enzyme family protein from Streptococcus thermophilus LMD-9
STER_0886 Cystathionine beta-lyase/cystathionine gamma-synthase from Streptococcus thermophilus LMD-9
59% identity, 96% coverage
BLL69_0264 trans-sulfuration enzyme family protein from Lacticaseibacillus paracasei
59% identity, 96% coverage
B3TNN9 cystathionine gamma-lyase (subunit 1/2) (EC 4.4.1.1); cysteine-S-conjugate beta-lyase (EC 4.4.1.13) from Lacticaseibacillus casei (see paper)
59% identity, 96% coverage
BWK52_3092 trans-sulfuration enzyme family protein from Lacticaseibacillus paracasei
59% identity, 96% coverage
- Comparative genomic and metabolic analysis of three Lactobacillus paracasei cheese isolates reveals considerable genomic differences in strains from the same niche
Stefanovic, BMC genomics 2018 - “...(BLL69_0264, BLL69_0493c). In strain DPC4206, two CBL genes (BWK52_1002, BWK52_3061c) and two CGL genes (BWK52_0733c, BWK52_3092) were identified, while in strain DPC4536 two CBL genes (B4Q23_0772, B4Q23_2254c), and only one CGL gene (B4Q23_0463c) were present. Additionally, genes encoding cystathionine beta synthase (CBS, EC 4.2.1.22), involved in...”
- “...(BLL69_0263 and B4Q23_0715, respectively), while DPC4206 has two homologs (BWK52_0941, BWK52_3091). Closer investigation showed that BWK52_3092 and BWK52_3091 in DPC4206 are located on plasmid-associated contigs, and appear to have been lost from strain DPC4536. The presence of the higher number of homologs for both CBL and...”
Lreu_0293 trans-sulfuration enzyme family protein from Limosilactobacillus reuteri subsp. reuteri JCM 1112
Lreu_0293 cystathionine gamma-lyase from Lactobacillus reuteri DSM 20016
60% identity, 100% coverage
7d7oB / Q818A3 Crystal structure of cystathionine gamma-lyase from bacillus cereus atcc 14579 (see paper)
BC4366 Cystathionine beta-lyase from Bacillus cereus ATCC 14579
Q818A3 Cystathionine beta-lyase from Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
BC_4366, WP_001201908 bifunctional cystathionine gamma-lyase/homocysteine desulfhydrase from Bacillus cereus ATCC 14579
58% identity, 99% coverage
- Ligand: pyridoxal-5'-phosphate (7d7oB)
- BC4707 is a major facilitator superfamily multidrug resistance transport protein from Bacillus cereus implicated in fluoroquinolone tolerance
Simm, PloS one 2012 - “...1-phosphofructokinase 0.60 bc3720 transcriptional regulator, DeoR family 0.41 bc3760 6-phospho-beta-glucosidase 0.59 bc4242 proton/sodium-glutamate symporter 0.47 bc4366 cystathionine beta-lyase 0.52 bc4367 cystein synthase A 0.50 bc4368 5-methylthioadenosine/S-adenosylhomocysteine nucleosidase 0.56 bc4369 Dimethyladenosine transferase 0.47 bc4396 molybdopterin biosynthesis protein 0.64 bc4707 drug resistance transporter, EmrB/QacA family 0.38 bc4789 S-ribosylhomocysteinase...”
- PlcRa, a new quorum-sensing regulator from Bacillus cereus, plays a role in oxidative stress responses and cysteine metabolism in stationary phase
Huillet, PloS one 2012 - “...1 12 8 BC4368 mtnN methylthioadenosine/S-adenosylhomocysteine nucleosidase 1 4 BC4367 mccA Cystathionine -synthase 1 9 BC4366 mccB Cystathionine -lyase 1 16 15 BC4392 yrvO Cysteine desulfhydrase 1 3 BC4393 cymR Cysteine metabolism repressor protein (RRF2 family) 1 3 BC0075 cysK OAS-thiol-lyase 1 3 BC2617 Cysteine dioxygenase...”
- Transcriptional responses of Bacillus cereus towards challenges with the polysaccharide chitosan
Mellegård, PloS one 2011 - “...10 4 potassium-transporting ATPase subunit A TMS(10) BC2603 4.4 10 4 hypothetical protein SS, TMS(5) BC4366 4.3 10 5 cystathionine beta-lyase BC4015 4.1 10 5 oligo-1,6-glucosidase amylase domain BC0754 3.7 10 5 potassium-transporting ATPase subunit B TMS(3), AAA, hydrolase BC4062 3.7 10 5 hypothetical protein SS,...”
- Structural Basis of the Inhibition of L-Methionine γ-Lyase from Fusobacterium nucleatum
Bu, International journal of molecular sciences 2023 - “...[ Pseudomonas putida (Uniprot accession no. P13254), Citrobacter freundii (Q84AR1), Clostridium sporogenes (A0A1J1CYV7), Bacillus cereus (Q818A3), Staphylococcus aureus (SAV0460), and P. aeruginosa (A0A2R3IX25)]. The PLP-binding residues are indicated by dotted boxes, and conserved residues for PLP binding are indicated by asterisks. All conserved residues shown in...”
- Exploring the Biologically Active Metabolites Produced by Bacillus cereus for Plant Growth Promotion, Heat Stress Tolerance, and Resistance to Bacterial Soft Rot in Arabidopsis
Tsai, Metabolites 2023 - “...3763547-3764614 AAS39887 acetolactate synthase 723478-721781 -dimethyl disulfide WP_000460299 methionine gamma-lyase 3328355-3329626 WP_000726591 methionine gamma-lyase 2387529-2388707 WP_001201908 cystathionine gamma-lyase 2694257-2695390 WP_000122291 cystathionine beta-lyase 2797135-2795972 -terpenoids WP_000251030 IPP isomerase 153587-152538 EEL15746 DXP reductoisomerase 3201707-3202921 WP_000288295 MEP cytidylyltransferase, ispD 1488120-1487440 Phytohormones -IAA WP_000080294 aldehyde dehydrogenase DhaS 3490691-3489207 WP_000537830 tryptophan...”
- Proteomic evidences for rex regulation of metabolism in toxin-producing Bacillus cereus ATCC 14579
Laouami, PloS one 2014 - “...0,058 3,8 0,00 GdhA BC_4162 NP_833877 Leucine dehydrogenase N N 1,8 0,04 2,4 0,081 - BC_4366 NP_834078 Cystathionine beta-lyase N N 0,151 0,447 2 0,03 AdsS BC_5468 NP_835123 Adenylosuccinate synthetase N N 1,8 0,04 1,15 0,202 - BC_3799 NP_833521 Aspartate-semialdehyde dehydrogenase N N 2,56 0,079 3,2...”
N134_RS01520 trans-sulfuration enzyme family protein from Limosilactobacillus reuteri TD1
59% identity, 100% coverage
lp_0255 cystathionine beta-lyase from Lactobacillus plantarum WCFS1
F9UT53 Cystathionine beta-lyase / cystathionine gamma-lyase from Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
lp_0255 trans-sulfuration enzyme family protein from Lactiplantibacillus plantarum WCFS1
59% identity, 99% coverage
- Molecular Responses of Lactobacilli to Plant Phenolic Compounds: A Comparative Review of the Mechanisms Involved
López, Antioxidants (Basel, Switzerland) 2021 - “...OLE + Bile resistance lp_0254 cysE : serine O -acetyltransferase HXT, OLE + Bile resistance lp_0255 metC1 : cystathionine beta-lyase HXT, OLE + Bile resistance lp_0256 cysK : cysteine synthase HXT, OLE + Bile resistance Gastro-intestinal tract (GIT) passage lp_2940 cell surface protein precursor, LPXTG-motif cell-wall...”
- Characterization of transcriptional response of Lactobacillus plantarum under acidic conditions provides insight into bacterial adaptation in fermentative environments
Jung, Scientific reports 2020 - “...3.18 9.45E87 1.47E84 Serine acetyltransferase lp_0254 F9UT52 COG1045 K00640 cblB 3.69 3.13E95 5.15E93 Cystathionine beta-lyase lp_0255 F9UT53 COG0626 K01760 cbs 3.45 1.28E70 1.41E68 Cystathionine beta-synthase lp_0256 F9UT54 COG0031 K01738 pnuC1 1.64 2.38E218 8.95E216 Nicotinamide mononucleotide transporter lp_0259 F9UT56 COG3201 K03811 treA 1.20 0.00109 0.005036 Trehalose-6-phosphate hydrolase...”
- Transcriptomic Evidence of Molecular Mechanisms Underlying the Response of Lactobacillus Plantarum WCFS1 to Hydroxytyrosol
Reverón, Antioxidants (Basel, Switzerland) 2020 - “...gshR4 (glutathione reductase) or lp_0858 (regulator of disulfide bond formation). Furthermore, the cystathionine--synthase (CBS) ( lp_0255 ) and cystathionine--lyase (CSE) ( lp_0256 ) encoding genes, which have been recently shown as the most important H 2 S-generating enzymes in many bacteria [ 26 ], were also...”
- Two homologous Agr-like quorum-sensing systems cooperatively control adherence, cell morphology, and cell viability properties in Lactobacillus plantarum WCFS1
Fujii, Journal of bacteriology 2008 - “...lamA mutants Open reading frame Downregulated genes lp_0254 lp_0255 lp_2833 lp_3084 lp_3085 lp_3087 lp_3575 lp_3579 lp_3580 lp_3582 a malG amy2 msmK1 ftsH npsA...”
- An agr-like two-component regulatory system in Lactobacillus plantarum is involved in production of a novel cyclic peptide and regulation of adherence
Sturme, Journal of bacteriology 2005 - “...lp_1206 lp_1207 lp_1208 lp_1210 lp_1211 Cluster 4 lp_0254 lp_0255 cps2C galE2 cps2E cps2F cps2G cps2H cps2I cps2J cysE metC1 Description Change (fold)c No. of...”
- Characterization of transcriptional response of Lactobacillus plantarum under acidic conditions provides insight into bacterial adaptation in fermentative environments.
Jung, Scientific reports 2020 - “...9.45E87 1.47E84 Serine acetyltransferase lp_0254 F9UT52 COG1045 K00640 cblB 3.69 3.13E95 5.15E93 Cystathionine beta-lyase lp_0255 F9UT53 COG0626 K01760 cbs 3.45 1.28E70 1.41E68 Cystathionine beta-synthase lp_0256 F9UT54 COG0031 K01738 pnuC1 1.64 2.38E218 8.95E216 Nicotinamide mononucleotide transporter lp_0259 F9UT56 COG3201 K03811 treA 1.20 0.00109 0.005036 Trehalose-6-phosphate hydrolase lp_0263...”
- Identification of key proteins and pathways in cadmium tolerance of Lactobacillus plantarum strains by proteomic analysis.
Zhai, Scientific reports 2017 - “...Amino acid metabolism Lysine biosynthesis F9UPP5 dapE1; succinyl-diaminopimelate desuccinylase 2.86 F9URV7 dapE2; succinyl-diaminopimelate desuccinylase 1.95 F9UT53 cblB; cystathionine beta-lyase/cystathionine gamma-lyase 3.54 Sulfur amino acid metabolism F9UQB3 iscS; Cysteine desulfurase 1.64 F9UTH2 lp_3283; Methonine synthase (Cobalamine-independent), C-terminal domain 2.40 Q88UW5 gshAB; glutathione biosynthesis bifunctional protein: glutamate-cysteine ligase;...”
6ldoA / F9UT53 Crystal structure of cystathionine gamma-lyase from lactobacillus plantarum complexed with l-serine (see paper)
59% identity, 99% coverage
- Ligand: (e)-n-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-l-serine (6ldoA)
D9S254 Cystathionine gamma-lyase from Thermosediminibacter oceani (strain ATCC BAA-1034 / DSM 16646 / JW/IW-1228P)
58% identity, 99% coverage
- Analytical Validation of Loss of Heterozygosity and Mutation Detection in Pancreatic Fine-Needle Aspirates by Capillary Electrophoresis and Sanger Sequencing.
Timmaraju, Diagnostics (Basel, Switzerland) 2024 - “...CE electropherogram and IGV snapshot of the TGS alignment shows the specific detection of the D9S254 region ( Figure 3 A,B). High-resolution images are shown in Supplementary Figures S1 and S2 . Comparison of the CE and TGS data showed the specific detection of all 17...”
- “...be downloaded at: https://www.mdpi.com/article/10.3390/diagnostics14050514/s1 , Figure S1: Representative image shows the capillary electropherogram for the D9S254 STR region for a sample with two alleles presented in a 3:1 allele ratio. Figure S2: Corresponding IGV snapshot of the TGS alignment showing the D9S254 region for the sample...”
- Molecular Clues for Prediction of Hepatocellular Carcinoma Recurrence After Liver Transplantation.
Badwei, Journal of clinical and experimental hepatology 2023 - Role of Allelic Imbalance in Predicting Hepatocellular Carcinoma (HCC) Recurrence Risk After Liver Transplant.
Pagano, Annals of transplantation 2019 - “...report that AI was associated with HCC recurrence in 3 main loci (D3S2303, D9S251, and D9S254). Tumor recurrence was associated only with 2 specific panels with 9 microsatellites previously reported to be associated with high risk for HCC recurrence. Our data show that fractional allelic imbalance...”
- “...of LOH ( Table 3A ), and D1S407 (p=0.006) D9S251 (p=0.02), D1S162 (p=0.005), D5S592 (p=0.005), D9S254 (p=0.002) and D10S520 (p=0.04) considering high-level LOH ( Table 3B ). Evaluation of specific panels and association with HCC recurrence Descriptive analysis of the different panels showed a relevant grade...”
- Liver transplantation for hepatocellular carcinoma: extension of indications based on molecular markers.
Schwartz, Journal of hepatology 2008 - Use of microsatellite marker loss of heterozygosity in accurate diagnosis of pancreaticobiliary malignancy from brush cytology samples.
Khalid, Gut 2004
CLJU_c24380 bifunctional cystathionine gamma-lyase/homocysteine desulfhydrase from Clostridium ljungdahlii DSM 13528
57% identity, 99% coverage
NWMN_0425 cystathionine gamma-synthase from Staphylococcus aureus subsp. aureus str. Newman
SAUSA300_0434 cystathionine gamma-synthase from Staphylococcus aureus subsp. aureus USA300_FPR3757
CH51_RS02435 bifunctional cystathionine gamma-lyase/homocysteine desulfhydrase from Staphylococcus aureus
54% identity, 99% coverage
SA0419 cystathionine gamma-synthase from Staphylococcus aureus subsp. aureus N315
SAV0460 cystathionine gamma-synthase homolog from Staphylococcus aureus subsp. aureus Mu50
54% identity, 99% coverage
- Sulfide Homeostasis and Nitroxyl Intersect via Formation of Reactive Sulfur Species in Staphylococcus aureus
Peng, mSphere 2017 - “...e 5.4 Sodium-dependent symporter /+ up d NWMN_0424 SA0418 cysM 5.7 Cystathionine--synthase (CBS) + NWMN_0425 SA0419 metB 8.5 Cystathionine--lyase (CSE) + NWMN_0426 SA0420 13.0 11.6 ABC transporter: peptide (ATPase) /+ down d NWMN_0427 SA0421 13.9 11.9 ABC transporter: peptide (permease) /+ down d NWMN_0428 SA0422 9.9...”
- The effect of skin fatty acids on Staphylococcus aureus
Neumann, Archives of microbiology 2015 - “...600 1.0 16h SA0165 Hypothetical protein, similar to alpha-helical coiled-coil 0.15 SA0367 NADPH-dependent oxidoreductase 2.13 SA0419 MetB Cystathionine gamma-synthase 2.11 SA0506 Tuf Elongation factor Tu 2.31 SA0506 Tuf Elongation factor Tu 2.46 SA0513 Hypothetical protein 0.48 SA0707 Hypothetical protein 0.44 SA0758 Hypothetical protein, similar to thioredoxin...”
- Characterizing the effects of inorganic acid and alkaline shock on the Staphylococcus aureus transcriptome and messenger RNA turnover
Anderson, FEMS immunology and medical microbiology 2010 - “...ND SA0255 hypothetical protein sa_c7047s6159_a_at 4.7 2.5 ND SA0411 hypothetical protein sa_c7070s6181_a_at 3.3 2.5 ND SA0419 hypothetical protein sa_c7078s6191_a_at 3.2 2.5 ND SA0421 hypothetical protein sa_c7088s6200_a_at * 6.6 2.5 ND SA0425 hypothetical protein sa_c9086s7967cs_a_at 9.9 2.5 2.5 SA0450 hypothetical protein sa_c7579s6599_a_at 5.8 2.5 2.5 SA0573 hypothetical...”
- Reporter metabolite analysis of transcriptional profiles of a Staphylococcus aureus strain with normal phenotype and its isogenic hemB mutant displaying the small-colony-variant phenotype
Seggewiss, Journal of bacteriology 2006 - “...amino acids and related molecules SA2428 SA2341 SA1165 SA1166 SA0419 SA0416 SA2427 SA2389 0.00 0.00 0.00 0.00 0.01 0.01 0.02 0.03 4.96 0.38 0.39 0.39 2.13 2.05...”
- The membrane-associated lipoprotein-9 GmpC from Staphylococcus aureus binds the dipeptide GlyMet via side chain interactions
Williams, Biochemistry 2004 - “...synthase (CysM, SA0418), and cystathionine -lyase/synthase (MetB, SA0419) is located upstream of the gmp operon (Figure 1). Pfam classification (Pfam03180.7) of...”
- Structural Basis of the Inhibition of L-Methionine γ-Lyase from Fusobacterium nucleatum
Bu, International journal of molecular sciences 2023 - “...(Uniprot accession no. P13254), Citrobacter freundii (Q84AR1), Clostridium sporogenes (A0A1J1CYV7), Bacillus cereus (Q818A3), Staphylococcus aureus (SAV0460), and P. aeruginosa (A0A2R3IX25)]. The PLP-binding residues are indicated by dotted boxes, and conserved residues for PLP binding are indicated by asterisks. All conserved residues shown in red. The numbering...”
7mcbH / X5E0F1 Crystal structure of staphylococcus aureus cystathionine gamma lyase holoenzyme (see paper)
55% identity, 98% coverage
- Ligand: pyridoxal-5'-phosphate (7mcbH)
MW0415 cystathionine gamma-synthase from Staphylococcus aureus subsp. aureus MW2
SAS0418 putative Cys/Met metabolism PLP-dependent enzyme from Staphylococcus aureus subsp. aureus MSSA476
54% identity, 99% coverage
- Rsp inhibits attachment and biofilm formation by repressing fnbA in Staphylococcus aureus MW2
Lei, Journal of bacteriology 2011 - “...fnbA fnbB Metabolism MW2444 MW2198 MW2443 MW0358 MW2541 MW2594 MW0415 MW0414 MW2206 MW2207 MW2208 MW2212 MW2209 MW2210 MW2211 MW2157 MW2154 2.4 2.3 3.0 3.4 2.6...”
- The SaeR/S gene regulatory system is essential for innate immune evasion by Staphylococcus aureus
Voyich, The Journal of infectious diseases 2009 - “...NADH dehydrogenase subunit L 2.67 ES MW0414 cysM Amino acid transport and metabolism 2.20 ES MW0415 metB cystathionine gamma-synthase 2.78 ES MW0509 ilvE branched-chain amino acid aminotransferase 2.05 ES MW0663 nagA probable N-acetylglucosamine-6-phosphate deacetylase 2.09 ES MW0726 trxB thioredoxine reductase 2.06 ES MW0745 int DNA replication,...”
- Transcriptomic and Metabolomic Analysis of a Fusidic Acid-Selected fusA Mutant of Staphylococcus aureus
Gupta, Antibiotics (Basel, Switzerland) 2022 - “...acid biosynthesis genes downregulated ( argF , asd , cysE , glyA , hisF , SAS0418, and SAS2563) than upregulated (SACOL2044 and SAV1737) in SH10001st-2 ( Tables S1 and S2 ). With regard to carbohydrate transporters, 3 (SACOL2146, SACOL2552, and treP ) were downregulated and another...”
SERP0095 trans-sulfuration enzyme family protein from Staphylococcus epidermidis RP62A
SE2323 cystathionine gamma-synthase from Staphylococcus epidermidis ATCC 12228
55% identity, 99% coverage
CAC0930 Cystathionine gamma-synthase from Clostridium acetobutylicum ATCC 824
55% identity, 99% coverage
METC_COXBU / Q83A83 Cystathionine beta-lyase; CBL; Beta-cystathionase; Cysteine lyase; Cysteine-S-conjugate beta-lyase; EC 4.4.1.13 from Coxiella burnetii (strain RSA 493 / Nine Mile phase I) (see paper)
54% identity, 97% coverage
- function: Catalyzes the cleavage of cystathionine to homocysteine, pyruvate and ammonia during methionine biosynthesis.
catalytic activity: L,L-cystathionine + H2O = L-homocysteine + pyruvate + NH4(+) (RHEA:13965)
catalytic activity: an S-substituted L-cysteine + H2O = a thiol + pyruvate + NH4(+) (RHEA:18121)
cofactor: pyridoxal 5'-phosphate
subunit: Homotetramer.
4iyoD / Q5H4T8 Crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. Oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates (see paper)
56% identity, 98% coverage
Q5H4T8 cystathionine gamma-lyase (EC 4.4.1.1) from Xanthomonas oryzae pv. oryzae (see paper)
PXO_03157 cystathionine gamma-synthase (CGS) (O-succinylhomoserine(Thiol)-lyase) from Xanthomonas oryzae pv. oryzae PXO99A
56% identity, 95% coverage
CPE0176 cystathionine gamma-synthase from Clostridium perfringens str. 13
Q8XNZ9 Cystathionine gamma-synthase from Clostridium perfringens (strain 13 / Type A)
56% identity, 98% coverage
- Clostridium perfringens phospholipase C, an archetypal bacterial virulence factor, induces the formation of extracellular traps by human neutrophils
Badilla-Vargas, Frontiers in cellular and infection microbiology 2023 - “...systems specific for maltose (cd13586) 42 555 Q8XNZ9 7 16 159.70 Cystathionine beta-synthase metB ; CPE0176 Aspartate aminotransferase I (cl18945) 38 741 Q8XNA0 10 27 175.08 Probable ion-uptake ABC transporter CPE0438 Substrate binding domain of ferric iron-binding protein (cd13542) 37 153 P0C2E4 18 35 163.83 Ornithine...”
- Global regulation of gene expression in response to cysteine availability in Clostridium perfringens
André, BMC microbiology 2010 - “...LuxS and further to cysteine via the reverse transulfuration pathway probably encoded by the genes cpe0176 and cpe0177 (Fig. 1 ). We then tested the ability of strain 13 to grow in minimal medium containing 1 mM homocysteine or 1 mM cystathionine as sole sulfur source....”
- “...70% identity with MccA, the cystathionine--synthase of B. subtilis and C. acetobutylicum , respectively while Cpe0176 is 56% and 70% identical to MccB, the cystathionine--lyase/homocysteine--lyase of the same microorganisms [ 8 , 19 ]. This strongly suggests that a reverse transsulfuration pathway is present in C....”
- Clostridium perfringens phospholipase C, an archetypal bacterial virulence factor, induces the formation of extracellular traps by human neutrophils
Badilla-Vargas, Frontiers in cellular and infection microbiology 2023 - “...ABC transporter CPE2343 periplasmic-binding component of ABC transport systems specific for maltose (cd13586) 42 555 Q8XNZ9 7 16 159.70 Cystathionine beta-synthase metB ; CPE0176 Aspartate aminotransferase I (cl18945) 38 741 Q8XNA0 10 27 175.08 Probable ion-uptake ABC transporter CPE0438 Substrate binding domain of ferric iron-binding protein...”
- “...Q8XMG4, Q8XM44, Q8XKP0), twelve cytosolic metabolic enzymes (Q8XNK4, Q8XLN5, Q8XI54, Q8XNH1, Q8XHF5, P0C2E1, Q8XKU4, Q8XJF2, Q8XNZ9, P0C2E4, Q8XK52; Q8XP50), two chaperones (P26823 and P26821), one folding enzyme (Q8XHK0), three membrane transporters (Q8XHY1, Q8XNA0, Q8XKB3), one adhesion membrane protein (Q93M90), two membrane enzymes (Q8XIW4 and Q8XN18), one...”
Cthe_1559 cystathionine gamma-lyase from Clostridium thermocellum ATCC 27405
56% identity, 97% coverage
PAP_08750 cystathionine gamma-synthase from Palaeococcus pacificus DY20341
54% identity, 98% coverage
XAC3602 cystathionine gamma-lyase-like protein from Xanthomonas axonopodis pv. citri str. 306
55% identity, 95% coverage
Cbei_0629 cystathionine gamma-synthase from Clostridium beijerincki NCIMB 8052
54% identity, 98% coverage
XALc_2712 probable cys/met metabolism plp-dependent enzyme protein from Xanthomonas albilineans
55% identity, 95% coverage
uptH / AAK53484.1 cystathionine gamma-synthase from Xanthomonas campestris pv. campestris (see 4 papers)
56% identity, 94% coverage
GSU0944 cystathionine beta-lyase from Geobacter sulfurreducens PCA
52% identity, 99% coverage
- Genome Scale Mutational Analysis of Geobacter sulfurreducens Reveals Distinct Molecular Mechanisms for Respiration and Sensing of Poised Electrodes versus Fe(III) Oxides
Chan, Journal of bacteriology 2017 - “...shared. A clear example of population-based complementation is evident in Tn-Seq data for fumarate hydratase (GSU0944), encoded by a tricarboxylic acid (TCA) cycle gene predicted to be absolutely essential (Table S3). As wild-type G. sulfurreducens secretes malate when grown with fumarate ( 47 ), extracellular malate...”
- The genome sequence of Geobacter metallireducens: features of metabolism, physiology and regulation common and dissimilar to Geobacter sulfurreducens
Aklujkar, BMC microbiology 2009 - “...dedicated enzyme of methionine biosynthesis, and also two linked cystathionine- -synthase/cystathionine- -lyase genes (Gmet_0698 = GSU0944; Gmet_0699 = GSU0945, 49% and 51% identical to the Lactococcus lactis lyase [ 56 , 57 ]). Phylogenetic analysis could not distinguish the synthase from the lyase (data not shown),...”
- Adaptation to disruption of the electron transfer pathway for Fe(III) reduction in Geobacter sulfurreducens
Leang, Journal of bacteriology 2005 - “...on February 11, 2017 by University of California, Berkeley GSU0944 GSU0945 GSU1906 5922 LEANG ET AL. J. BACTERIOL. TABLE 2--Continued Locus ID a Common name...”
PA14_05230 probable cystathionine gamma-lyase from Pseudomonas aeruginosa UCBPP-PA14
53% identity, 95% coverage
- Mechanisms of chlorate toxicity and resistance in Pseudomonas aeruginosa
Spero, Molecular microbiology 2022 - “...as proteases (HslU, HslV, PepN), chaperones (ClpX, ClpAB, DnaK), and cysteine/methionine metabolism proteins (MetE, PA14_05220, PA14_05230) ( Fig. 2C , Table S4 ). Interestingly, when we explored which KEGG categories were induced in response to chlorate, we found that each KEGG category in Figure 2C (excluding...”
PA0400 probable cystathionine gamma-lyase from Pseudomonas aeruginosa PAO1
NP_249091 cystathionine gamma-lyase from Pseudomonas aeruginosa PAO1
53% identity, 95% coverage
- Searching for Biological Function of the Mysterious PA2504 Protein from Pseudomonas aeruginosa
Drabinska, International journal of molecular sciences 2021 - “...to L-cysteine (review [ 15 ]), cystathionine beta-synthase ( PA0399 ), and cystathionine gamma-lyase ( PA0400 ) were downregulated in the PA2504 mutant, as was PA2562 , a homolog of the E. coli iscS gene coding for L-cysteine desulphurase [ 16 ] ( Table 2 )....”
- “...protein PA0284 oscA 3.11 Hypothetical protein/ sulphur starvation response protein PA0399 PA0399 0.73 Cystathionine beta-synthase PA0400 PA0400 0.54 Cystathionine gamma-lyase PA1245 aprX 0.92 Extracellular protease AprX PA1246 aprD 0.70 Alkaline protease secretion ATP-binding protein AprD PA1247 aprE 0.64 Alkaline protease secretion protein AprE PA1248 aprF 0.73...”
- New insights into the antibacterial and quorum sensing inhibition mechanism of Artemisia argyi leaf extracts towards Pseudomonas aeruginosa PAO1
Kong, 3 Biotech 2021 - “...involved in the metabolism of cysteine (PA0400, cystathionine gamma-lyase; CysM, cysteine synthase), histidine (HutU, urocanate hydratase), arginine (ArgJ,...”
- Dissection of the cis-2-decenoic acid signaling network in Pseudomonas aeruginosa using microarray technique
Rahmani-Badi, Frontiers in microbiology 2015 - “...sahH, betA, aspA, ilvCD, arc, aroC, proC, argC, nadBE, dapB, trpE, aotJ, phhA, phaF, PA0006, PA0400, PA0440, PA0530, PA1339-PA1342, PA1638, PA2084, PA2108, PA2740, PA3164, PA3271, PA3538, PA3589, PA3871, PA4180, PA4672, PA4774, PA4977, PA5093, PA5522 Amino acid and Fatty acid metabolism gcdH Carbohydrate transport and metabolism rpe,...”
- Identification of five structurally unrelated quorum-sensing inhibitors of Pseudomonas aeruginosa from a natural-derivative database
Tan, Antimicrobial agents and chemotherapy 2013 - “...PA4175 PA5100 PA3922 PA3919 PA2300 PA1372 PA0572 PA0792 PA0400 PA5213 PA2951 PA0586 PA2399 PA3924 PA2290 PA2424 PA3148 PA2302 piv, prpL hutU PA2402 PA0852...”
- Bis-(3'-5')-cyclic dimeric GMP regulates antimicrobial peptide resistance in Pseudomonas aeruginosa
Chua, Antimicrobial agents and chemotherapy 2013 - “...PA3686 PA3922 PA2385 PA3729 PA0314 PA2445 PA0084 PA3452 PA0400 PA4138 PA4236 PA0139 PA5322 PA2944 PA3186 PA0036 PA4560 PA4938 PA0077 PA4266 PA4829 PA3328 PA3666...”
- Dispersion by Pseudomonas aeruginosa requires an unusual posttranslational modification of BdlA
Petrova, Proceedings of the National Academy of Sciences of the United States of America 2012 - “...a conserved hypothetical protein (PA1658), cystathionine gamma-lyase (PA0400), two proteins involved in LPS biosynthesis Petrova and Sauer (WbpA, WbpB),...”
- Extragenic suppressor mutations that restore twitching motility to fimL mutants of Pseudomonas aeruginosa are associated with elevated intracellular cyclic AMP levels
Nolan, MicrobiologyOpen 2012 - “...intergenic regions. In total, nonsynonymous substitutions were detected in seven protein-coding genes: PA0159, W35C (183697T>C); PA0400, A125R (4423850C>G); PA1029, M1V (1116213G>C); PA1459, G34A (1589438G>C); PA2400/PvdJ, P819A (2669175G>C); PA4341, E158D (4869855T>G); and PA4969/CpdA, L187R (5578940A>C). The nucleotide sequences of the coding and upstream promoter regions of cpdA...”
- Catalytic specificity and crystal structure of cystathionine γ-lyase from Pseudomonas aeruginosa.
Pedretti, Scientific reports 2024 - GeneRIF: Catalytic specificity and crystal structure of cystathionine gamma-lyase from Pseudomonas aeruginosa.
Smal_0489 Cystathionine gamma-lyase from Stenotrophomonas maltophilia R551-3
56% identity, 96% coverage
SCO4958 cystathionine gamma-synthase from Streptomyces coelicolor A3(2)
55% identity, 97% coverage
mll4503 cystathionine gamma-lyase from Mesorhizobium loti MAFF303099
54% identity, 95% coverage
- Reactive Sulfur Species Produced by Cystathionine γ-lyase Function in the Establishment of Mesorhizobium loti-Lotus japonicus Symbiosis
Fukudome, Microbes and environments 2023 - “...(wpi). In MAFF303099, the CSE gene is encoded on two open reading frames, mlr1566 and mll4503. Among them, mll4503 gas been predicted by MicrobesOnline ( http://www.microbesonline.org/operons/gnc266835.html ) to be on the same operon as CBS (mll4505), which functions cooperatively with CSE in RSS production. Therefore, in...”
- “...mutation. Three STM strains (clone IDs: 12T02e02, 14T06a12, and 20T03b07) with a mini-transposon inserted into mll4503, an open reading frame encoding CSE, were designated cse1 , cse2 , and cse3 , respectively. The CSE gene was 1,185 bp, and cse1 , cse2 , and cse3 had...”
6k1lA / B4SII9 E53a mutant of a putative cystathionine gamma-lyase (see paper)
55% identity, 98% coverage
- Ligand: pyridoxal-5'-phosphate (6k1lA)
CLP_1763 trans-sulfuration enzyme family protein from Clostridium butyricum E4 str. BoNT E BL5262
53% identity, 98% coverage
6cjaA / Q5ZX43 Crystal structure of cystathionine beta-lyase from legionella pneumophila philadelphia 1 in complex with alanyl-plp and serine
56% identity, 98% coverage
- Ligands: (e)-n-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-l-alanine; serine (6cjaA)
lpg0890 cystathionine beta-lyase from Legionella pneumophila subsp. pneumophila str. Philadelphia 1
56% identity, 98% coverage
- The LetA/S two-component system regulates transcriptomic changes that are essential for the culturability of Legionella pneumophila in water
Mendis, Scientific reports 2018 - “...(gamma-glutamyl kinase) proB 1.72 1.33 Lpg2278 4-hydroxyphenylpyruvate dioxygenase (legiolysin) oxidoreductase protein (hemolysin) hpd 2.12 1.45 Lpg0890 cystathionine beta-lyase (cystathionine gamma lyase) metC 1.53 1.40 Lpg2951 cystathionine beta synthase (cysteine synthase) 1.62 1.98 Lpg0725 serine hydroxymethyltransferase glyA3 2.60 2.80 Carbohydrate Metabolism Lpg2887 phosphomannose isomerase GDP mannose pyrophosphorylase...”
- Transcriptomic changes of Legionella pneumophila in water
Li, BMC genomics 2015 - “...at two or all three time points, while the remaining four genes ( lpg0025 , lpg0890 , lpg1284 and lpg2487 ) were significantly down-regulated (Fig. 4a ). The RT-qPCR results for these 10 genes are shown in Fig. 4b . Despite some differences, the general expression...”
- “...qPCR GTGGCGTTCCAGTTTGT 586_QR lpg0586 qPCR CTGTCCAGGCAGCATAAC 846_QF lpg0846 qPCR GGTAGAAGGCGATGGTTATC 846_QR lpg0846 qPCR GCCTTCCGGTGGTAATAAA 890_QF lpg0890 qPCR CCTTCCAATCCCATGCTAAAG 890_QR lpg0890 qPCR GTCAAATCCGAGTTCAAGAGG 1206_QF lpg1206 qPCR GCGTCATGAGGATTCTATTCG 1206_QR lpg1206 qPCR GGCCTGTAAATCGTATCAGAC 1284_QF lpg1284 qPCR GTTTATCTCAGAGCGGCAAG 1284_QR lpg1284 qPCR GACATCCTCCAAAGGCTTATC 1659_QF lpg1659 qPCR CGGTCACTCTTTGGTATATGTC 1659_QR lpg1659 qPCR CTGATTGACTGGATCGAACATC...”
R3M60_12360 cystathionine beta-lyase from Bacillus subtilis
51% identity, 97% coverage
Gmet_0699 Cys/Met metabolism pyridoxal-phosphate-dependent enzymes from Geobacter metallireducens GS-15
51% identity, 98% coverage
- The genome sequence of Geobacter metallireducens: features of metabolism, physiology and regulation common and dissimilar to Geobacter sulfurreducens
Aklujkar, BMC microbiology 2009 - “...enzyme of methionine biosynthesis, and also two linked cystathionine- -synthase/cystathionine- -lyase genes (Gmet_0698 = GSU0944; Gmet_0699 = GSU0945, 49% and 51% identical to the Lactococcus lactis lyase [ 56 , 57 ]). Phylogenetic analysis could not distinguish the synthase from the lyase (data not shown), but...”
- “...G. metallireducens , transsulfuration may also be controlled by a GC-rich element between Gmet_0698 and Gmet_0699, which contains four tandem repeats of the heptanucleotide GGGACCG and is found in 49 intergenic and intragenic locations in the genome (Additional file 6 : Figure S2, Additional file 5...”
METC_BACSU / O31632 Cystathionine beta-lyase MetC; CBL; Beta-cystathionase MetC; Cysteine lyase MetC; Cysteine-S-conjugate beta-lyase MetC; EC 4.4.1.13 from Bacillus subtilis (strain 168) (see 2 papers)
BSU11880 cystathionine beta-lyase from Bacillus subtilis subsp. subtilis str. 168
51% identity, 97% coverage
- function: Catalyzes the transformation of cystathionine into homocysteine. Also exhibits cysteine desulfhydrase activity in vitro, producing sulfide from cysteine.
catalytic activity: L,L-cystathionine + H2O = L-homocysteine + pyruvate + NH4(+) (RHEA:13965)
catalytic activity: an S-substituted L-cysteine + H2O = a thiol + pyruvate + NH4(+) (RHEA:18121)
cofactor: pyridoxal 5'-phosphate
subunit: Homotetramer.
disruption phenotype: Cells lacking this gene grow as well as the wild- type in the presence of sulfate, cysteine, homocysteine or methionine as sole sulfur source, but do not grow in the presence of cystathionine. - A Survey of Pyridoxal 5'-Phosphate-Dependent Proteins in the Gram-Positive Model Bacterium Bacillus subtilis
Richts, Frontiers in molecular biosciences 2019 - “...Nakano et al., 2003 ; Choi et al., 2006 ; Even et al., 2006 MetC BSU11880 No 4.4.1.8 4L0O ( H. pylori , 51%) Cystathionine -lyase Methionine biosynthesis SigA, S-box MccB (52%), MetI (43%)/trans-sulfuration enzyme family Grundy and Henkin, 1998 ; Auger et al., 2002 ;...”
LRK54_RS05660 trans-sulfuration enzyme family protein from Rhodanobacter denitrificans
54% identity, 97% coverage
- High-throughput protein characterization by complementation using DNA barcoded fragment libraries
Biggs, Molecular systems biology 2024 - “...TK06_RS10770 of P. fluorescens FW300-N2E2. A second example of a confirmed hit is that of LRK54_RS05660 of R. denitrificans FW104-10B01 found in the context of metB . MetB is a cystathionine gamma-synthase that, along with cystathionine beta-lyase (MetC), is involved in the essential two-step process of...”
- “...l -homoserine as part of E. colis methionine synthesis pathway (Fig. 7 ). By homology, LRK54_RS05660 is related to both E. coli MetB (41%) and E. coli MetC (28%), with its AlphaFold structure resembling MetB (Fig. 7 ). Yet, its closest biochemically-characterized homolog is cystathionine gamma-lyase...”
GSU0945 cystathionine beta-lyase from Geobacter sulfurreducens PCA
52% identity, 98% coverage
CAC0391 Cystathionine beta-lyase from Clostridium acetobutylicum ATCC 824
51% identity, 99% coverage
- Genome-scale model for Clostridium acetobutylicum: Part I. Metabolic network resolution and analysis
Senger, Biotechnology and bioengineering 2008 - “...CAC3038. List 4: CAC0998, CAC2378/CAC3600, CAC2379, CAC2381, CAC2380, CAC2723, CAC2624, CAC0608. List 5: CAC1825, CAC0390, CAC0391, CAC3348/CAC0578. List 6: CAC0737/CAC1001/CAC1819/CAC2832/CAC0764/CAC1673/CAC1674. List 7: (from DAHP) CAC0894, CAC0713/CAC0899, CAC0897, CAC0898, CAC0895, CAC0896. List 8: CAC2680, CAC0944, CAC1348, CAC1730, CAC0726, CAC0819/CAC3221. List 9: CAC0936, CAC0943, CAC0942, CAC0940, CAC0939, CAC0938,...”
BC_4254 cystathionine beta-lyase from Bacillus cereus ATCC 14579
50% identity, 97% coverage
- Bacillus cereus Response to a Proanthocyanidin Trimer, a Transcriptional and Functional Analysis
Tamura, Current microbiology 2016 - “...14.9 Acetolactate synthase large subunit BC_1825 14.4 Transposase BC_1435 14.4 Hypothetical protein Two-component regulatory system BC_4254 14.3 Cystathionine beta-lyase BC_3600 14.3 Protease HhoA BC_2323 14.1 ABC transporter ATP-binding protein ABC transporter BC_3199 14.1 Hypothetical Cytosolic Protein ABC transporter BC_1781 14.0 Threonine dehydratase BC_4667 13.8 Ankyrin BC_4742...”
XTGART29_0559 cystathionine gamma-synthase from Xanthomonas graminis pv. graminis ART-Xtg29
53% identity, 95% coverage
8juiA / Q818J6 Crystal structures of cystathionine beta lyase from bacillus cereus atcc 14579 (see paper)
50% identity, 99% coverage
- Ligand: pyridoxal-5'-phosphate (8juiA)
7ba4A / A0A509J8D5 Structure of cystathionine gamma-lyase from pseudomonas aeruginosa
51% identity, 99% coverage
- Ligand: pyridoxal-5'-phosphate (7ba4A)
CAC0390 Cystathionine gamma-synthase from Clostridium acetobutylicum ATCC 824
CA_C0390 trans-sulfuration enzyme family protein from Clostridium acetobutylicum ATCC 824
48% identity, 98% coverage
- Genome-scale model for Clostridium acetobutylicum: Part I. Metabolic network resolution and analysis
Senger, Biotechnology and bioengineering 2008 - “...to 2-oxobutanoate through homoserine- O -succinyl-transferase (MetB, EC 2.3.1.46, CAC1825) and cystathione- -synthase (EC 2.5.1.48, CAC0390). This metabolic route of l -isoleucine biosynthesis is inefficient as MetB requires succinyl-CoA as a substrate. This TCA cycle component is derived from 2-oxoglutarate at the bottom of the incomplete...”
- “...CAC1479, CAC3038. List 4: CAC0998, CAC2378/CAC3600, CAC2379, CAC2381, CAC2380, CAC2723, CAC2624, CAC0608. List 5: CAC1825, CAC0390, CAC0391, CAC3348/CAC0578. List 6: CAC0737/CAC1001/CAC1819/CAC2832/CAC0764/CAC1673/CAC1674. List 7: (from DAHP) CAC0894, CAC0713/CAC0899, CAC0897, CAC0898, CAC0895, CAC0896. List 8: CAC2680, CAC0944, CAC1348, CAC1730, CAC0726, CAC0819/CAC3221. List 9: CAC0936, CAC0943, CAC0942, CAC0940, CAC0939,...”
- A Quantitative System-Scale Characterization of the Metabolism of Clostridium acetobutylicum
Yoo, mBio 2015 - “...a 1:1 molar ratio. Furthermore, three genes involved in cysteine (CA_C2783) and methionine (CA_C1825 and CA_C0390) biosynthesis exhibited ~5-fold decreases in their numbers of mRNA and protein molecules per cell in agreement with a previous metabolomics study by Amador-Noguez et al. ( 67 ), showing an...”
R5D67_08365 cystathionine beta-lyase from Bacillus velezensis
50% identity, 97% coverage
CGL_DICDI / Q55DV9 Cystathionine gamma-lyase; CGL; CSE; Cysteine desulfhydrase; Cysteine-protein sulfhydrase; Gamma-cystathionase; Homocysteine desulfhydrase; EC 4.4.1.1; EC 4.4.1.2 from Dictyostelium discoideum (Social amoeba) (see paper)
52% identity, 97% coverage
- function: Catalyzes the last step in the trans-sulfuration pathway from L-methionine to L-cysteine in a pyridoxal-5'-phosphate (PLP)-dependent manner, which consists on cleaving the L,L-cystathionine molecule into L-cysteine, ammonia and 2-oxobutanoate. Part of the L-cysteine derived from the trans-sulfuration pathway is utilized for biosynthesis of the ubiquitous antioxidant glutathione. Besides its role in the conversion of L-cystathionine into L-cysteine, it utilizes L-cysteine and L- homocysteine as substrates (at much lower rates than L,L-cystathionine) to produce the endogenous gaseous signaling molecule hydrogen sulfide (H2S).
catalytic activity: L,L-cystathionine + H2O = 2-oxobutanoate + L-cysteine + NH4(+) (RHEA:14005)
catalytic activity: L-cysteine + H2O = hydrogen sulfide + pyruvate + NH4(+) + H(+) (RHEA:24931)
catalytic activity: L-homocysteine + H2O = 2-oxobutanoate + hydrogen sulfide + NH4(+) + H(+) (RHEA:14501)
catalytic activity: L-homoserine = 2-oxobutanoate + NH4(+) (RHEA:24923)
cofactor: pyridoxal 5'-phosphate
subunit: Homotetramer (By similarity). Interacts with CALM in a calcium-dependent manner (By similarity).
WP_000122291 cystathionine beta-lyase from Bacillus paranthracis
50% identity, 97% coverage
NP_001038050 cystathionine gamma-lyase from Sus scrofa
Q19QT7 Cystathionine gamma-lyase from Sus scrofa
50% identity, 93% coverage
PUV_18690 trans-sulfuration enzyme family protein from Parachlamydia acanthamoebae UV-7
51% identity, 99% coverage
A0A0D9S702 Cystathionine gamma-lyase from Chlorocebus sabaeus
50% identity, 93% coverage
- Proteomic screening identifies RPLp2 as a specific regulator for the translation of coronavirus
Dong, International journal of biological macromolecules 2023 - “...[NAD(P)(+)] 1.519017 A0A0D9RZH1 TRIP6 0.543401 150 A0A0D9R8V0 CENPV 1.26512 A0A0D9RAX8 GHITM 0.677351 A0A0D9RDE3 EML1 1.518292 A0A0D9S702 CTH 0.541408 151 A0A0D9QVK3 KRR1 1.263152 A0A0D9RW18 PAIP1 0.67656 A0A0D9RD66 CPNE1 1.516144 A0A0D9RDM5 DUT 0.53784 152 A0A0D9S398 APOA1 1.261682 A0A0D9QY32 LRP1 0.676311 A0A0D9QWD2 HSD17B11 1.508017 A0A0D9RE47 CYFIP2 0.531986 153 A0A0D9RKV9...”
NP_001040113 cystathionine gamma-lyase from Bombyx mori
49% identity, 95% coverage
Entcl_0641 trans-sulfuration enzyme family protein from [Enterobacter] lignolyticus SCF1
54% identity, 98% coverage
- Evidence supporting dissimilatory and assimilatory lignin degradation in Enterobacter lignolyticus SCF1
Deangelis, Frontiers in microbiology 2013 - “...formyltransferase 2 (complement(2053388..2054566)) Purine metabolism 2.080 0.779 Entcl_1559 Cytidine deaminase (complement(1657176..1658060)) Pyrimidine metabolism 3.710 1.169 Entcl_0641 Cys/Met metabolism pyridoxal-phosphate-dependent protein (complement(670311..671459)) None given 2.000 1.757 Entcl_3443 Taurine dioxygenase (complement(3672816..3673664)) Taurine and hypotaurine metabolism 14.850 2.995 Genome sequence analysis of SCF1 had revealed a lack of core...”
NP_001286578 cystathionine gamma-lyase, isoform B from Drosophila melanogaster
50% identity, 95% coverage
METB_MYCTU / P9WGB7 Cystathionine gamma-synthase; CGS; O-succinylhomoserine (thiol)-lyase; EC 2.5.1.48 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
MT1110 cystathionine gamma-synthase from Mycobacterium tuberculosis CDC1551
Rv1079 cystathionine gamma-synthase from Mycobacterium tuberculosis H37Rv
51% identity, 96% coverage
- function: Catalyzes the formation of L-cystathionine from O-succinyl-L- homoserine (OSHS) and L-cysteine, via a gamma-replacement reaction (By similarity). In the absence of thiol, catalyzes gamma-elimination to form 2-oxobutanoate, succinate and ammonia.
catalytic activity: O-succinyl-L-homoserine + L-cysteine = L,L-cystathionine + succinate + H(+) (RHEA:20397)
cofactor: pyridoxal 5'-phosphate (Binds 1 pyridoxal phosphate per subunit.)
subunit: Homotetramer. - Translational control plays an important role in the adaptive heat-shock response of Streptomyces coelicolor
Bucca, Nucleic acids research 2018 - “...have relevance to both processes ( 22 ). MATERIALS AND METHODS Polysome fractionation Streptomyces coelicolor MT1110 wild-type spores (2.8 \documentclass[12pt]{minimal} \usepackage{amsmath} \usepackage{wasysym} \usepackage{amsfonts} \usepackage{amssymb} \usepackage{amsbsy} \usepackage{upgreek} \usepackage{mathrsfs} \setlength{\oddsidemargin}{-69pt} \begin{document} }{}$ \times$\end{document} 10 9 cfu/ml) were pregerminated in 20 ml of 2YT medium in spring coil-fitted flasks...”
- “...g/ml) to arrest translation elongation. We previously determined the M.I.C. of chloramphenicol for S. coelicolor MT1110 as <40 g/ml on the SMMS medium used in this study ( Supplementary Figure S1 ); a concentration of 80 g/ml was previously demonstrated to arrest translation in S. coelicolor...”
- Development and application of versatile high density microarrays for genome-wide analysis of Streptomyces coelicolor: characterization of the HspR regulon
Bucca, Genome biology 2009 - “...methods Streptomyces strains and culture conditions For the ChIP-on-chip studies the prototrophic S. coelicolor strain MT1110, a SCP1 - SCP2 - derivative of the wild-type strain, John Innes Stock Number 1147 [ 57 ], was cultivated in YEME liquid medium plus 10% sucrose at 30C in...”
- “...the mycelium constituted a more reproducible method than the conventional lysozyme treatment methods. S. coelicolor MT1110 was cultivated at 30C in 50 ml YEME liquid medium in 250 ml flasks with springs (supplemented with 10% sucrose, glycine and MgCl 2 as specified in [ 58 ]...”
- The SsgA-like proteins in actinomycetes: small proteins up to a big task
Traag, Antonie van Leeuwenhoek 2008 - “...Transcriptional regulation of the ssg genes in streptomycetes Microarray analysis of S. coelicolor M145 and MT1110 and promoter-probe experiments in S. coelicolor indicated that all ssg genes except ssgD are developmentally regulated (Noens etal. 2005 ; Noens etal. 2007 ). In contrast to the other ssg...”
- Roles of aconitase in growth, metabolism, and morphological differentiation of Streptomyces coelicolor
Viollier, Journal of bacteriology 2001 - “...(100 g/ml), or apramycin (50 g/ml). S. coelicolor MT1110 is a prototrophic, plasmid-free (SCP1 SCP2) derivative of S. coelicolor A3(2) (15, 16, 39)....”
- “...due to the lability of aconitase enzyme activity. S. coelicolor MT1110 mycelium (70 g [wet weight]) was lysed by sonication in 200 ml buffer A (20 mM Tris-HCl...”
- Role of acid metabolism in Streptomyces coelicolor morphological differentiation and antibiotic biosynthesis
Viollier, Journal of bacteriology 2001 - “...cultivation. S. coelicolor A3 (2) derivatives used were MT1110 (SCP1 SCP2) and J1501 (hisA1 uraA1 strA1 pgl SCP1 SCP2). The developmentally blocked S....”
- “...were synthesized to PCR amplify a fragment of citA from MT1110 genomic DNA. Taq DNA polymerase (5 U; Boehringer) was used in a PCR mixture (consisting of 100...”
- Interplay between Sulfur Assimilation and Biodesulfurization Activity in Rhodococcus qingshengii IGTS8: Insights into a Regulatory Role of the Reverse Transsulfuration Pathway
Martzoukou, mBio 2022 - “...). (B) Comparison of R. qingshengii IGTS8 MetB with M. tuberculosis C-S/L (UniProt accession no. P9WGB7 ), C. glutamicum CS (UniProt accession no. Q79VD9 ), E. coli cystathionine -synthase (UniProt accession no. P00935 ), S. cerevisiae cystathionine -lyase (UniProt accession no. P31373 ), and human cystathionine...”
- S-Adenosylmethionine-responsive cystathionine β-synthase modulates sulfur metabolism and redox balance in Mycobacterium tuberculosis
Bandyopadhyay, Science advances 2022 - “...that Mtb activates the FTS pathway of Met biosynthesis. Mtb encodes a bifunctional enzyme, MetB (Rv1079), which has both CGS and Cysth -lyase (CGL) activities ( 43 ) and therefore could generate Cysth to fuel Met biosynthesis and maintain viability in response to AZA. To test...”
- Mycobacterium tuberculosis H2S Functions as a Sink to Modulate Central Metabolism, Bioenergetics, and Drug Susceptibility
Kunota, Antioxidants (Basel, Switzerland) 2021 - “...2 S, pyruvate, and ammonia [ 19 ]. Elegant biochemical studies have shown that Mtb Rv1079 possesses both CSE and cystathionine -synthase (CGS) activity [ 27 ]. However, Rv1079 lacks Cys desulfhydrase activity, and these authors speculated that an as yet uncharacterized enzyme performed this important...”
- The Role of Host-Generated H2S in Microbial Pathogenesis: New Perspectives on Tuberculosis
Rahman, Frontiers in cellular and infection microbiology 2020 - “...( Liu etal., 2020 ). Of note, Mtb encodes putative orthologs of CBS (Rv1077), CSE (Rv1079), and 3-MST (Rv2291). Biochemical studies of the Mtb transsulfuration pathway revealed that Rv1079 is a dual-function enzyme with CSE activity (catalyzes cystathionine to cysteine) and cystathionine -synthase (CGS) activity (catalyzes...”
- “...including mammals. CDS activity has been observed in WT Mtb as well as a Mtb rv1079 deletion mutant, and this activity was not inhibited by PAG. Hence, the CSD activity in Mtb is catalyzed by an unknown protein(s) using L-cysteine or L-cystine as a substrate (...”
- Proteome Remodeling in Response to Sulfur Limitation in "Candidatus Pelagibacter ubique"
Smith, mSystems 2016 - “.... Pelagibacter ubique have high sequence similarity (E values of 6e50 and 2e45, respectively) to Rv1079, a gene in Mycobacterium tuberculosis that has been suggested to act as a cystathionine gamma-lyase (EC 4.4.1.1) to catalyze the reversible reaction from cystathionine to cysteine ( 55 ). Therefore,...”
- Deciphering the metabolic response of Mycobacterium tuberculosis to nitrogen stress
Williams, Molecular microbiology 2015 - “...0.037 2 1 Aspartate carbamoyltransferase Rv1380, Rv1381 d8 0.037 2 1 O succinylhomoserine lyase Rv0391, Rv1079 d9 0.039 1 1 Fatty acyl ACP hydrolase Rv2928 d10 0.041 1 1 NADH dehydrogenase demethylmenaquinone 8 Rv0082, Rv3145, Rv3146, Rv3147, Rv3148, Rv3149, Rv3150, Rv3152, Rv3153, Rv3154, Rv3155, Rv3156, Rv3157,...”
- Regulation of homocysteine metabolism by Mycobacterium tuberculosis S-adenosylhomocysteine hydrolase
Singhal, Scientific reports 2013 - “...M. tuberculosis H37Rv as follows: 1- SahH (Rv3248c), 2- Cystathionine -synthase (Rv1077), 3- Cystathionine -synthase (Rv1079), 4- Adenosine kinase (Rv2202c), 5- Adenylate kinase (Rv0733), 6- Adenosine deaminase (Rv3313c), 7- Methionine synthase (Rv2124c and Rv1133c), 8- S-adenosylmethionine synthetase (Rv1392) and 9- Methyltransferases, which transfer methyl group (CH...”
- New targets and inhibitors of mycobacterial sulfur metabolism
Paritala, Infectious disorders drug targets 2013 - “...of TB infection may be warranted. METHIONINE BIOSYNTHESIS AND REVERSE TRANSSULFURATION In M. tuberculosis , Rv1079 (annotated as metB ) encodes a bi-functional cysteine -lyase (CGL)-cystathionine -synthase (CGS) enzyme, converts cysteine to cystathionine [ 249 ]. Cystathionine is then transformed into methionine by two subsequent reactions:...”
- “...infection [ 344 ]. Subsequently, cysM2 (Rv1077) converts homocysteine to cystathionine and the bifunctional enzyme, Rv1079 (annotated as metB ) encodes a bifunctional cysteine -lyase (CGL)-cystathionine -synthase (CGS) enzyme catalyzes the cystathionine to cysteine [ 249 ]. Thus, M. tuberculosis can shuttle the sulfur source between...”
- Descriptive proteomic analysis shows protein variability between closely related clinical isolates of Mycobacterium tuberculosis
Mehaffy, Proteomics 2010 - “...0.55 0.57 7 3 6.90 15608163 Rv1023 eno 1.03 1.48 1.32 7 1 3.50 15608219 Rv1079 metB 1.52 1.11 1.08 7 3 12.37 15608492 a Rv1352 -- 0.57 0.49 0.60 10 1 11.38 [ 23 ] 15608531 Rv1392 metK 0.69 1.80 0.98 7 4 14.89 [...”
- More
wcw_1145 trans-sulfuration enzyme family protein from Waddlia chondrophila WSU 86-1044
49% identity, 99% coverage
Gmet_0698 Cys/Met metabolism pyridoxal-phosphate-dependent enzymes from Geobacter metallireducens GS-15
50% identity, 96% coverage
- The genome sequence of Geobacter metallireducens: features of metabolism, physiology and regulation common and dissimilar to Geobacter sulfurreducens
Aklujkar, BMC microbiology 2009 - “...the first dedicated enzyme of methionine biosynthesis, and also two linked cystathionine- -synthase/cystathionine- -lyase genes (Gmet_0698 = GSU0944; Gmet_0699 = GSU0945, 49% and 51% identical to the Lactococcus lactis lyase [ 56 , 57 ]). Phylogenetic analysis could not distinguish the synthase from the lyase (data...”
- “...respectively). In G. metallireducens , transsulfuration may also be controlled by a GC-rich element between Gmet_0698 and Gmet_0699, which contains four tandem repeats of the heptanucleotide GGGACCG and is found in 49 intergenic and intragenic locations in the genome (Additional file 6 : Figure S2, Additional...”
CGL_MOUSE / Q8VCN5 Cystathionine gamma-lyase; CGL; CSE; Cysteine desulfhydrase; Cysteine-protein sulfhydrase; Gamma-cystathionase; Homocysteine desulfhydrase; EC 4.4.1.1; EC 4.4.1.2 from Mus musculus (Mouse) (see 6 papers)
49% identity, 94% coverage
- function: Catalyzes the last step in the trans-sulfuration pathway from L-methionine to L-cysteine in a pyridoxal-5'-phosphate (PLP)-dependent manner, which consists on cleaving the L,L-cystathionine molecule into L-cysteine, ammonia and 2-oxobutanoate. Part of the L-cysteine derived from the trans-sulfuration pathway is utilized for biosynthesis of the ubiquitous antioxidant glutathione. Besides its role in the conversion of L-cystathionine into L-cysteine, it utilizes L-cysteine and L- homocysteine as substrates (at much lower rates than L,L-cystathionine) to produce hydrogen sulfide (H2S). In vitro, it converts two L-cysteine molecules into lanthionine and H2S, and two L-homocysteine molecules to homolanthionine and H2S, which can be particularly relevant under conditions of severe hyperhomocysteinemia. Lanthionine and homolanthionine are structural homologs of L,L-cystathionine that differ by the absence or presence of an extra methylene group, respectively (By similarity). Acts as a cysteine-protein sulfhydrase by mediating sulfhydration of target proteins: sulfhydration consists of converting -SH groups into -SSH on specific cysteine residues of target proteins such as GAPDH, PTPN1 and NF-kappa-B subunit RELA, thereby regulating their function (PubMed:19903941, PubMed:22244329). By generating the gasotransmitter H2S, it participates in a number of physiological processes such as vasodilation, bone protection, and inflammation (By similarity) (PubMed:18948540). Plays an essential role in myogenesis by contributing to the biogenesis of H2S in skeletal muscle tissue (PubMed:33826201). Can also accept homoserine as substrate (By similarity). Catalyzes the elimination of selenocystathionine (which can be derived from the diet) to yield selenocysteine, ammonia and 2-oxobutanoate (By similarity).
catalytic activity: L,L-cystathionine + H2O = 2-oxobutanoate + L-cysteine + NH4(+) (RHEA:14005)
catalytic activity: L-cysteine + H2O = hydrogen sulfide + pyruvate + NH4(+) + H(+) (RHEA:24931)
catalytic activity: L-homocysteine + H2O = 2-oxobutanoate + hydrogen sulfide + NH4(+) + H(+) (RHEA:14501)
catalytic activity: L-homoserine = 2-oxobutanoate + NH4(+) (RHEA:24923)
catalytic activity: L-selenocystathionine + H2O = L-selenocysteine + 2- oxobutanoate + NH4(+) (RHEA:31151)
cofactor: pyridoxal 5'-phosphate
subunit: Homotetramer (By similarity). Interacts with CALM in a calcium-dependent manner (PubMed:18948540).
disruption phenotype: No visible phenotype at birth. Mice exhibit strongly decreased levels of hydrogen sulfide (H2S) in heart and aorta. Mice also show absence of protein sulfhydration on target proteins. Hydrogen sulfide serum levels are also lower than normal. No effect on brain hydrogen sulfide levels. Age-dependent hypertension beginning at about seven weeks of age (PubMed:18948540, PubMed:19903941). Deteriorated the loss of skeletal muscle mass in aging mice (PubMed:33826201). - Effect of Semaglutide and Empagliflozin on Pulmonary Structure and Proteomics in Obese Mice.
Yang, Diabetes, metabolic syndrome and obesity : targets and therapy 2024 - “...5 Chmp5 Down Up Q8BHC0 Lymphatic vessel endothelial hyaluronic acid receptor 1 Lyve1 Down Up Q8VCN5 Cystathionine gamma-lyase Cth Down Up P03953 Complement factor D Cfd Down Up Table 2 Comparison of DEPs Between HFD/NCD and Empa/HFD Groups Accession Protein Name Gene Name HFD/NCD Empa/HFD Q99L60...”
- Proteomic Analysis of Protective Effects of Dl-3-n-Butylphthalide against mpp + -Induced Toxicity via downregulating P53 pathway in N2A Cells
Zhao, Proteome science 2023 - “...0.002081 Q8VD46 Asz1 \Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 \"" 0.032754 Q8VCN5 Cth Cystathionine gamma-lyase 9.08E-05 Q8R1G6 Pdlim2 PDZ and LIM domain protein 2 0.000344 Q8R1F1 Fam129b Niban-like protein 1 0.000115 Q8R191 Syngr3 Synaptogyrin-3 0.000281 Q8R035 Mrpl58 \Peptidyl-tRNA hydrolase ICT1, mitochondrial \""...”
- Transcriptome analysis of genes and pathways associated with metabolism in Scylla paramamosain under different light intensities during indoor overwintering.
Li, BMC genomics 2020 - “...metabolism. 2-amino-3-ketobutyrate coenzyme A ligase (ID: O75600; LL: 2.13-fold, HL: 2.49-fold) and cystathionine gamma-lyase (ID: Q8VCN5; LL: 4.08-fold, HL: 16.10-fold) were up-regulated in both pathways. Betaine--homocysteine S-methyltransferase 1 (ID: Q5XGM3) was down-regulated in the LL group (0.53-fold) and up-regulated in the HL group (7.34-fold). In the...”
- “...0.3899 0.0042 0.3054 2.12E-05 2-amino-3-ketobutyrate coenzyme A ligase O75600 2.1360 0.0470 2.4998 0.0070 Cystathionine gamma-lyase Q8VCN5 4.0899 0.0094 16.1023 7.93E-05 Peroxisomal sarcosine oxidase Q29RU9 0.1632 2.73E-09 0.4559 0.0016 Betaine--homocysteine S-methyltransferase 1 Q5XGM3 0.5321 0.0447 7.3483 0.0184 beta-Alanine metabolism (ko00410) Aldehyde dehydrogenase P81178 0.2589 3.45E-06 0.4912 0.0037...”
- Maternal High Fat Diet and in-Utero Metformin Exposure Significantly Impact upon the Fetal Renal Proteome of Male Mice.
Nüsken, Journal of clinical medicine 2019 - “...3.6 0 3 Gtf2f2 # O89051 Integral membrane protein 2B <0.05 3.4 0 3 Itm2b Q8VCN5 Cystathionine gamma-lyase <0.05 3.3 0 3 Cth * O35682 Myeloid-associated differentiation marker <0.05 3.3 0 3 Myadm Q3UI43 BRISC and BRCA1-A complex member 1 <0.05 3.2 0 3 Babam1 P38060...”
- Liver proteome of mice with different genetic susceptibilities to the effects of fluoride
Khan, Journal of applied oral science : revista FOB 2016 - “...protein 176 66.5 + - P50172 Hsd11b1 Corticosteroid 11-beta-dehydrogenase isozyme 1 100.4 + - Cth Q8VCN5 Cystathioninegamma-lyase 100.5 - + P48771 Cox7a2 Cytochrome c oxidase subunit 7A2, mitochondrial 185.6 + - P10518 Alad Delta-aminolevulinicaciddehydratase 316.8 + - Q9DBT9 Dmgdh Dimethylglycinedehydrogenase, mitochondrial 89.4 + - Q99LC5 Etfa...”
- Renal proteome in mice with different susceptibilities to fluorosis
Carvalho, PloS one 2013 - “...specific acyl-CoA dehydrogenase, mitochondrial 41/6.805 42.2/6.3 9/396 Q07417 Metabolism 567 Cystathionine gamma-lyase 43.5/7.99 43.6/7.6 5/163 Q8VCN5 Metabolism 568 Hydroxymethylglutaryl-CoA synthase, cytoplasmic 56/5.7 57.6/5.65 2/62 Q8JZK9 Metabolism 586 Probable D-lactate dehydrogenase, mitochondrial 37.5/8.23 19.1/6.2 2/84 Q7TNG8 Metabolism 562 Thiomorpholine-carboxylate dehydrogenase 37.5/5.09 33.5/5.44 8/395 O54983 Metabolism 560 Phenazine...”
- Predicting functional family of novel enzymes irrespective of sequence similarity: a statistical learning approach.
Han, Nucleic acids research 2004 - “...2.5 Methionine gamma-lyase (P13254) EC 4.4 2.00E15 E1->W;E2->F2 Exocellobiohydrolase 1 (P38676) EC 3.2 Cystathionine gamma-lyase (Q8VCN5) EC 4.4 1.00E12 E1->W;E2->F2 Maleylacetoacetate isomerase (P57109) EC 5.2 Glutathione S -transferase zeta class (P57108) EC 2.5 1.00E51 E1->F1;E2->F2 + Tyrosine-protein kinase FRK (P42685) EC 2.7 Intestinalguanylate cyclase (P70106) EC...”
- SVM-Prot: Web-based support vector machine software for functional classification of a protein from its primary sequence.
Cai, Nucleic acids research 2003
Q9EQS4 Cystathionine gamma-lyase from Rattus norvegicus
48% identity, 94% coverage
- Biological Effects of Korean Red Ginseng Polysaccharides in Aged Rat Using Global Proteomic Approach.
Lee, Molecules (Basel, Switzerland) 2020 - “...5.5 0.00000 Spectrin alpha chain, non-erythrocytic 1 Sptan1 Q6IRK8 9.0 0.00017 Cystathionase (Cystathionine gamma-lyase) LOC103691744 Q9EQS4 4.9 0.00000 Stabilin 2/HARE Stab2 E0X583 8.9 0.00017 Brefeldin A inhibited guanine nucleotide-exchange protein 2 Arfgef2 Q7TSU1 4.6 0.00000 Microtubule-actin crosslinking factor 1 Macf1 A0A0G2K9T4 8.8 0.00017 Leucyl-tRNA synthetase Lars...”
8j6nA / P18757 Crystal structure of cystathionine gamma-lyase in complex with compound 1 (see paper)
48% identity, 96% coverage
- Ligand: [6-methyl-4-[(~{e})-(oxamoylhydrazinylidene)methyl]-5-oxidanyl-pyridin-3-yl]methyl dihydrogen phosphate (8j6nA)
W5PQY2 Cystathionine gamma-lyase from Ovis aries
XP_004002126 cystathionine gamma-lyase from Ovis aries
50% identity, 89% coverage
LOC100159560 cystathionase-like from Acyrthosiphon pisum
48% identity, 94% coverage
- The boom and bust of the aphid's essential amino acid metabolism across nymphal development
Pers, G3 (Bethesda, Md.) 2021 - “...Down Down LOC100159441 Trehalose transporter; Tret1 N/A: Transporter Down LOC100166971 Phenylalanine 4-monooxygenase; PAH 1.14.16.1 Down LOC100159560 Cystathionase-likeF 4.4.1.1 Down Down LOC100160139 Glutamine synthetase 2; GS2 6.3.1.2 Down LOC100163589 Phosphoserine transaminase 2.6.1.52 Down LOC100161178 L-Threonine aldolase 2 4.1.2.48 Down LOC100160265 Asparagine synthase 6.3.5.4 Down Down LOC100164179 Asparaginase...”
- Aphid genome expression reveals host-symbiont cooperation in the production of amino acids
Hansen, Proceedings of the National Academy of Sciences of the United States of America 2011 - “...Table 1). The other two (LOC100165866 and LOC100159560), encoding enzymes (4.3.1.19 and 4.4.1.8, respectively) in the isoleucine and methionine pathways, are...”
- “...LOC100166971 XP_001945589.1 LOC100159197 XP_001951155.1 LOC100159560 NP_001157405.1 LOC100168557 XP_001945392.1 LOC100159972 XP_001946395 Nonessential amino...”
J9EI41 cystathionine gamma-lyase from Wuchereria bancrofti
49% identity, 94% coverage
Cth / P18757 cystathionine γ-lyase subunit (EC 4.4.1.1) from Rattus norvegicus (see 15 papers)
CGL_RAT / P18757 Cystathionine gamma-lyase; CGL; CSE; Cysteine desulfhydrase; Cysteine-protein sulfhydrase; Gamma-cystathionase; Homocysteine desulfhydrase; Probasin-related antigen; PRB-RA; EC 4.4.1.1; EC 4.4.1.2 from Rattus norvegicus (Rat) (see paper)
48% identity, 94% coverage
- function: Catalyzes the last step in the trans-sulfuration pathway from L-methionine to L-cysteine in a pyridoxal-5'-phosphate (PLP)-dependent manner, which consists on cleaving the L,L-cystathionine molecule into L-cysteine, ammonia and 2-oxobutanoate (Probable) (PubMed:13525371). Part of the L-cysteine derived from the trans-sulfuration pathway is utilized for biosynthesis of the ubiquitous antioxidant glutathione. Besides its role in the conversion of L-cystathionine into L-cysteine, it utilizes L-cysteine and L-homocysteine as substrates (at much lower rates than L,L-cystathionine) to produce hydrogen sulfide (H2S). In vitro, it converts two L-cysteine molecules into lanthionine and H2S, and two L-homocysteine molecules to homolanthionine and H2S, which can be particularly relevant under conditions of severe hyperhomocysteinemia. Lanthionine and homolanthionine are structural homologs of L,L-cystathionine that differ by the absence or presence of an extra methylene group, respectively. Acts as a cysteine-protein sulfhydrase by mediating sulfhydration of target proteins: sulfhydration consists of converting -SH groups into -SSH on specific cysteine residues of target proteins such as GAPDH, PTPN1 and NF-kappa- B subunit RELA, thereby regulating their function. By generating the gasotransmitter H2S, it participates in a number of physiological processes such as vasodilation, bone protection, and inflammation (By similarity). Plays an essential role in myogenesis by contributing to the biogenesis of H2S in skeletal muscle tissue (By similarity). Can also accept homoserine as substrate (PubMed:13525371). Catalyzes the elimination of selenocystathionine (which can be derived from the diet) to yield selenocysteine, ammonia and 2-oxobutanoate (Probable).
catalytic activity: L,L-cystathionine + H2O = 2-oxobutanoate + L-cysteine + NH4(+) (RHEA:14005)
catalytic activity: L-homoserine = 2-oxobutanoate + NH4(+) (RHEA:24923)
catalytic activity: L-selenocystathionine + H2O = L-selenocysteine + 2- oxobutanoate + NH4(+) (RHEA:31151)
catalytic activity: L-cysteine + H2O = hydrogen sulfide + pyruvate + NH4(+) + H(+) (RHEA:24931)
catalytic activity: L-homocysteine + H2O = 2-oxobutanoate + hydrogen sulfide + NH4(+) + H(+) (RHEA:14501)
cofactor: pyridoxal 5'-phosphate
subunit: Homotetramer (By similarity). Interacts with CALM in a calcium-dependent manner (By similarity). - Investigation into potential mechanisms of metabolic syndrome by integrative analysis of metabolomics and proteomics.
Chen, PloS one 2022 - “...1 Homocysteine metabolism. 1.314 0.0039 Cps1 P07756 Carbamoyl-phosphate synthase [ammonia] Urea cycle 1.29 0.0003 Cth P18757 Cystathionine gamma-lyase Cysteine biosynthesis 1.277 0.0019 Cyp2b2 P04167 Cytochrome P450 2B2 Oxidoreductase 0.398 0.0421 Cyp2c7 P05179 Cytochrome P450 2C7 Oxidoreductase 1.332 0.0122 Cyp3a18 Q64581 Cytochrome P450 3A18 Oxidoreductase 0.719 0.0006...”
- Identification of protein targets for the antidepressant effects of Kai-Xin-San in Chinese medicine using isobaric tags for relative and absolute quantitation.
Dong, Neural regeneration research 2020 - “...D4A0W4, M0RBK9, G3V795, F1M9F9, D4A7Q3, D3ZP34, Q8VID1, Q3B8N7, Q8CFC9 ,F1M208, D3ZXY8, Q4QQW3, M0R9P1,O3534, F1LNP1, Q497A9, P18757, Q80XX4, W4VSR4, D4A1C1, D3ZS15, P04550, F1M0N1, Q712U5, D4A2D8, D3ZFB6, F1M8Y2, D3ZIV3, D4A8N1, P07936 O88600, D3ZJF8, Q6IFW6, D3ZDA6, Q4FZU2, Q6IMF3, Q5U2Y6, P84087, D3ZDE4, Q6IG04, D3ZS28, E9PU01, Q64598, F1LNE8, Q6IG02, Q05140, G3V9B3,...”
- Functional proteomic analysis of corticosteroid pharmacodynamics in rat liver: Relationship to hepatic stress, signaling, energy regulation, and drug metabolism.
Ayyar, Journal of proteomics 2017 - “...Cystathionine beta-synthase Transsulfuration pathway - mediates elimination of L-methionine and the toxic metabolite L-homocysteine UP P18757 Cth Cystathionine gamma-lyase Last step in the trans-sulfuration pathway from methionine to cysteine DOWN P00173 Cyb5a Cytochrome b5 Hemoprotein which functions as an electron carrier for several membrane bound oxygenases...”
- Peptidomic Analysis of Rat Plasma: Proteolysis in Hemorrhagic Shock.
Aletti, Shock (Augusta, Ga.) 2016 - “...Stmn1 chymotrypsin-like ASTVRPSFSLGNETLKVPLALF Q5I0D7 Pepd chymotrypsin-like ASVLTAQPRLMEPIY P05197 Eef2 chymotrypsin-like ATGKPRYVVLVPSEL Q63041 A1m chymotrypsin-like ATTFKQDSPGQSSGFVY P18757 Cth chymotrypsin-like ATTVSTQRGPVY A2RUW1 Tollip chymotrypsin-like AVYSLSKSY Q03626 Mug1 chymotrypsin-like DEPQSQWDRVKDF P04639 Apoa1 chymotrypsin-like DGILGRDTLPHEDQGKGRQLHSLTL P05545 Serpina3k chymotrypsin-like DIISNILHNF D3ZY96 Ngp chymotrypsin-like DIVLTQSPVL F1LYU4 chymotrypsin-like EAHKSEIAHRFKDLGEQHFKGL P02770 Alb chymotrypsin-like ELVEAYQEQAKGLLDGGVDILL...”
- “...Psma1 chymotrypsin-like MIVESETQSPLF P17475 Serpina1 chymotrypsin-like MMDQARSAFSNLF G3V679 Tfrc chymotrypsin-like MNAAAEAEFNIL Q80Z29 Nampt chymotrypsin-like MQKDASSSGFLPSFQHF P18757 Cth chymotrypsin-like PKPDSEAGTAFIQTQQLHAAMADTF P11980 Pkm2 chymotrypsin-like PYEIKKVF Q5RKI0 Wdr1 chymotrypsin-like RKLQPNLYVVAELFTGSEDL D4AEH9 Agl chymotrypsin-like RLLWESGSLL M0RBF1 C3 chymotrypsin-like RVELDTKSYWKALGISPFHEY P02767 Ttr chymotrypsin-like SEIAHRFKDLGEQHFKGLVL P02770 Alb chymotrypsin-like SEKKQPVDLGLLEEDDEF D3ZHW9 Shfm1 chymotrypsin-like...”
- Platelet-derived growth factor-BB induces cystathionine γ-lyase expression in rat mesangial cells via a redox-dependent mechanism.
Hassan, British journal of pharmacology 2012
XP_005204538 cystathionine gamma-lyase isoform X1 from Bos taurus
50% identity, 86% coverage
METI_BACSU / O31631 Cystathionine gamma-synthase/O-acetylhomoserine (thiol)-lyase; CGS/OAH thiolyase; O-acetylhomoserine sulfhydrylase; OAH sulfhydrylase; EC 2.5.1.- from Bacillus subtilis (strain 168) (see paper)
BSU11870 cystathionine gamma-synthase from Bacillus subtilis subsp. subtilis str. 168
49% identity, 99% coverage
- function: Catalyzes the formation of L-cystathionine from O-acetyl-L- homoserine and L-cysteine. Cannot use O-succinyl-L-homoserine as substrate. Also exhibits O-acetylhomoserine thiolyase activity, catalyzing the synthesis of L-homocysteine from O-acetyl-L-homoserine and sulfide.
catalytic activity: O-acetyl-L-homoserine + L-cysteine = L,L-cystathionine + acetate + H(+) (RHEA:30931)
catalytic activity: O-acetyl-L-homoserine + hydrogen sulfide = L-homocysteine + acetate (RHEA:27822)
cofactor: pyridoxal 5'-phosphate
subunit: Homotetramer.
disruption phenotype: Cells lacking this gene are unable to grow in the presence of sulfate or cysteine as sole sulfur source, whereas their growth in the presence of homocysteine, cystathionine or methionine is similar to that of the wild-type strain. - A Survey of Pyridoxal 5'-Phosphate-Dependent Proteins in the Gram-Positive Model Bacterium Bacillus subtilis
Richts, Frontiers in molecular biosciences 2019 - “...Grundy and Henkin, 1998 ; Auger et al., 2002 ; Tomsic et al., 2008 MetI BSU11870 No 4L0O ( H. pylori , 48%) O-Succinyl-homoserine lyase Methionine biosynthesis SigA, S-box MccB (48%), MetC (43%)/trans-sulfuration enzyme family Grundy and Henkin, 1998 ; Auger et al., 2002 ; Tomsic...”
9axjA / A0A9P2TCP3 Cystathionine gamma lyase from thermobifida fusca in an amino crotonate form (see paper)
53% identity, 98% coverage
- Ligand: (2e)-2-{[(1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}but-2-enoic acid (9axjA)
D0NAM5 cystathionine gamma-lyase from Phytophthora infestans (strain T30-4)
PITG_08445 cystathionine gamma-lyase from Phytophthora infestans T30-4
50% identity, 91% coverage
- A sulfur-containing volatile emitted by potato-associated bacteria confers protection against late blight through direct anti-oomycete activity
Chinchilla, Scientific reports 2019 - “...First, DMTS led to higher abundance of enzymes involved in the synthesis of both cysteine (D0NAM5, 2.5x) and methionine (D0NMR7, 3.9x). Both amino acids are not only protein constituents, but also precursors of important sulfur-compounds (cysteine), such as glutathione, coenzyme A or Fe-S clusters, or methyl...”
- “...of oxidized methionine DMTS D0NX78 PITG_18187 0.565 Sulfite reductase NADPH subunit EC: 1.8.1.2 Sulfur reduction D0NAM5 PITG_08445 2.516 Cystathionine lyase EC:4.4.1.1 Cysteine synthesis D0NMR7 PITG_13769 3.89 Homocysteine S-methyltransferase (EC:2.1.1.10?) Methionine synthesis ON with DMDS D0NSN9 PITG_16020 ON Putative desulfhydrase? (EC:4.4.1.28?) Degradation of cysteine, production of H...”
- A sulfur-containing volatile emitted by potato-associated bacteria confers protection against late blight through direct anti-oomycete activity
Chinchilla, Scientific reports 2019 - “...oxidized methionine DMTS D0NX78 PITG_18187 0.565 Sulfite reductase NADPH subunit EC: 1.8.1.2 Sulfur reduction D0NAM5 PITG_08445 2.516 Cystathionine lyase EC:4.4.1.1 Cysteine synthesis D0NMR7 PITG_13769 3.89 Homocysteine S-methyltransferase (EC:2.1.1.10?) Methionine synthesis ON with DMDS D0NSN9 PITG_16020 ON Putative desulfhydrase? (EC:4.4.1.28?) Degradation of cysteine, production of H 2...”
Q58DW2 Cystathionine gamma-lyase from Bos taurus
50% identity, 89% coverage
BLD_0913 cystathionine gamma-synthase from Bifidobacterium longum DJO10A
49% identity, 96% coverage
- Regulatory mechanism of cysteine-dependent methionine biosynthesis in <i>Bifidobacterium longum</i>: insights into sulfur metabolism in gut microbiota
Kim, Gut microbes 2024 - “...by other intestinal bacteria, combined with O- succinyl homoserine by cystathionine -synthase ( metB , BLD_0913), without a sulfate-reducing mechanism, producing cystathionine. 5 This cystathionine is then converted to cysteine by cystathionine -lyase (BLD_1679). Additionally, cystathionine is converted to homocysteine by cystathionine--lyase ( metC , BLD_0095)...”
- “...analysis was performed to investigate how the expression of related enzyme genes (BLD_1130, BLD_0674, BLD_0538, BLD_0913, BLD_0095, and BLD_0914) is influenced by the presence of sulfur-containing amino acids in DJO10A. Based on these findings, the biosynthetic pathways for cysteine and methionine were elucidated. This metabolic characterization...”
3qhxA / A0PKT3 Crystal structure of cystathionine gamma-synthase metb (cgs) from mycobacterium ulcerans agy99 bound to hepes (see paper)
50% identity, 98% coverage
- Ligand: 4-(2-hydroxyethyl)-1-piperazine ethanesulfonic acid (3qhxA)
SP5448_RS00875 trans-sulfuration enzyme family protein from Streptococcus pyogenes
47% identity, 99% coverage
BL1155 cystathionine gamma-synthase from Bifidobacterium longum NCC2705
BBMN68_917, BLGT_RS03020 cystathionine gamma-synthase from Bifidobacterium longum subsp. longum GT15
49% identity, 96% coverage
- Low-pH adaptation and the acid tolerance response of Bifidobacterium longum biotype longum
Sánchez, Applied and environmental microbiology 2007 - “...acid transport and metabolism BL80 BL10 BL12 metE metB dppD BL0798 BL1155 BL1390 85.4 41.9 73.2 5.2 5.3 5.9 47 77 64 4.32E 25 1.08E 11 1.12E 15 Up Up Down BL85...”
- Oxidative Stress Response of Probiotic Strain Bifidobacterium longum subsp. longum GT15
Averina, Foods (Basel, Switzerland) 2023 - “...P-type ATPase BLGT_RS01395 NS 17.40 2.24 5.65 NS 9.48 RP Stress response 6 Cystathionine gamma-synthase BLGT_RS03020 2.63 11.43 5.78 2.86 5.74 2.96 E 7 Co-chaperonin GroES groES NS 35.69 NS 4.84 2.18 46.57 O 8 Transcription elongation factor GreA BLGT_RS03800 NS 0.73 2.23 4.47 NS 5.28...”
- Integrated transcriptomic and proteomic analysis of the bile stress response in a centenarian-originated probiotic Bifidobacterium longum BBMN68
An, Molecular & cellular proteomics : MCP 2014 - “...BBMN68_1663 BBMN68_1360 28 30 33 argG ilvC1 metC3 BBMN68_809 BBMN68_1262 BBMN68_917 40 41 2 10 19 26 27 35 hisG asd pyrG purA purH prsA2 pyrD1 pyrI BBMN68_464...”
- Mechanism analysis of acid tolerance response of bifidobacterium longum subsp. longum BBMN 68 by gene expression profile using RNA-sequencing
Jin, PloS one 2012 - “...by more than 2 fold. Neutralizing H + The genes BBMN68_1526 encoding cystathionine beta-lyase (MalY1), BBMN68_917 encoding cystathionine gamma-synthase (MetC3) and BBMN68_918 encoding cystathionine beta-synthase (CysK) involved in cysteine metabolism pathway were upregulated by 9.25, 2.71, and 2.84 fold, respectively ( Table 4 ). The reactions...”
- “...S-adenosylmethionine synthetase [EC:2.5.1.6] BBMN68_918 265.56 744 2.80 * E COG0031 cysK K01697, cystathionine beta-synthase [EC:4.2.1.22] BBMN68_917 359.99 976.06 2.71 * E COG0626 metC3 K01739, cystathionine gamma-synthase [EC:2.5.1.48] BBMN68_1263 2667.41 18881.2 7.08 * EH COG0059 ilvC2 K00053, ketol-acid reductoisomerase [EC:1.1.1.86] BBMN68_16 99.73 224.99 2.26 * EG COG0129...”
C4N14_10525, HMPREF0397_RS04485 methionine gamma-lyase from Fusobacterium nucleatum subsp. nucleatum ATCC 23726
50% identity, 95% coverage
- A global survey of small RNA interactors identifies KhpA and KhpB as major RNA-binding proteins in Fusobacterium nucleatum
Zhu, Nucleic acids research 2024 - “...influences a wider range of gene expression compared to KhpA. For example, the gene megL (C4N14_10525), which encodes methionine gamma-lyase, was highly downregulated in khpB in the early stationary phase (Figure 7B ). Overall, these data show that KhpA/B influence gene expression in F. nucleatum ....”
- Genetic Determinants of Hydrogen Sulfide Biosynthesis in Fusobacterium nucleatum Are Required for Bacterial Fitness, Antibiotic Sensitivity, and Virulence
Chen, mBio 2022 - “...harbor mutant alleles. To generate a triple mutant lacking cysK2 (HMPREF0397_RS09315), hly (HMPREF0397_RS08940), and megL (HMPREF0397_RS04485), a single mutant was used as a starting strain. Plasmid construction. (i) pCysK1. A DNA fragment containing the cysK1 (HMPREF0397_RS07615) coding sequence and its promoter region was PCR amplified using...”
- The Fused Methionine Sulfoxide Reductase MsrAB Promotes Oxidative Stress Defense and Bacterial Virulence in Fusobacterium nucleatum
Scheible, mBio 2022 - “...eutH Ethanolamine utilization protein 33.96 HMPREF0397_RS01500 Ethanolamine ammonia-lyase subunit 32.80 HMPREF0397_RS01535 Ethanolamine utilization protein 30.67 HMPREF0397_RS04485 megL Methionine gamma-lyase 15.27 HMPREF0397_RS01490 eutA Ethanolamine ammonia-lyase reactivating factor 14.06 HMPREF0397_RS04495 nifJ Pyruvate-ferredoxin (flavodoxin) oxidoreductase 12.56 HMPREF0397_RS01550 DUF861 domain-containing protein 9.35 HMPREF0397_RS06445 NAD(P)/FAD-dependent oxidoreductase 7.08 HMPREF0397_RS03635 Urocanate hydratase 6.97...”
A0PKT3 cystathionine gamma-synthase (EC 2.5.1.48) from Mycobacterium ulcerans (see paper)
50% identity, 96% coverage
- Structure of the cystathionine γ-synthase MetB from Mycobacterium ulcerans
Clifton, Acta crystallographica. Section F, Structural biology and crystallization communications 2011 - “...full-length M. ulcerans cystathionine -synthase MetB (CGS) gene encoding 388 amino acids (NCBI YP_904423.1; UniProt A0PKT3; Pfam ID PF01053; EC 2.5.1.48) was amplified from M.ulcerans Agy99 genomic DNA using the oligonucleotide primers 5-GGGTCCTGGTTCGATGAAGGACGATCACAAGGCGC-3 (forward) and 5-CTTGTTCGTGCTGTTTATTAGCCCAGCGCCTGTTTGAGGTC-3 (reverse) (Integrated DNA Technologies Inc.). MetB was cloned into pAVA0421...”
E1BYF1 Cystathionine gamma-lyase from Gallus gallus
XP_422542 cystathionine gamma-lyase from Gallus gallus
49% identity, 90% coverage
- Characterization of the Effects of Low-Sodium Salt Substitution on Sensory Quality, Protein Oxidation, and Hydrolysis of Air-Dried Chicken Meat and Its Molecular Mechanisms Based on Tandem Mass Tagging-Labeled Quantitative Proteomics.
Li, Foods (Basel, Switzerland) 2024 - “...F1NU17 PGK2 Phosphoglycerate kinase C1L370 pvalb1 Parvalbumin P02604 Myosin light chain 1, skeletal muscle isoform E1BYF1 CTH Cystathionine gamma-lyase A6BLM8 TTN Titin isoform b11 (Fragment) A0A8V0XA66 AASS Aminoadipate-semialdehyde synthase F1NMM5 ABHD12B Abhydrolase domain containing 12B P79757 Connectin/titin (Fragment) A0A8V0YKB8 AKR1E2 Aldo-keto reductase family 1 member E2...”
- Embryonic protein undernutrition by albumen removal programs the hepatic amino acid and glucose metabolism during the perinatal period in an avian model
Willems, PloS one 2014 - “...3 Pl PCK2 Phosphoenolpyruvate carboxykinase P21642 7.56 71,1 59 1 2 Mt CTH Cystathionine gamma-lyase E1BYF1 6.85 43,9 51 1 3 Cp GLUT1 Solute carrier family 2, facilitated glucose transporter member 1 P46896 8.82 54,1 42 2 1 Cm SMAD3 Mothers against decapentaplegic homolog 3 P84023...”
- Endogenous CSE/Hydrogen Sulfide System Regulates the Effects of Glucocorticoids and Insulin on Muscle Protein Synthesis.
Wang, Oxidative medicine and cellular longevity 2019 - GeneRIF: The results from the present study suggest that the endogenous CSE/H2S system regulates fast-twitch glycolytic muscle degeneration and regeneration.
CTH / P32929 cystathionine γ-lyase monomer (EC 4.4.1.1; EC 4.4.1.2; EC 4.2.1.22) from Homo sapiens (see 7 papers)
CGL_HUMAN / P32929 Cystathionine gamma-lyase; CGL; CSE; Cysteine desulfhydrase; Cysteine-protein sulfhydrase; Gamma-cystathionase; Homocysteine desulfhydrase; EC 4.4.1.1; EC 4.4.1.2 from Homo sapiens (Human) (see 10 papers)
P32929 cystathionine gamma-lyase (EC 4.4.1.1) from Homo sapiens (see 9 papers)
NP_001893 cystathionine gamma-lyase isoform 1 from Homo sapiens
49% identity, 89% coverage
- function: Catalyzes the last step in the trans-sulfuration pathway from L-methionine to L-cysteine in a pyridoxal-5'-phosphate (PLP)-dependent manner, which consists on cleaving the L,L-cystathionine molecule into L-cysteine, ammonia and 2-oxobutanoate (PubMed:10212249, PubMed:18476726, PubMed:19261609, PubMed:19961860). Part of the L- cysteine derived from the trans-sulfuration pathway is utilized for biosynthesis of the ubiquitous antioxidant glutathione (PubMed:18476726). Besides its role in the conversion of L- cystathionine into L-cysteine, it utilizes L-cysteine and L- homocysteine as substrates (at much lower rates than L,L-cystathionine) to produce the endogenous gaseous signaling molecule hydrogen sulfide (H2S) (PubMed:10212249, PubMed:19019829, PubMed:19261609, PubMed:19961860). In vitro, it converts two L-cysteine molecules into lanthionine and H2S, also two L-homocysteine molecules to homolanthionine and H2S, which can be particularly relevant under conditions of severe hyperhomocysteinemia (which is a risk factor for cardiovascular disease, diabetes, and Alzheimer's disease) (PubMed:19261609). Lanthionine and homolanthionine are structural homologs of L,L-cystathionine that differ by the absence or presence of an extra methylene group, respectively (PubMed:19261609). Acts as a cysteine-protein sulfhydrase by mediating sulfhydration of target proteins: sulfhydration consists of converting -SH groups into -SSH on specific cysteine residues of target proteins such as GAPDH, PTPN1 and NF-kappa-B subunit RELA, thereby regulating their function (PubMed:22169477). By generating the gasotransmitter H2S, it participates in a number of physiological processes such as vasodilation, bone protection, and inflammation (Probable) (PubMed:29254196). Plays an essential role in myogenesis by contributing to the biogenesis of H2S in skeletal muscle tissue (By similarity). Can also accept homoserine as substrate (By similarity). Catalyzes the elimination of selenocystathionine (which can be derived from the diet) to yield selenocysteine, ammonia and 2-oxobutanoate (By similarity).
catalytic activity: L,L-cystathionine + H2O = 2-oxobutanoate + L-cysteine + NH4(+) (RHEA:14005)
catalytic activity: L-cysteine + H2O = hydrogen sulfide + pyruvate + NH4(+) + H(+) (RHEA:24931)
catalytic activity: L-homocysteine + H2O = 2-oxobutanoate + hydrogen sulfide + NH4(+) + H(+) (RHEA:14501)
catalytic activity: L-homoserine = 2-oxobutanoate + NH4(+) (RHEA:24923)
catalytic activity: L-selenocystathionine + H2O = L-selenocysteine + 2- oxobutanoate + NH4(+) (RHEA:31151)
cofactor: pyridoxal 5'-phosphate
subunit: Homotetramer (PubMed:19019829). Interacts with CALM in a calcium-dependent manner (By similarity). - Identifying CTH and MAP1LC3B as ferroptosis biomarkers for prognostic indication in gastric cancer decoding.
Qu, Scientific reports 2024 - GeneRIF: Identifying CTH and MAP1LC3B as ferroptosis biomarkers for prognostic indication in gastric cancer decoding.
- Cystathionine-γ-lyase contributes to tamoxifen resistance, and the compound I194496 alleviates this effect by inhibiting the PPARγ/ACSL1/STAT3 signalling pathway in oestrogen receptor-positive breast cancer.
Fu, Scientific reports 2024 - GeneRIF: Cystathionine-gamma-lyase contributes to tamoxifen resistance, and the compound I194496 alleviates this effect by inhibiting the PPARgamma/ACSL1/STAT3 signalling pathway in oestrogen receptor-positive breast cancer.
- Cystathionine gamma-lyase (CTH) inhibition attenuates glioblastoma formation.
Peleli, Redox biology 2023 - GeneRIF: Cystathionine gamma-lyase (CTH) inhibition attenuates glioblastoma formation.
- Disrupted Binding of Cystathionine γ-Lyase to p53 Promotes Endothelial Senescence.
Hu, Circulation research 2023 (PubMed)- GeneRIF: Disrupted Binding of Cystathionine gamma-Lyase to p53 Promotes Endothelial Senescence.
- Hypoxia increases persulfide and polysulfide formation by AMP kinase dependent cystathionine gamma lyase phosphorylation.
Alam, Redox biology 2023 - GeneRIF: Hypoxia increases persulfide and polysulfide formation by AMP kinase dependent cystathionine gamma lyase phosphorylation.
- [Exploration of cystathionine β-synthase and cystathionine γ-lyase gene expression poor prognostic predictive value with the application of bioinformatics data mining in liver cancer].
Liu, Zhonghua gan zang bing za zhi = Zhonghua ganzangbing zazhi = Chinese journal of hepatology 2023 (PubMed)- GeneRIF: [Exploration of cystathionine beta-synthase and cystathionine gamma-lyase gene expression poor prognostic predictive value with the application of bioinformatics data mining in liver cancer].
- Cystathionine γ-lyase mediates cell proliferation, migration, and invasion of nasopharyngeal carcinoma.
Zhang, Oncogene 2022 (PubMed)- GeneRIF: Cystathionine gamma-lyase mediates cell proliferation, migration, and invasion of nasopharyngeal carcinoma.
- KRAS G12D mutation eliminates reactive oxygen species through the Nrf2/CSE/H 2S axis and contributes to pancreatic cancer growth.
Fan, Acta biochimica et biophysica Sinica 2022 - GeneRIF: KRAS G12D mutation eliminates reactive oxygen species through the Nrf2/CSE/H 2S axis and contributes to pancreatic cancer growth.
- More
- Multiomic analysis in fibroblasts of patients with inborn errors of cobalamin metabolism reveals concordance with clinical and metabolic variability
Wiedemann, EBioMedicine 2024 - “...dehydrogenase kinase deficiency 614923 -/ Seizures (10.6%) Development delay (38.2%) Reduced branched-chain amino acid cblG P32929 CTH Cystathionine gamma-lyase 607657 7.52 0.045 Cystathioninuria 219500AR Development delay (38.2%) Cystathionuria cblG P11182 DBT Dihydrolipoamide branched-chain transacylase 248610 3.17 0.033 Maple syrup urine disease, type II 248600AR Development delay...”
- Analysis of the mechanism of curcumin against osteoarthritis using metabolomics and transcriptomics.
Deng, Naunyn-Schmiedeberg's archives of pharmacology 2024 - “...Aldehyde dehydrogenase family 3 member B1 3 AOC2 O75106 Retina-specific copper amine oxidase 4 CTH P32929 Cystathionine gamma-lyase 5 MAOA P21397 Amine oxidase [flavin-containing] A 6 PSAT1 Q9Y617 Phosphoserine aminotransferase 7 CDO1 Q16878 Cysteine dioxygenase type 1 8 DCXR Q7Z4W1 L-xylulose reductase 9 DGAT2 Q96PD7 Diacylglycerol...”
- Naphthyl-Substituted Indole and Pyrrole Carboxylic Acids as Effective Antibiotic Potentiators-Inhibitors of Bacterial Cystathionine γ-Lyase.
Kuzovlev, International journal of molecular sciences 2023 - “...amino acid sequences of the bCSE under study (UniProt ID: A0A2Y2FJW5) and hCSE (UniProt ID: P32929) is 42.1% ( Figure S1 ) [ 23 ]. Comparisons of the crystal structure between bCSE (PDB ID: 7md0) and hCSE (PDB ID: 3COG), as well as predictive models using...”
- “...database ( https://www.uniprot.org/ , (accessed on 17 May 2022)), whereas hCSE was identical to sequence P32929. 3.7. Other Methods and Funnel Metadynamics 3.7.1. Parameter Sets Three freely available modern force fields, Amber19sb, were used. All ligands was parameterized with acpype, where atom point charges were derived...”
- Interplay between Sulfur Assimilation and Biodesulfurization Activity in Rhodococcus qingshengii IGTS8: Insights into a Regulatory Role of the Reverse Transsulfuration Pathway
Martzoukou, mBio 2022 - “...cerevisiae cystathionine -lyase (UniProt accession no. P31373 ), and human cystathionine -lyase (UniProt accession no. P32929 ). All multiple-sequence alignments were done using ClustalO. Asterisks indicate fully conserved residues, colons denote strongly conserved residues, and dots show weakly conserved residues. Residues in yellow boxes participate in...”
- Fungal and host protein persulfidation are functionally correlated and modulate both virulence and antifungal response.
Sueiro-Olivares, PLoS biology 2021 - “...of the A . fumigatus Af293 proteome (taxid:330879) using the well-characterized human proteins (UniProtKB IDs P32929, P35520, and P25325) as queries. MecB and MecA are highly similar to their human counterparts (MecB 53% identity, 69% similarity; MecA 54% identity, 69% similarity) indicating a conserved activity, while...”
- Dynamic Changes of Urine Proteome in Rat Models Inoculated with Two Different Hepatoma Cell Lines.
Zhang, Journal of oncology 2021 - “...NP-4 2.80 B1AK53 Espin 2.77 Q96KP4 Cytosolic nonspecific dipeptidase 2.76 P0C0L4 Complement C4 2.69 Serum P32929 Cystathionine gamma-lyase 2.64 2.04 Melanoma P14174 Macrophage migration inhibitory factor 2.62 Serum Gastrointestinal tract (GIT) malignancy P21399 Cytoplasmic aconitate hydratase 2.57 Q86YJ6 Threonine synthase-like 2 2.50 P02511 Alpha-crystallin B chain...”
- CD40 is Positively Correlated with the Expression of Nucleophosmin in Cisplatin-Resistant Bladder Cancer
Luo, Journal of oncology 2020 - “...Erlin-2 CY24A_HUMAN P13498 CYBA Cytochrome b-245 light chain SLK_HUMAN Q9H2G2 SLK STE20-like serine/threonine-protein kinase CGL_HUMAN P32929 CTH Cystathionine gamma-lyase F5H6H0_HUMAN F5H6H0 HMGA2 High-mobility group protein HMGI-C SKI_HUMAN P12755 SKI Ski oncogene BI2L1_HUMAN Q9UHR4 BAIAP2L1 Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1 RHG19_HUMAN Q14CB8 ARHGAP19 Rho...”
- Natural Exogenous Antioxidant Defense against Changes in Human Skin Fibroblast Proteome Disturbed by UVA Radiation
Gęgotek, Oxidative medicine and cellular longevity 2020 - “...UV-oxidized proteins [ 58 ]. UVA radiation also induces the expression of cystathionine gamma-lyase (CTH, P32929), which catalyzes the biosynthesis of cysteine or thiocysteine. The increased activity of CTH is the response of cells to the increased demand for thiol groups under oxidative stress [ 59...”
- More
3cogD / P32929 Crystal structure of human cystathionase (cystathionine gamma lyase) in complex with dl-propargylglycine (see paper)
49% identity, 92% coverage
- Ligands: pyridoxal-5'-phosphate; (2s)-2-aminopent-4-enoic acid (3cogD)
MEGL_FUSNN / Q8RDT4 L-methionine gamma-lyase; MGL; Homocysteine desulfhydrase; L-cysteine desulfidase; EC 4.4.1.11; EC 4.4.1.2; EC 4.4.1.28 from Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355) (see paper)
Q8RDT4 methionine gamma-lyase (EC 4.4.1.11) from Fusobacterium nucleatum subsp. nucleatum (see paper)
FN1419 Methionine gamma-lyase from Fusobacterium nucleatum subsp. nucleatum ATCC 25586
50% identity, 95% coverage
- function: Catalyzes the alpha,gamma-elimination of L-methionine to produce methanethiol, 2-oxobutanoate and ammonia, and that of L- homocysteine (By similarity). Can also use L-cysteine as substrate, catalyzing its alpha,beta-elimination; this activity seems to only minimally contribute to the production of hydrogen sulfide (H2S) by F.nucleatum in the oral cavity, which is toxic for a large variety of cells in periodontal regions (PubMed:21798982).
catalytic activity: L-methionine + H2O = methanethiol + 2-oxobutanoate + NH4(+) (RHEA:23800)
catalytic activity: L-homocysteine + H2O = 2-oxobutanoate + hydrogen sulfide + NH4(+) + H(+) (RHEA:14501)
catalytic activity: L-cysteine + H2O = hydrogen sulfide + pyruvate + NH4(+) + H(+) (RHEA:24931)
cofactor: pyridoxal 5'-phosphate
subunit: Homotetramer. - Structural Basis of the Inhibition of L-Methionine γ-Lyase from Fusobacterium nucleatum
Bu, International journal of molecular sciences 2023 - “...and severity of colorectal cancer. Four genes ( FN0625 , FN1055 , FN1220 , and FN1419 ) of F. nucleatum are involved in producing hydrogen sulfide (H 2 S), which plays an essential role against oxidative stress. The molecular functions of Fn1419 are known, but their...”
- “...conformation of the PLP-binding site when compared with L-methionine -lyase (MGL) proteins. Inhibitor screening for Fn1419 with L-cysteine showed that two natural compounds, gallic acid and dihydromyricetin, selectively inhibit the H 2 S production of Fn1419. The chemicals of gallic acid, dihydromyricetin, and its analogs containing...”
- Genetic Determinants of Hydrogen Sulfide Biosynthesis in Fusobacterium nucleatum Are Required for Bacterial Fitness, Antibiotic Sensitivity, and Virulence
Chen, mBio 2022 - “...produce H 2 S and l -serine ( 16 ). The fourth enzyme encoded by FN1419 , annotated as l -methionine -lyase (MegL), is thought to catalyze the ,-elimination of l -cysteine to produce H 2 S, pyruvate, and ammonia ( 18 ). Based on enzymatic...”
- “...is estimated to account for the majority of H 2 S production (87.6%), with FN1055, FN1419, and FN0625 making up 10.3%, 1.94%, and 0.14% of the total H 2 S production, respectively ( 18 ). It remains unknown, however, whether one of these enzymes constitutes a...”
- The proteins of Fusobacterium spp. involved in hydrogen sulfide production from L-cysteine
Basic, BMC microbiology 2017 - “...production have been identified [ 14 18 ]. The highest molecular weight enzymes Fn0625 and Fn1419 (47 and 43kDa respectively) generate H 2 S with pyruvate and ammonia. Fn1220 (the cdl gene homologue) is the smallest (33kDa) but most frequently used enzyme in the formation of...”
- “...desulfhydrases previously reported for F. nucleatum ATCC 25586; 33kDa (Fn1220, cdl ), 37kDa (Fn1055), 43kDa (Fn1419) and 47kDa (Fn0625) [ 18 ]. It is therefore tempting to suggest that similar desulfhydrases are also involved in H 2 S-production in F. necrophorum and F. periodonticum . When...”
- Table grape consumption reduces adiposity and markers of hepatic lipogenesis and alters gut microbiota in butter fat-fed mice
Baldwin, The Journal of nutritional biochemistry 2016 - “...measured; i.e., two homologues of L-cysteine desulfhydrase (FN0625 and FN1220), Cystathionine- synthase (FN1055), and L-methionine--lyase (FN1419). Standard curves were constructed using cloned 16S rRNA and functional genes or amplified PCR product. 2.11. Sequencing of 16s rRNA gene using Illumina Mi-Seq platform To assess bacterial community structure...”
- “...L-cysteine desulfohydrases ( FN0625 and FN1220 ) cystathionine- synthase ( FN1055 ), and L-methionine--lyase ( FN1419 )). Although HF-feeding did not increase the abundance of any of these genes associated with sulfur metabolism in ileal or colonic mucosa compared to LF control mice (data not shown),...”
- Purification, crystallization and preliminary X-ray analysis of two hydrogen sulfide-producing enzymes from Fusobacterium nucleatum
Kezuka, Acta crystallographica. Section F, Structural biology and crystallization communications 2012 - “...Currently, four genes (fn0625, fn1055, fn1220 and fn1419) encoding pyridoxal50 -phosphate (PLP) dependent H2S-producing enzymes have been identified in F....”
- Identification of an L-methionine γ-lyase involved in the production of hydrogen sulfide from L-cysteine in Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Suwabe, Microbiology (Reading, England) 2011 (PubMed)- “...electrophoresis combined with MALDI-TOF MS. The enzyme, Fn1419, has previously been characterized as an L-methionine c-lyase. SDS-PAGE and gel-filtration...”
- “...production in F. nucleatum, the quaternary structure of Fn1419 was not completely disrupted by exposure to SDS. The purified recombinant enzyme exhibited a Km...”
BBPR_1343 cystathionine gamma-synthase from Bifidobacterium bifidum PRL2010
50% identity, 95% coverage
- Regulatory mechanism of cysteine-dependent methionine biosynthesis in Bifidobacterium longum: insights into sulfur metabolism in gut microbiota
Kim, Gut microbes 2024 - “...in the suggested metabolic pathway for the sulfur amino acid of B. bifidum PRL2010. Secondly, BBPR_1343 is homologous to BLD_0913 (cystathionine -synthase; 83.07% protein sequence identity) with bioconversion activity of cysteine to H 2 S ( Figures 3b,c ), suggesting that B. bifidum PRL2010 may also...”
- “...amino acid, despite the prediction that H 2 S is produced from cysteine degradation by BBPR_1343 and that O -acetyl/ O -succinyl homoserine with H 2 S is directly converted to homocysteine by BBPR_1213 and BBPR_1343 ( Figure 6 ). Therefore, the sulfur utilization pathway of...”
- Exploring Amino Acid Auxotrophy in Bifidobacterium bifidum PRL2010
Ferrario, Frontiers in microbiology 2015 - “...cysK BBPR_1344 cysK-fw CGAACCAGTACGACAACCCC cysK-rv GATGGAGCCTTCCGGATCGG 203 cysB BBPR_0960 cysB-fw GACGACCTCAAGCCGTTCCC cysB-rv GTCGCCGTTGTCGATGCCGG 189 metB BBPR_1343 metB-fw GGAGCCCGACCCGACCACCG metB-rv CAGCAGCACGTCAATCGCGG 214 metC BBPR_1226 metC-fw CATGGGTGTGGGAAGCGAGG metC-rv TCGATGTCCCAGTTGTGCCG 189 metE BBPR_0933 metE-fw GATGCTGGACACCGCGATCC metE-rv GGCGGATCTCGGTGCTCTCC 206 metA BBPR_1654 metA-fw GTTCGCTCTCGGCCATTGGG metA-rv CGGCGTGGTCTGATACACCC 205 rpoB a BBP-rpo-for GTGCAGACCGACAGCTTCGAC...”
- “...( Figure 3A ). In the same genomic region, we also identified the metB gene (BBPR_1343) predicted to encode a cystathionine--synthase, which is catalyzing the conversion of cysteine to cystathionine, as well as the luxS gene (BBPR_1341), encoding an S -ribosylhomocysteinase involved in the production of...”
LSEI_0600 Cystathionine beta-lyase/cystathionine gamma-synthase from Lactobacillus casei ATCC 334
47% identity, 99% coverage
O45391 cystathionine gamma-lyase from Caenorhabditis elegans
49% identity, 92% coverage
NP_495449 Putative cystathionine gamma-lyase 2 from Caenorhabditis elegans
P55216 Putative cystathionine gamma-lyase 2 from Caenorhabditis elegans
49% identity, 92% coverage
MEGL_FUSNP / Q8L0X4 L-methionine gamma-lyase; MGL; Homocysteine desulfhydrase; L-methionine-alpha-deamino-gamma-mercaptomethane-lyase; METase; EC 4.4.1.11; EC 4.4.1.2 from Fusobacterium nucleatum subsp. polymorphum (Fusobacterium polymorphum) (see paper)
51% identity, 95% coverage
- function: Catalyzes the alpha,gamma-elimination of L-methionine to produce methanethiol, 2-oxobutanoate and ammonia; methanethiol (methyl mercaptan) is considered to be one of the main causes of the oral malodor associated with periodontitis. Also displays homocysteine desulfhydrase activity, degrading homocysteine to produce hydrogen sulfide, 2-oxobutanoate and ammonia. L-cysteine and S-methyl-L-cysteine are poor substrates for the enzyme.
function: Plays an important role in the resistance of F.nucleatum to the antibacterial agent 3-chloro-DL-alanine (3CA), thanks to its 3CA chloride-lyase (deaminating) activity.
catalytic activity: L-methionine + H2O = methanethiol + 2-oxobutanoate + NH4(+) (RHEA:23800)
catalytic activity: L-homocysteine + H2O = 2-oxobutanoate + hydrogen sulfide + NH4(+) + H(+) (RHEA:14501)
cofactor: pyridoxal 5'-phosphate
subunit: Homotetramer.
A7Z3I1 Methionine biosynthesis PLP-dependent protein from Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
48% identity, 99% coverage
BLJ_1400 trans-sulfuration enzyme family protein from Bifidobacterium longum subsp. longum JDM301
46% identity, 91% coverage
- Adaptational changes in physiological and transcriptional responses of Bifidobacterium longum involved in acid stress resistance after successive batch cultures
Wei, Microbial cell factories 2019 - “...genes, 289 (82.6%) were downregulated, while 61 (17.4%) were upregulated (Fig. 3 ). Among them, BLJ_1400 (Log 2 FC=1.6) encoding cystathionine gamma-synthase (MetC 3 ) was upregulated in JDM301AR (Additional file 1 ). MetC 3 can catalyze the combination of cysteine with succinylhomoserine to produce cystathionine...”
- “...which suggested that the import of ammonium is enhanced to neutralize proton. Additionally, cystathionine gamma-synthase (BLJ_1400) was also upregulated in JDM301 (Log 2 FC=1.7) and JDM301AR (Log 2 FC=2.0) (Additional file 2 ), which suggested that the ability to produce NH 3 is promoted in both...”
5x5hA / Q79VD9 Crystal structure of metb from corynebacterium glutamicum (see paper)
48% identity, 97% coverage
- Ligands: pyridoxal-5'-phosphate; magnesium ion (5x5hA)
H7C6A2 cystathionine gamma-synthase (EC 2.5.1.48) from Corynebacterium glutamicum (see paper)
Q79VD9 Cystathionine beta-lyases/cystathionine gamma-synthases from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
cg2687 cystathionine gamma-synthase from Corynebacterium glutamicum ATCC 13032
48% identity, 97% coverage
- Interplay between Sulfur Assimilation and Biodesulfurization Activity in Rhodococcus qingshengii IGTS8: Insights into a Regulatory Role of the Reverse Transsulfuration Pathway
Martzoukou, mBio 2022 - “...with M. tuberculosis C-S/L (UniProt accession no. P9WGB7 ), C. glutamicum CS (UniProt accession no. Q79VD9 ), E. coli cystathionine -synthase (UniProt accession no. P00935 ), S. cerevisiae cystathionine -lyase (UniProt accession no. P31373 ), and human cystathionine -lyase (UniProt accession no. P32929 ). All multiple-sequence...”
- Functional genomics of pH homeostasis in Corynebacterium glutamicum revealed novel links between pH response, oxidative stress, iron homeostasis and methionine synthesis
Follmann, BMC genomics 2009 - “...subunit 0 1.90 n.d. 1.2 - -0.2 4.9 1.3 3.4 6.0 3.3 2.7 McbR* 58 cg2687 metB Cystathionine beta-lyases/cysta-thionine gamma-synthases 0 1.34 0.37 5.3 4.2 5.1 - - - - - -0.4 McbR* 59 cg2748 Hypothetical membrane protein 2 1.21 0.86 - - - -0.4 -...”
- Genome-wide analysis of the L-methionine biosynthetic pathway in Corynebacterium glutamicum by targeted gene deletion and homologous complementation
Rückert, Journal of biotechnology 2003 (PubMed)- “...cg1290 (metE), cg1702 (metH), cg2383 (metF), cg2536 (aecD), and cg2687 (metB)) were demonstrated to be part of the pathway while two others (cg0961 and cg3086)...”
- “...tree based on the multiple alignment of the protein sequences of cg2687 ( metB ), cg0755 ( metY ), and cg3086 as well as the known members of the PROSITE...”
CBL_MIMPU / A0A0M3VI47 Cystathionine beta-lyase, chloroplastic; Cysteine-S-conjugate beta-lyase; EC 4.4.1.13 from Mimosa pudica (Sensitive plant) (see paper)
A0A0M3VI47 cysteine-S-conjugate beta-lyase (EC 4.4.1.13) from Mimosa pudica (see paper)
46% identity, 78% coverage
- function: Catalyzes the degradation of cystathionine.
catalytic activity: L,L-cystathionine + H2O = L-homocysteine + pyruvate + NH4(+) (RHEA:13965)
catalytic activity: an S-substituted L-cysteine + H2O = a thiol + pyruvate + NH4(+) (RHEA:18121)
cofactor: pyridoxal 5'-phosphate
subunit: Forms homodimers. May form homotetramers from two homodimers.
J7TA22 methionine gamma-lyase (EC 4.4.1.11) from Clostridium sporogenes (see 2 papers)
48% identity, 94% coverage
5dx5A Crystal structure of methionine gamma-lyase from clostridium sporogenes (see paper)
48% identity, 94% coverage
- Ligand: pyridoxal-5'-phosphate (5dx5A)
CH_124009 cystathionine-gamma-lyase [Acremonium chrysogenum] from Magnaporthe grisea 70-15 (see 2 papers)
49% identity, 87% coverage
B2LXT6 cystathionine gamma-lyase (EC 4.4.1.1) from Aspergillus nidulans (see paper)
mecB cystathionine gamma-lyase; EC 4.4.1.1 from Emericella nidulans (see paper)
49% identity, 89% coverage
- CharProtDB Description: Cystathionine gamma-lyase, an enzyme involved in methionine, S-adenosylmethionine, and cysteine biosynthesis; Source:AspGD
An16g08720 uncharacterized protein from Aspergillus niger
49% identity, 91% coverage
- Enhancement of protein production in Aspergillus niger by engineering the antioxidant defense metabolism
Chen, Biotechnology for biofuels and bioproducts 2024 - “...GS5(Grx4) OEGSH1 P-WT An02g09720 G1(GSH1) OEGSH2 P-WT An09g03030 G2(GSH2) OEMetG P-WT An14g00930 G3(MetG) OEMecB P-WT An16g08720 G4(MecB) OEYap1 P-WT An11g07980 T1(Yap1) OEPrx P-WT An04g00120 T2(Prx) OEGpxA P-WT An02g08110 T3(GpxA) OESodC P-WT An07g03770 T4(SodC) OESod2 P-WT An04g04870 T5(Sod2) OESodB P-WT An01g12530 T6(SodB) OEHacA P-WT An01g00160 U1(HacA) OEPdiA...”
- “...synthesis pathway in our analysis, which encompasses GSH1 (An02g09720), GSH2 (An09g03030), MetG (An14g00930), and MecB (An16g08720). The systems regulated by Yap1 are dependent on NADPH for their activity, represented in the figure by NAD kinase (An03g05090). Consequently, we segmented this system into the following components: NADPH...”
XP_447072 hypothetical protein from Candida glabrata CBS 138
49% identity, 96% coverage
HI0086 cystathionine gamma-synthase (metB) from Haemophilus influenzae Rd KW20
46% identity, 99% coverage
- Genome-scale approaches to identify genes essential for Haemophilus influenzae pathogenesis
Wong, Frontiers in cellular and infection microbiology 2012 - “...a HI1432 trpA Tryptophan synthase subunit alpha a HI1290 tyrA Bifunctional chorismate mutase/prephenate dehydrogenase a HI0086 metB Cystathionine gamma-synthase a, d HI0122 metC Cystathionine beta-lyase a HI1702 metE 5-Methyltetrahydropteroyltriglutamate homocysteine methyltransferase a HI1263 metX Homoserine O -acetyltransferase a HI0465 serA D-3-phosphoglycerate dehydrogenase a HI1033 serB Phosphoserine...”
NTHI0100 cystathionine gamma-synthase from Haemophilus influenzae 86-028NP
46% identity, 99% coverage
lmo1680 similar to cystathionine gamma-synthase from Listeria monocytogenes EGD-e
47% identity, 95% coverage
- Listeria monocytogenes σA Is Sufficient to Survive Gallbladder Bile Exposure
Boonmee, Frontiers in microbiology 2019 - “...LMRG_01283 lmo2129 Hypothetical protein 2.03 0.00 LMRG_01286 lmo1681 metE LMRG_01286-LMRG_01288 5-methyltetrahydropteroyl-triglutamatehomocysteine methyltransferase 2.23 0.00 LMRG_01287 lmo1680 Cystathionine gamma-synthase 2.59 0.04 LMRG_01333 lmo1633 trpE trp Anthranilate synthase, aminase component 2.21 0.00 LMRG_01428 lmo1542 rplU LMRG_01428-LMRG_01430 50S ribosomal protein L21 3.22 0.00 LMRG_01435 lmo1535 LMRG_01435-LMRG_01436 YebC/PmpR family DNA-binding...”
CBL1 / P53780 cystathionine β-lyase monomer (EC 4.4.1.13) from Arabidopsis thaliana (see 3 papers)
METC_ARATH / P53780 Cystathionine beta-lyase, chloroplastic; CBL; Beta-cystathionase; Cysteine lyase; Cysteine-S-conjugate beta-lyase; EC 4.4.1.13 from Arabidopsis thaliana (Mouse-ear cress) (see 4 papers)
NP_191264 cystathionine beta-lyase from Arabidopsis thaliana
AT3G57050 CBL (cystathionine beta-lyase); cystathionine beta-lyase from Arabidopsis thaliana
44% identity, 77% coverage
- function: Catalyzes the penultimate step in the de novo biosynthesis of methionine (PubMed:11402193, PubMed:31002461, PubMed:8541513). Its role in methionine metabolism may affect plant development in different organs, probably by modifying plant auxin transport (PubMed:31002461). Its cysteine desulfhydrase activity may be involved in hydrogen sulfur production using L-cysteine as a substrate (PubMed:35472754).
catalytic activity: L,L-cystathionine + H2O = L-homocysteine + pyruvate + NH4(+) (RHEA:13965)
catalytic activity: an S-substituted L-cysteine + H2O = a thiol + pyruvate + NH4(+) (RHEA:18121)
cofactor: pyridoxal 5'-phosphate
subunit: Forms homodimers (PubMed:11402193). May form homotetramers from two homodimers (PubMed:11402193).
disruption phenotype: Decreased abundance of several PIN-FORMED (PIN) proteins, involved in plant auxin transport, and impaired auxin- responsive gene expression. - Clonostachys rosea demethiolase STR3 controls the conversion of methionine into methanethiol
Jia, Scientific reports 2016 - “...aCBL are indicated, STR3-C.r: C. rosea STR3(KT157524), STR3-S.c: S. cerevisiae STR3 (EDZ72299), CBL-A: Arabidopsis CBL (NP_191264). Figure 6 The Met-MTL conversion pathway proposed in the present study. The blue marks indicate proposed functions of STR3 in the present study. After Met addition, KMBA as a Met...”
- Metabolic strategies in hypoxic plants
van, Plant physiology 2024 - “...AT1G77120 NAD CHEBI: CHEBI:13389 NADH CHEBI: CHEBI:16908 CIPK15 Gramene: AT5G01810 CIPK15 Araport: AT5G01810 CBL Gramene: AT3G57050 CBL Araport: AT3G57050 References Antnio C , Ppke C , Rocha M , Diab H , Limami AM , Obata T , Fernie AR , Van Dongen JT . Regulation...”
- Changes in annual transcriptome dynamics of a clone of Japanese cedar (Cryptomeria japonica D. Don) planted under different climate conditions
Nose, PloS one 2023 - “...protein temp-60d -0.79 CUST_1399_PI429951308 reCj12805:MSWR:isotig12660 AT5G19550 0.0 ASP2 aspartate aminotransferase 2 temp-30d -0.78 CUST_6383_PI429951308 reCj20989:MSWR:isotig20841 AT3G57050 0.0 CBL cystathionine beta-lyase temp-0h -0.78 CUST_4351_PI429951308 reCj18944:-SWR:isotig18796 AT3G22960 0.0 PKP-ALPHA Pyruvate kinase family protein daylength -0.77 CUST_12927_PI429951308 reCj27637:---R:isotig27489 AT3G07630 4.7E-66 ADT2 arogenate dehydratase 2 temp-30d -0.65 CUST_4726_PI429951308 reCj19321:MSWR:isotig19173 AT3G55610...”
- Plant homocysteine, a methionine precursor and plant's hallmark of metabolic disorders
Sobieszczuk-Nowicka, Frontiers in plant science 2022 - “...squares. The CBL and SAHH genes from various plant species used here were as follows: AT3G57050 ( AtCBL ); Glyma.19G132000 ( GmCBL1 ); Glyma.03G129700 ( GmCBL2 ); Potri.016G038200 ( PtCBL ); PGSC0003DMG400029836 ( StCBL ); Solyc10g079720.1 ( SlCBL ); VIT_208s0007g05410 ( VvCBL ); Medtr1g064320 ( MtCBL...”
- Global Survey, Expressions and Association Analysis of CBLL Genes in Peanut
Ren, Frontiers in genetics 2022 - “...(2013) Cohen et al. (2014) Cohen et al. (2017) Whitcomb et al. (2018) AdCBLL6/AiCBLL5/AhCBLL5 AtCBL (AT3G57050) Associated with MET biosynthesis, crucial for embryo patterning and the maintenance of root stem cell niche Kim and Leustek, 2000 Levin et al. (2000) Liu et al. (2019) Cis -Acting...”
- Identification of Circular RNAs from the Parental Genes Involved in Multiple Aspects of Cellular Metabolism in Barley
Darbani, Frontiers in plant science 2016 - “...Unknown_circular RNA Ch7:4237959-4238849 Probable KH domain-containing splicing factor_circular RNA Ch7:457516955-457517152/MLOC_10055 AT3G32940 Cystathionine beta-lyase_circular RNA Ch7:53946083-53946582/MLOC_71910 AT3G57050 Sec-independent protein translocase_circular RNA Morex_contig_106453:2137-3175 ATMG00570 ATP-binding cassette Abc I3_circular RNA Morex_contig_1661226:956-1173/MLOC_24918 ATMG00900 Apocytochrome b_circular RNA Morex_contig_42365:12844-13477MLOC_58118 ATMG00220 NADH Dehydrogenase Nad 9_circular RNA Morex_contig_70567:2809-3204/MLOC_76215 ATMG00070 a See Supplementary File 1...”
- Identification of proteins enriched in rice egg or sperm cells by single-cell proteomics
Abiko, PloS one 2013 - “...SALK_081595 no 5 0 0 0 0 DEAD-like helicase, N-terminal domain containing protein AK119521 Os06g0175800 At3g57050 SALK_034725 no 5 0 0 0 0 Similar to Cystathionine beta-lyase, chloroplast precursor AK069281 Os09g0471100 At2g22420 SAIL_827_A08 no 5 0 0 0 0 Similar to Peroxidase 17 precursor Os01t0876900-00 Os01g0876900...”
- Aspartate-Derived Amino Acid Biosynthesis in Arabidopsis thaliana
Jander, The arabidopsis book 2009 - “...pyruvate ammonia Cystathionine -lyase At3g57050 = CBL L-homocysteine 5-methyltetra-hydropteroyltri-L-glutamate tetrahydropteroyltri-L-glutamate methionine...”
- “...extensively than cystathionine -synthase. A single gene, At3g57050, encodes cystathionine -lyase in A. thaliana (Ravanel et al., 1995). Analysis of recombinant...”
- Coordinations between gene modules control the operation of plant amino acid metabolic networks
Less, BMC systems biology 2009 - “...264855_at cystathionine synthase 11 CGS1 d AT3G01120 259279_at CGS AT1G33320 256531_at cystathionine lyase 12 CBL AT3G57050 251666_at methionine synthase 13 MS1 AT5G17920 259343_s_at MS2 AT3G03780 259343_s_at MS3 AT5G20980 246185_at homocysteine S-methyltransferase 14 HMT1 AT3G25900 258075_at HMT2 AT3G63250 251175_at HMT3 AT3G22740 258322_at S-adenosylmethionine synthetase 15 SAMS1 AT1G02500...”
- More
NP_850712 cystathionine beta-lyase from Arabidopsis thaliana
44% identity, 80% coverage
RB6443 cystathionine gamma-lyase homolog from Pirellula sp. 1
RB6443 trans-sulfuration enzyme family protein from Rhodopirellula baltica SH 1
45% identity, 95% coverage
LMRG_01287 cystathionine beta/gamma-lyase from Listeria monocytogenes 10403S
47% identity, 95% coverage
- Listeria monocytogenes σA Is Sufficient to Survive Gallbladder Bile Exposure
Boonmee, Frontiers in microbiology 2019 - “...0.00 LMRG_01283 lmo2129 Hypothetical protein 2.03 0.00 LMRG_01286 lmo1681 metE LMRG_01286-LMRG_01288 5-methyltetrahydropteroyl-triglutamatehomocysteine methyltransferase 2.23 0.00 LMRG_01287 lmo1680 Cystathionine gamma-synthase 2.59 0.04 LMRG_01333 lmo1633 trpE trp Anthranilate synthase, aminase component 2.21 0.00 LMRG_01428 lmo1542 rplU LMRG_01428-LMRG_01430 50S ribosomal protein L21 3.22 0.00 LMRG_01435 lmo1535 LMRG_01435-LMRG_01436 YebC/PmpR family...”
LOC109017889 cystathionine beta-lyase, chloroplastic-like from Juglans regia
45% identity, 73% coverage
SA0346 hypothetical protein from Staphylococcus aureus subsp. aureus N315
47% identity, 92% coverage
SAR0355 Cys/Met metabolism PLP-dependent enzyme from Staphylococcus aureus subsp. aureus MRSA252
47% identity, 92% coverage
- The Staphylococcus aureus response to unsaturated long chain free fatty acids: survival mechanisms and virulence implications
Kenny, PloS one 2009 - “...1.30E-03 SAR0242 putative galactitol PTS component 2.13 1.76E-02 SAR0263 putative PTS system protein 2.50 3.44E-02 SAR0355 Cys/Met metabolism PLP-dependent enzyme 2.04 2.74E-02 SAR0522 putative pyridoxal 5-phosphate biosynthesis protein 3.03 3.00E-04 SAR0523 SNO glutamine amidotransferase family protein 2.70 3.70E-04 SAR0752 putative phosphofructokinase 2.38 3.27E-02 SAR0753 fruA fructose-specific...”
- “...of genes involved in pyruvate utilisation, including ldh1 , SAR1088 ( pycA ), ald2 and SAR0355 converting pyruvate to lactate, oxaloacetate, alanine and cysteine, respectively. Reduced transcription of SAR2143 ( ilvC ) could further lower the expenditure of cellular pyruvate via amino acid synthesis, and down-regulation...”
1ibjA / P53780 Crystal structure of cystathionine beta-lyase from arabidopsis thaliana (see paper)
44% identity, 94% coverage
- Ligands: carbonate ion; pyridoxal-5'-phosphate (1ibjA)
Pc21g05430 uncharacterized protein from Penicillium rubens
47% identity, 94% coverage
- A Penicillium rubens platform strain for secondary metabolite production
Pohl, Scientific reports 2020 - “...to sulfate was observed and might cause a decrease in methionine. Moreover, the cystathionine gamma-lyase (Pc21g05430, log2 Fc 0.8) breaking down cystathionine into cysteine, -ketobutyrate and ammonia was downregulated. The lack of methionine might have been sensed by the cell as the L-methionine (R)-S-oxide reductase Pc20g05770...”
SAUSA300_0359 trans-sulfuration enzyme family protein from Staphylococcus aureus subsp. aureus USA300_FPR3757
NWMN_0350 trans-sulfuration enzyme family protein from Staphylococcus aureus subsp. aureus str. Newman
SACOL0430 trans-sulfuration enzyme family protein from Staphylococcus aureus subsp. aureus COL
47% identity, 92% coverage
- The ClpXP protease is dispensable for degradation of unfolded proteins in Staphylococcus aureus
Stahlhut, Scientific reports 2017 - “...hypothetical protein 4,0 1,1E-15 sbi IgG-binding protein SBI 3,9 3,6E-16 SAUSA300_0372 putative lipoprotein 3,9 6,9E-10 SAUSA300_0359 trans-sulfuration enzyme family protein 3,7 1,2E-07 SAUSA300_0797 ABC transporter permease protein 3,7 9,0E-15 SAUSA300_0846 Na+/H+antiporter family protein 3,7 1,5E-14 SAUSA300_0358 putative 5-methyltetrahydrofolatehomocysteine methyltransferase 3,6 6,0E-15 sak staphylokinase precursor 3,6 7,5E-22...”
- Cigarette Smoke Extract-Exposed Methicillin-Resistant Staphylococcus aureus Regulates Leukocyte Function for Pulmonary Persistence
Kulkarni, American journal of respiratory cell and molecular biology 2016 - “...SAUSA300_2561 SAUSA300_2080 SAUSA300_2014 SAUSA300_2534 SAUSA300_0359 SAUSA300_2384 SAUSA300_0850 SAUSA300_0708 SAUSA300_1568 SAUSA300_0201 SAUSA300_2611...”
- Nutrient limitation governs Staphylococcus aureus metabolism and niche adaptation in the human nose
Krismer, PLoS pathogens 2014 - “...6 ). The genes for cystathionine--synthase ( metI , SAUSA300_0360) and cystathionine--lyase ( metC , SAUSA300_0359), whose gene products are responsible for these enzymatic reactions, were 26- to 32-fold up-regulated and exhibited the strongest up-regulation of all genes in SNM3. Among the methionine-biosynthetic genes those for...”
- CodY in Staphylococcus aureus: a regulatory link between metabolism and virulence gene expression
Pohl, Journal of bacteriology 2009 - “...on April 16, 2019 by guest NWMN_0349 NWMN_0350 NWMN_0351 NWMN_0425 NWMN_0436 NWMN_0437 NWMN_0516 NWMN_0831 NWMN_0855 NWMN_0858 NWMN_0860 NWMN_0883 NWMN_1239...”
- In vitro and in vivo models of Staphylococcus aureus endophthalmitis implicate specific nutrients in ocular infection
Sadaka, PloS one 2014 - “...SACOL0428 metE 5-methyltetrahydropteroyltriglutamate/homocysteineS-methyltransferase 19.7 (1.2) 9.2 (1.6) SACOL0429 Bifunctional homocysteineS-methyltransferase/5,10-methylenetetrahydrofolate reductase 28.3 (1.2) 11.5 (1.4) SACOL0430 Trans-sulfuration enzyme family protein 36.1 (1.1) 12.8 (1.1) SACOL0431 Trans-sulfuration enzyme family protein 30.9 (1.1) 10.4 (1.1) SACOL0431 rev comp Reverse complement of interior105 nt region of SACOL0431 11.1 (1.4)...”
- Aureolib - a proteome signature library: towards an understanding of staphylococcus aureus pathophysiology
Fuchs, PloS one 2013 - “...five proteins including aconitase (AcnA), dihydroxy-acid dehydratase (IlvA), IMP cyclohydrolase (PurH), carbamoyl-phosphate synthase (CarB), and SACOL0430 was repressed in response to six stimuli. Interestingly, 133 proteins are represented by multiple spots on the gel indicating post translational modifications ( Fig. S3 ). In the present approach,...”
- “...These are AcnA spot 1, CarB, PurH spot 1 and spot 3, PurQ, PyrF and SACOL0430 spot 1 which are mainly involved in nucleotide biosynthesis. A pair wise comparison of all tested conditions revealed the most significant overlap of repressed marker proteins to heat shock (28...”
- Global analysis of the Staphylococcus aureus response to mupirocin
Reiss, Antimicrobial agents and chemotherapy 2012 - “...0.50 0.20 0.28 0.08 0.59 0.15 2.99 SACOL0430 SACOL0617 SACOL0944 SACOL0945 SACOL1108 SACOL1236 SACOL1386 SACOL1483 SACOL2136 SACOL2293 SACOL2335 SACOL2596...”
- A new oxidative sensing and regulation pathway mediated by the MgrA homologue SarZ in Staphylococcus aureus
Chen, Molecular microbiology 2009 - “...ABC transporter, DppClike protein SACOL0218 -2.0 + Conserved hypothetical protein SACOL0219 -2.5 Conserved hypothetical protein SACOL0430 -2.6 Cystathionine -lyase family protein SACOL0431 -2.3 Cystathionine -synthase family protein SACOL0505 -3.1 ABC transporter SACOL0507 -2.3 N-acetylmuramoyl-L-Ala amidase precursor SACOL0602 -2.3 Haloacid dehydrogenase-like protein SACOL0883 -2.7 ABC transporter SACOL0910...”
PD1812 cystathionine gamma-synthase from Xylella fastidiosa Temecula1
46% identity, 93% coverage
HSM_0277 cystathionine gamma-synthase from Haemophilus somnus 2336
45% identity, 99% coverage
FPSE_01836 hypothetical protein from Fusarium pseudograminearum CS3096
47% identity, 88% coverage
- Transcriptomic Profiling of Fusarium pseudograminearum in Response to Carbendazim, Pyraclostrobin, Tebuconazole, and Phenamacril
Zhang, Journal of fungi (Basel, Switzerland) 2023 - “...RIB3 ), FPSE_06011 (ZEB2-regulated ABC transporter 1, ZRA1 ), FPSE_09015 (glucosamine-6-phosphate isomerase 1, GNPDA1 ), FPSE_01836 (cystathionine gamma-lyase, CYS3 ), and FPSE_11895 (ABC multidrug transporter, MDR1 ). The bars represent the standard deviations (SD) of the mean. jof-09-00334-t001_Table 1 Table 1 The key DEGs that are...”
1n8pA / P31373 Crystal structure of cystathionine gamma-lyase from yeast (see paper)
48% identity, 95% coverage
- Ligand: pyridoxal-5'-phosphate (1n8pA)
CYS3 / P31373 Cys3 (EC 4.4.1.1) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (see 4 papers)
CYS3_YEAST / P31373 Cystathionine gamma-lyase; gamma-CTLase; Gamma-cystathionase; Sulfur transfer protein 1; EC 4.4.1.1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 6 papers)
P31373 cystathionine gamma-lyase (EC 4.4.1.1) from Saccharomyces cerevisiae (see paper)
YAL012W Cys3p from Saccharomyces cerevisiae
NP_009390 cystathionine gamma-lyase CYS3 from Saccharomyces cerevisiae S288C
48% identity, 95% coverage
- function: Catalyzes the production of cysteine from cystathionine in the reverse transsulfuration pathway for the biosynthesis of sulfur- containing amino acids cysteine and methionine. In this pathway, homocysteine sulfur is converted to cysteine sulfur (Probable). Also has cystathionine beta-lyase and cystathionine gamma-synthase activities in vitro. Cystathionine beta-lyase may be physiological, while cystathionine gamma-synthase activity is not, as the required substrate O-succinyl-L-homoserine(OSH) does not occur naturally in S.cerevisiae (PubMed:8335636).
catalytic activity: L,L-cystathionine + H2O = 2-oxobutanoate + L-cysteine + NH4(+) (RHEA:14005)
cofactor: pyridoxal 5'-phosphate
subunit: Homotetramer. - YALI0C22088g from Yarrowia lipolytica catalyses the conversion of l-methionine into volatile organic sulfur-containing compounds
Zhao, Microbial biotechnology 2021 - “...l Met into ketobutyrate, MTL and NH 4 + (Messerschmidt etal ., 2003 ). While YAL012W (cystathioninelyase, EC 4.4.1.1, as encoded by CYS3 ) exhibited no activity towards LMet, STR3 (cystathionine lyase, EC 4.4.1.8) from S. cerevisiae and its homologues in Clonostachys rosea isolated from Tuber...”
- “...cystathioninesynthase (EC 2.5.1.48) (Fig. 1A ). Cystathionine lyase catalyses the elimination of l Met, whereas YAL012W, which was named CYS3, exhibited no activity towards l Met; STR3 from C. rosea , which is located in the cystathioninelyase group, displayed negligible activity towards l Met, and this...”
- Systematic analysis of nuclear gene function in respiratory growth and expression of the mitochondrial genome in S. cerevisiae
Stenger, Microbial cell (Graz, Austria) 2020 - “...RPL1B YGL135W BUD25 YER014C-A HAP3 YBL021C SNF1 YDR477W CTR1 YPR124W HAP4 YKL109W SNF4 YGL115W CYS3 YAL012W HAP5 YOR358W SWI3 YJL176C DEF1 YKL054C LCB5 YLR260W TPD3 YAL016W DOC1 YGL240W MAC1 YMR021C VPS34 YLR240W FBP1 YLR377C RNR4 YGR180C GRR1 YJR090C RPB9 YGL070C Proteins of unknown function IRC19 YLL033W...”
- A disrupted transsulphuration pathway results in accumulation of redox metabolites and induction of gametocytogenesis in malaria
Beri, Scientific reports 2017 - “...organism possesses a complete TS pathway. The representative protein sequences of CBS (YGR155W) and CGL (YAL012W) of Saccharomyces cerevisiae were retrieved from FungiDB keeping the threshold of E value cutoff as 0.01. The presence of specific catalytic domains of these enzymes in other proteins was verified...”
- “...for the enzymes CBS and CGL. The representative protein sequences of CBS (YGR155W) and CGL (YAL012W) of Saccharomyces cerevisiae were retrieved from FungiDB. Using these sequences as a query, we looked for the presence of CBS and CGL in the representative protozoans keeping the threshold of...”
- Intracellular trafficking of the pyridoxal cofactor. Implications for health and metabolic disease
Whittaker, Archives of biochemistry and biophysics 2016 - “...KYNU 3.7.1.3 Bna5 YLR231C L-ornithine transaminase OAT 2.6.1.13 Car2 YLR438W Cystathionine -lyase CTH 4.4.1.1 Cys3 YAL012W Cystathionine -synthase CBS 4.2.1.22 Cys4 YGR155W Dihydrosphingosine phosphate lyase 4.1.2.27 Dpl1 YDR294C Glutamate decarboxylase GAD 4.1.1.15 Gad1 YMR250W Glycogen phosphorylase GP 2.4.1.1 Gph1 YPR160W Histidinol-phosphate aminotransferase 2.6.1.9 His5 YIL116W Cysteine-S-conjugate...”
- Untargeted metabolomics unravels functionalities of phosphorylation sites in Saccharomyces cerevisiae
Raguz, BMC systems biology 2016 - “...427, 429 p-deletion Crz1 OUT TF HOG pathway ch [ 38 , 61 ] Cys3 YAL012W 39, 40 p-deletion Cys3 OUT Enzyme metabolic enzyme dif [ 11 , 30 ] Gln3 YER040W 469, 471, 473 p-deletion Gln3 site 1 OUT TF TOR signaling dif [ 4...”
- RSC Chromatin-Remodeling Complex Is Important for Mitochondrial Function in Saccharomyces cerevisiae
Imamura, PloS one 2015 - “...6 ARGinine requiring YDR127W ARO1 AROmatic amino acid requiring YOR303W CPA1 Carbamyl Phosphate synthetase A YAL012W CYS3 CYStathionine gamma-lyase YEL046C GLY1 GLYcine requiring YDR158W HOM2 HOMoserine requiring YER052C HOM3 HOMoserine requiring YJR139C HOM6 HOMoserine requiring YHL011C PRS3 PhosphoRibosylpyrophosphate Synthetase YOR184W SER1 SERine requiring YGR208W SER2 SERine...”
- A comparative genomics study on the effect of individual amino acids on ribosome stalling
Sabi, BMC genomics 2015 - “...in the Methods). (D) An example of ribo-seq, mRNA-seq and RD/mRNA profiles obtained from gene YAL012W in S. cerevisiae . The profiles were generated based on all S. cerevisiae datasets (see the Methods section: Merging all datasets of the organism into one aggregate ). Positions along...”
- Dissecting a complex chemical stress: chemogenomic profiling of plant hydrolysates
Skerker, Molecular systems biology 2013 - “...Gene AA biosynthesis YDR127W ARO1 AA biosynthesis YGL148W ARO2 AA biosynthesis YPR060C ARO7 AA biosynthesis YAL012W CYS3 AA biosynthesis YJL101C GSH1 AA biosynthesis YDR158W HOM2 AA biosynthesis YER052C HOM3 AA biosynthesis YJR139C HOM6 AA biosynthesis YER086W ILV1 AA biosynthesis YCR053W THR4 AA biosynthesis YKL211C TRP3 AA...”
- More
- A role for glutamate-333 of Saccharomyces cerevisiae cystathionine γ-lyase as a determinant of specificity.
Hopwood, Biochimica et biophysica acta 2014 (PubMed)- GeneRIF: The glutamate residue at position 333 is a determinant of specificity in cystathione gamma lyase.
- Transcriptional regulation of Saccharomyces cerevisiae CYS3 encoding cystathionine gamma-lyase.
Hiraishi, Current genetics 2008 - GeneRIF: dual transcriptional regulation of CYS3 by factors that interact with the CDE1 motif and the CCG/CGC motif cis-elements
- Interplay between Sulfur Assimilation and Biodesulfurization Activity in Rhodococcus qingshengii IGTS8: Insights into a Regulatory Role of the Reverse Transsulfuration Pathway
Martzoukou, mBio 2022 - “...coli cystathionine -synthase (UniProt accession no. P00935 ), S. cerevisiae cystathionine -lyase (UniProt accession no. P31373 ), and human cystathionine -lyase (UniProt accession no. P32929 ). All multiple-sequence alignments were done using ClustalO. Asterisks indicate fully conserved residues, colons denote strongly conserved residues, and dots show...”
- Transcriptional analysis of L-methionine catabolism in the cheese-ripening yeast Yarrowia lipolytica in relation to volatile sulfur compound biosynthesis
Cholet, Applied and environmental microbiology 2008 - “...putative homocysteine Smethyltransferase MmuM Similar to sp P31373 S. cerevisiae YAL012w CYS3 cystathionine -lyase Similar to sp P32582 S. cerevisiae YGR155w...”
- Regulation of xylose metabolism in recombinant Saccharomyces cerevisiae
Salusjärvi, Microbial cell factories 2008 - “...-0.2 1.3 1.0 1.5 1.2 P06115 Ctt1p YGR088W catalase 1.4 1.8 3.4 2.4 2.0 0.6 P31373 Cys3p YAL012W cystathionine gamma-lyase -2.3 -0.6 -2.9 -3.1 -0.6 -2.4 P32582 Cys4p_a YGR155W cystathionine beta-synthase -2.5 -0.8 -0.2 -1.1 2.3 -0.3 P32582 Cys4p_b YGR155W cystathionine beta-synthase -0.9 -0.8 -1.7 -1.1...”
- The nucleotide sequence of chromosome I from Saccharomyces cerevisiae
Bussey, Proceedings of the National Academy of Sciences of the United States of America 1995 - “...pir PQ0207 pir S36718 pdb 1ABK sp P31385 sp P31373 gb X80874 Early sporulation sp P18410 Pro-tRNA HSP70 heat shock protein Elongation factor 1f, essential...”
Q4WCI1 cystathionine gamma-lyase (EC 4.4.1.1) from Aspergillus fumigatus (see paper)
AFUA_8G04340, XP_747241 cystathionine gamma-lyase from Aspergillus fumigatus Af293
48% identity, 91% coverage
- The sulfur-related metabolic status of <i>Aspergillus fumigatus</i> during infection reveals cytosolic serine hydroxymethyltransferase as a promising antifungal target
Alharthi, Virulence 2025 - “...C6 transcription factor (PrnA) Unknown AFUA_5G06060 SCF-complex subunit (SkpA) Suspected [ 32 , 33 ] AFUA_8G04340 cystathionine gamma-lyase (MecB) Proven [ 34 ] AFUA_7G06810 L-amino acid oxidase (LaoA) Suspected [ 35 ] AFUA_2G07620 Cystathionine beta-synthase (mecA) Suspected [ 34 ] Fungal sulfur related in vivo metabolism...”
- “...virulence in a murine model of infection [ 14 ]. We have also demonstrated that AFUA_8G04340 encodes cystathionine--lyase (MecB), the major persulfidating enzyme in A. fumigatus , which is relevant for fungal virulence [ 34 ]. The genes AFUA_2G07680, encoding L-ornithine- N 5 -monooxygenase (SidA), which...”
- Fungal and host protein persulfidation are functionally correlated and modulate both virulence and antifungal response
Sueiro-Olivares, PLoS biology 2021 - “...cannot be abrogated in Aspergillus fumigatus A . fumigatus orthologue proteins CTH ( mecB , AFUA_8G04340), CBS ( mecA , AFUA_2G07620), and MST ( mstA , AFUA_8G01800) were identified by BLASTp [ 17 ] of the A . fumigatus Af293 proteome (taxid:330879) using the well-characterized human...”
- Effects of amino acids on the lignocellulose degradation by Aspergillus fumigatus Z5: insights into performance, transcriptional, and proteomic profiles
Miao, Biotechnology for biofuels 2019 - “...cycle for energy production, during which the S -adenosylmethionine synthetase (AFUA_1G10630), adenosylhomocysteinase (AFUA_1G10130), cystathionine gamma-lyase (AFUA_8G04340), cystathionine beta-lyase MetG (AFUA_4G03950), cystathionine gamma-synthase (AFUA_7G01590), aspartate transaminase (AFUA_2G09650), and aspartate aminotransferase (AFUA_4G10410) were upregulated 1.11.7 times. Pyruvate decarboxylase PdcA (AFUA_3G11070), pyruvate decarboxylase (AFUA_6G00750), pyruvate dehydrogenase E1 component alpha...”
- The Aspergillus fumigatus SchA<sup>SCH9</sup> kinase modulates SakA<sup>HOG1</sup> MAP kinase activity and it is essential for virulence
Alves, Molecular microbiology 2016 - “...AFUB_057500 nitroreductase family protein NI 2.686 NI AFUA_4G09220 AFUB_066340 flavin-binding monooxygenase-like protein NI NI 1.128 AFUA_8G04340 AFUB_083200 Cystathionine gamma-lyase NI 1.160 NI AFUA_8G06080 AFUB_081400 Putative flavohemoprotein NI NI 1.633 AFUA_1 G09930 AFUB_009370 glycerol dehydrogenase; protein level decreases upon heat shock NI NI 1.040 Protein synthesis AFUA_5G05450...”
- Biochemical stability and molecular dynamic characterization of Aspergillus fumigatus cystathionine γ-lyase in response to various reaction effectors.
El-Sayed, Enzyme and microbial technology 2015 (PubMed)- GeneRIF: Eight buried Trp residues are reoriented to the enzyme surface and get exposed to the solvent under destabilizers. Electrostatic calculations of 3D structure under experimental conditions showed differences in polarity of the enzyme surface.
- RNA-seq reveals the pan-transcriptomic impact of attenuating the gliotoxin self-protection mechanism in Aspergillus fumigatus
O'Keeffe, BMC genomics 2014 - “...0.205 5.681 0.0005 AFUA_8G01570 - 1.158 0.561 3.979 0.003 AFUA_8G01780 - 1.171 0.639 2.758 0.036 AFUA_8G04340 - 0.308 0.910 1.530 0.001 AFUA_8G05220 - 0.048 0.996 2.941 0.0005 AFUA_8G06580 - 0.118 0.988 4.540 0.0005 AFUA_1G13440 - 0.520 0.792 1.692 0.010 AFUA_3G00680 - 4.122 0.005 1.910 0.0005 AFUA_3G14590...”
A0A1L7H888 methionine gamma-lyase (EC 4.4.1.11) from Clostridium tetani (see paper)
47% identity, 95% coverage
Q84AR1 methionine gamma-lyase (EC 4.4.1.11); alliin lyase (EC 4.4.1.4) from Citrobacter freundii (see 11 papers)
43% identity, 94% coverage
- Structural Basis of the Inhibition of L-Methionine γ-Lyase from Fusobacterium nucleatum
Bu, International journal of molecular sciences 2023 - “...of MGL enzymes from seven bacteria [ Pseudomonas putida (Uniprot accession no. P13254), Citrobacter freundii (Q84AR1), Clostridium sporogenes (A0A1J1CYV7), Bacillus cereus (Q818A3), Staphylococcus aureus (SAV0460), and P. aeruginosa (A0A2R3IX25)]. The PLP-binding residues are indicated by dotted boxes, and conserved residues for PLP binding are indicated by...”
SE2380 putative cystathionine beta-lyase from Staphylococcus epidermidis ATCC 12228
47% identity, 91% coverage
K3G22_02465 cystathionine gamma-synthase from Shewanella putrefaciens
44% identity, 98% coverage
BLD_0095 Cystathionine beta-lyases/cystathionine gamma-synthase from Bifidobacterium longum DJO10A
49% identity, 88% coverage
- Regulatory mechanism of cysteine-dependent methionine biosynthesis in <i>Bifidobacterium longum</i>: insights into sulfur metabolism in gut microbiota
Kim, Gut microbes 2024 - “...by cystathionine -lyase (BLD_1679). Additionally, cystathionine is converted to homocysteine by cystathionine--lyase ( metC , BLD_0095) and subsequently to methionine by methionine synthase ( metE , BLD_0538). However, a subsequent metabolic pathway study revealed that bifidobacteria are not autotrophic for cysteine and methionine but are instead...”
- “...was performed to investigate how the expression of related enzyme genes (BLD_1130, BLD_0674, BLD_0538, BLD_0913, BLD_0095, and BLD_0914) is influenced by the presence of sulfur-containing amino acids in DJO10A. Based on these findings, the biosynthetic pathways for cysteine and methionine were elucidated. This metabolic characterization of...”
6egrA / A0A0A5P8W7 Crystal structure of citrobacter freundii methionine gamma-lyase with v358y replacement (see paper)
43% identity, 95% coverage
- Ligand: pyridoxal-5'-phosphate (6egrA)
1e5eA / A2FEV4 Methionine gamma-lyase (mgl) from trichomonas vaginalis in complex with propargylglycine
45% identity, 95% coverage
- Ligand: n-(hydroxy{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)norvaline (1e5eA)
WP_038635138 methionine gamma-lyase from Citrobacter cronae
42% identity, 94% coverage
METC_STAHJ / Q4L332 Cystathionine beta-lyase MetC; CBL; Beta-cystathionase; Cysteine lyase; Cysteine-S-conjugate beta-lyase; EC 4.4.1.13 from Staphylococcus haemolyticus (strain JCSC1435) (see paper)
45% identity, 94% coverage
- function: Catalyzes the transformation of cystathionine into homocysteine (PubMed:19035565). Can also catalyze, at low levels, the conversion of cystathionine into methionine and the conversion of methionine into methanethiol (PubMed:19035565).
catalytic activity: L,L-cystathionine + H2O = L-homocysteine + pyruvate + NH4(+) (RHEA:13965)
catalytic activity: an S-substituted L-cysteine + H2O = a thiol + pyruvate + NH4(+) (RHEA:18121)
cofactor: pyridoxal 5'-phosphate
subunit: Homotetramer.
ETAE_3430 cystathionine beta-lyase/cystathionine gamma-synthase from Edwardsiella tarda EIB202
45% identity, 96% coverage
- Pyruvate Abundance Confounds Aminoglycoside Killing of Multidrug-Resistant Bacteria via Glutathione Metabolism
Xiang, Research (Washington, D.C.) 2024 - “...where the top 10 altered genes included cysk , uptG , metB , aspC , ETAE_3430 , and thrA , which are implicated in cysteine and methionine metabolism, as well as glycine, serine, and threonine metabolism. Additionally, aceE , which plays a role in the P...”
MOC_5078 cystathionine gamma-synthase from Methylobacterium oryzae CBMB20
46% identity, 95% coverage
O15565 methionine gamma-lyase (EC 4.4.1.11) from Trichomonas vaginalis (see paper)
mgl2 / CAA04125.1 methionine gamma-lyase from Trichomonas vaginalis (see paper)
46% identity, 94% coverage
O15564 methionine gamma-lyase (EC 4.4.1.11) from Trichomonas vaginalis (see paper)
mgl1 / CAA04124.1 methionine gamma-lyase from Trichomonas vaginalis (see paper)
45% identity, 94% coverage
Shew185_0536 O-succinylhomoserine (thiol)-lyase from Shewanella baltica OS185
43% identity, 98% coverage
- Adaptation of the Marine Bacterium Shewanella baltica to Low Temperature Stress
Kloska, International journal of molecular sciences 2020 - “...L-homocysteine (with accompanying succinate release). Genes encoding enzymes catalyzing these reactions, CysK (Shew185_2117) and MetB (Shew185_0536) were also upregulated in cold stressed S. baltica . It is interesting that the only downregulated genes in the sulfur metabolic pathway were those encoding the tetrathionate reductase ttrB (Shew185_3734),...”
WP_000726591 methionine gamma-lyase from Bacillus pacificus
44% identity, 97% coverage
6ld8A / Q5H1U9 Crystal structure of cystathionine gamma synthase from xanthomonas oryzae pv. Oryzae in complex with aminoacrylate and cysteine
45% identity, 96% coverage
- Ligands: 2-{[(e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid; cysteine (6ld8A)
SO1812 Methionine gamma-lyase (EC 4.4.1.11) from Shewanella oneidensis MR-1
SO1812 methionine gamma-lyase from Shewanella oneidensis MR-1
45% identity, 94% coverage
- mutant phenotype: Specifically important for utilizing L-Methionine. Automated validation from mutant phenotype: the predicted function (4.4.1.11) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
- Probing regulon of ArcA in Shewanella oneidensis MR-1 by integrated genomic analyses
Gao, BMC genomics 2008 - “...transcriptional activator so1807-9 (pspABC) -1.49 -0.85 L 102 + 3.13 GTTAATAAAATGTTT Phage shock protein A so1812 (mdeA) 3.10 3.46 H 84 + 2.45 GTTATTTAAAAGATA Methionine gamma-lyase so1821 -2.29 -3.22 R 230 + 3.05 GTTAATTTGATGTTA Outer membrane porin, putative so1822 3.35 4.99 R 133 + 2.41 GTTGATTAAAGGTTT...”
BAS4553 methionine gamma-lyase from Bacillus anthracis str. Sterne
44% identity, 97% coverage
- Rapid targeted gene disruption in Bacillus anthracis
Saldanha, BMC biotechnology 2013 - “...intron integration events. As a proof of principle, we have designed introns to insert at BAS4553 (a methionine gamma-lyase) and BAS4597 (a pullulanase). The regions within the intron that interact with DNA insertion sites were changed in order to direct the intron to insert between nucleotides...”
- “...genomic DNA schematic) were designed to flank the site of intron insertion in BAS4597 and BAS4553. kanamycin resistant colonies arising in Bacillus anthracis Sterne after transformation of plasmids reengineered to integrate the group II intron at BAS4597 and BAS4553 were screened by colony PCR and analyzed...”
MEGL_TREDE / Q73KL7 L-methionine gamma-lyase; MGL; Homocysteine desulfhydrase; L-methionine-alpha-deamino-gamma-mercaptomethane-lyase; METase; EC 4.4.1.11; EC 4.4.1.2 from Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104) (see paper)
Q73KL7 methionine gamma-lyase (EC 4.4.1.11) from Treponema denticola (see paper)
TDE2200 methionine gamma-lyase from Treponema denticola ATCC 35405
44% identity, 94% coverage
- function: Catalyzes the alpha,gamma-elimination of L-methionine to produce methanethiol, 2-oxobutanoate and ammonia; methanethiol (methyl mercaptan) is considered to be one of the main causes of the oral malodor associated with periodontitis and may also play a role in the pathogenicity of T.denticola. Also displays homocysteine desulfhydrase activity, degrading homocysteine to produce hydrogen sulfide, 2- oxobutanoate and ammonia.
catalytic activity: L-methionine + H2O = methanethiol + 2-oxobutanoate + NH4(+) (RHEA:23800)
catalytic activity: L-homocysteine + H2O = 2-oxobutanoate + hydrogen sulfide + NH4(+) + H(+) (RHEA:14501)
cofactor: pyridoxal 5'-phosphate
subunit: Homotetramer; dimer of active dimers. - Transcriptional responses of Treponema denticola to other oral bacterial species
Sarkar, PloS one 2014 - “...the expression pattern revealed that ORFs TDE0761/62 (dentilisin protease complex), TDE1072 (lipoprotein), TDE1978-80 (hypothetical genes), TDE2200 (methionine lyase) were repressed by all three species. In contrast, ORFs TDE1238 (preprotein translocase), TDE1272-74 (part of a larger ABC transporter gene operon spanning from TDE1271-75), TDE1482, TDE2054-56 (Hemin binding...”
- “...kinase/ribosomal protein S1 2.10 1.98 2.05 TDE2180 trmE tRNA modification GTPase TrmE 1.52 1.50 3.04 TDE2200 megL methionine gamma-lyase 2.78 2.24 1.86 TDE2465 hypothetical protein - 2.90 1.61 1.77 TDE2466 conserved hypothetical protein 1.53 3.30 1.58 1.85 TDE2467 conserved domain protein 1.67 2.59 1.87 1.91 TDE2601...”
PP_4594 cystathionine gamma-synthase, putative from Pseudomonas putida KT2440
43% identity, 95% coverage
Q96VU7 cystathionine gamma-lyase (EC 4.4.1.1) from Neurospora crassa (see paper)
NCU09230, XP_963807 cystathionine gamma-lyase from Neurospora crassa OR74A
46% identity, 90% coverage
- Aspects of the Neurospora crassa Sulfur Starvation Response Are Revealed by Transcriptional Profiling and DNA Affinity Purification Sequencing
Huberman, mSphere 2021 - “...and Data Set S1 in the supplemental material). However, only the cystathionine -lyase gene cys-16 (NCU09230), previously shown to be upregulated during sulfur starvation, is thought to be directly involved in the enzymatic pathway converting sulfate into cysteine and methionine ( 20 , 21 ) (...”
- “...not regulated by CYS-3 under the conditions we tested. These included cystathionine -synthase gene met-11 (NCU09230), myo-inositol-1-monophosphatase gene inl-3 (NCU09567), utr4 (NCU06228), and methylenetetrahydrofolate reductase gene met-13 (NCU09545) ( Fig.2 ; Data Set S2 ). Although we did not detect CYS-3-mediated regulation of these genes, the...”
- Glucose Starvation Alters Heat Shock Response, Leading to Death of Wild Type Cells and Survival of MAP Kinase Signaling Mutant
Plesofsky, PloS one 2016 - “...0.89 0.136 NCU08946 Phb1Prohib 1.28 1.60E-05 NCU05340 MetSynthase 0.90 0.015 NCU03310 Prohibitin 2 1.12 0.037 NCU09230 MetSynthase 0.89 1.80E-05 NCU05313 Fission 1 1.22 0.184 NCU07112 MetSynthase 0.45 6.47E-05 NCU02064 ApoO-Like 1.29 0.001 NCU06228 EnolPhosphE1 0.79 0.056 NCU04304 Porin 1.11 0.008 NCU08434 S-AdMetSyn 0.90 0.014 NCU00227 CationTransp...”
- “...MeTetrahyFo 0.83 0.000 NCU07263 CarnitineCarr 1.85 0.015 NCU02274 SerOHmetran 0.88 0.000 NCU10732 DicarboxTran 3.13 0.034 NCU09230 Cys -Lyase 1.20 0.020 NCU08561 SuccFumTran 1.35 0.025 NCU07112 SulfQuinOx 1.10 0.038 NCU01689 Yhm2 1.12 0.041 NCU04636 CysDesulf 0.89 0.056 NCU04945 Mia40 1.17 0.135 NCU02007 Isd11 0.84 0.169 NCU03359 Iap1AAA...”
- Analysis of the sulfur-regulated control of the cystathionine γ-lyase gene of Neurospora crassa
Reveal, BMC research notes 2012 - GeneRIF: Cystathionine gamma-lyase gene expression is controlled by the CYS3 transcriptional activator.
- “...crassa e-Compendium [ 23 ]. The gene has also since been given the locus designation NCU09230 in the Broad Institute Neurospora crassa database [ 24 ]. Northern analysis Poly(A) + mRNA was isolated by phenol extraction and subsequent oligo (dT)-cellulose chromatography as described previously [ 20...”
MEGL_PORGI / Q7MX71 L-methionine gamma-lyase; MGL; Homocysteine desulfhydrase; L-methionine-alpha-deamino-gamma-mercaptomethane-lyase; METase; EC 4.4.1.11; EC 4.4.1.2 from Porphyromonas gingivalis (strain ATCC BAA-308 / W83) (see paper)
Q7MX71 methionine gamma-lyase (EC 4.4.1.11) from Porphyromonas gingivalis (see paper)
PGN_1618 methionine gamma-lyase from Porphyromonas gingivalis ATCC 33277
44% identity, 93% coverage
- function: Catalyzes the alpha,gamma-elimination of L-methionine to produce methanethiol, 2-oxobutanoate and ammonia; methanethiol (methyl mercaptan) is considered to be one of the main causes of the oral malodor in periodontal disease and may also play a role in the pathogenicity of P.gingivalis in that disease (PubMed:11083813). Is also able to catalyze the alpha,gamma-elimination of L-homocysteine (By similarity).
catalytic activity: L-methionine + H2O = methanethiol + 2-oxobutanoate + NH4(+) (RHEA:23800)
catalytic activity: L-homocysteine + H2O = 2-oxobutanoate + hydrogen sulfide + NH4(+) + H(+) (RHEA:14501)
cofactor: pyridoxal 5'-phosphate
subunit: Homotetramer; dimer of active dimers.
disruption phenotype: Cells lacking this gene show a marked decrease in the formation of methyl mercaptan from L-methionine and decreased virulence compared with the wild-type strain W83. The hydrogen sulfide content in the culture supernatants of mutant and wild-type strains is similar. - Porphyromonas gingivalis genes conferring fitness in a tobacco-rich environment
Hutcherson, Molecular oral microbiology 2020 - “...mfa1, nadA , htrA , PGN_0862 [type III restriction enzyme], PGN_1116 [aminotransferase], PGN_1120 [NADPH-NAD transhydrogenase], PGN_1618 [ wbpB ], PGN_1722 [uridine kinase]. PGN_1777 [bleomycin hydrolase], and PGN_2017 [YjeF-family], as well as the hypothetical protein-encoding genes, PGN_1313 and PGN_1591). On the other hand, common CSE-, TIGK- and...”
- Using Tn-seq To Identify Pigmentation-Related Genes of Porphyromonas gingivalis: Characterization of the Role of a Putative Glycosyltransferase
Klein, Journal of bacteriology 2017 - “...PGN_1313 Hypothetical protein PGN_1591 Hypothetical protein PGN_1618 Methionine gamma-lyase 34 Downloaded from http://jb.asm.org/ on June 15, 2017 by...”
C3VMV9 methionine gamma-lyase (EC 4.4.1.11) from Porphyromonas gingivalis (see paper)
PG0343 methionine gamma-lyase from Porphyromonas gingivalis W83
44% identity, 95% coverage
- A Novel Regulation of K-antigen Capsule Synthesis in <i>Porphyromonas gingivalis</i> Is Driven by the Response Regulator PG0720-Directed Antisense RNA
Kim, Frontiers in oral health 2021 - “...domain-containing protein 0.65 Enzyme/metabolism PG0135 rsmA 16S rRNA [adenine(1518)-N(6)/adenine(1519)-N(6)]-dimethyltransferase RsmA 1.01 PG0143 Carbon-nitrogen hydrolase 0.87 PG0343 megL Methionine gamma-lyase 0.59 PG0445 pepT Peptidase T 0.75 PG0497 5'-methylthioadenosine/adenosylhomocysteine nucleosidase 0.82 PG0583 Cell division protein FtsA 0.59 PG0629 NAD kinase 0.81 PG1310 queC 7-cyano-7-deazaguanine synthase QueC 0.74 PG1435...”
- Porphyromonas gingivalis hydrogen sulfide enhances methyl mercaptan-induced pathogenicity in mouse abscess formation
Nakamura, Microbiology (Reading, England) 2018 (PubMed)- “...enzyme identified was identical to methionine g-lyase (PG0343), which produces methyl mercaptan (CH3SH) from L-methionine. Therefore, we analysed H2S and CH3SH...”
- “...Gene targeted PG0343UF-Apa ATGCGAGGGCCCCCACGGATTTCTATTGGGAAG PG0343 upstream PG0343UR-Sph CTACATGCATGCAATCGAAGAATCGACGACCG PG0343 upstream PG0343DF-Spe...”
- Protein Analysis of Sapienic Acid-Treated Porphyromonas gingivalis Suggests Differential Regulation of Multiple Metabolic Pathways
Fischer, Journal of bacteriology 2016 - “...in amino acid metabolism was methionine gamma-lyase (MegL; PG0343). MegL is a cofactor (e.g., vitamin B6)-binding enzyme (30) that is involved in cysteine,...”
- “...4 8 0.0395000* 0.0439900* 4 3 PG1545, PG0343, PG1755, PG2124, PG1764, PG2141, PGN_1023, PG0185, PG1190, PG1232, PG1417, PG2024, PG1803, PG1278, PG1297,...”
- Microarray analysis of the transcriptional responses of Porphyromonas gingivalis to polyphosphate
Moon, BMC microbiology 2014 - “...and amines PG1269 Delta-1-pyrroline-5-carboxylate dehydrogenase 2.02 PG0474 Low-specificity L-threonine aldolase 1.93 PG1401 Beta-eliminating lyase 1.74 PG0343 Methionine gamma-lyase 1.64 PG1559 Aminomethyltransferase 1.54 PG0324 Histidine ammonia-lyase 1.53 PG1305 Glycine dehydrogenase 1.52 PG2121 L-asparaginase 1.51 PG0025 Fumarylacetoacetate hydrolase family protein 2.11 Energy metabolism : Anaerobic/Fermentation PG0687 Succinate-semialdehyde dehydrogenase...”
- Metabolic network model of a human oral pathogen
Mazumdar, Journal of bacteriology 2009 - “...on April 16, 2019 by guest 4.4.1.11 EC no. PG0343 Protein ID NP_904655 GenBank accession no. 3.00E-175 E value BLAST result (top hit) Reference 100 7.00E-119...”
- Effects of various growth conditions in a chemostat on expression of virulence factors in Porphyromonas gingivalis
Masuda, Applied and environmental microbiology 2006 - “...PG2024 PG0449 PG0506 PG2024 PG1824 PG1804 PG1385 PG0027 PG0343 PG0776 PG1755 PG1077 PG0378 PG1545 PG0293 PG0618 Fold changec 0.15 0.09 1.75 0.90 1.02 0.69...”
Q5MQ31 methionine gamma-lyase (EC 4.4.1.11) from Brevibacterium linens (see paper)
41% identity, 88% coverage
D2S229 Cystathionine gamma-lyase from Haloterrigena turkmenica (strain ATCC 51198 / DSM 5511 / JCM 9101 / NCIMB 13204 / VKM B-1734 / 4k)
45% identity, 91% coverage
VpaChn25_2692 O-succinylhomoserine (thiol)-lyase from Vibrio parahaemolyticus
44% identity, 97% coverage
SENTW_4189 cystathionine gamma-synthase from Salmonella enterica subsp. enterica serovar Weltevreden str.
42% identity, 96% coverage
PITG_13402 cystathionine beta-lyase from Phytophthora infestans T30-4
42% identity, 70% coverage
NMB0802 cystathionine gamma-synthase from Neisseria meningitidis MC58
45% identity, 98% coverage
VIBHAR_00049 cystathionine gamma-synthase from Vibrio harveyi ATCC BAA-1116
44% identity, 97% coverage
Dda3937_03888 cystathionine gamma-synthase from Dickeya dadantii 3937
43% identity, 96% coverage
KPHS_00860 cystathionine beta-lyase from Klebsiella pneumoniae subsp. pneumoniae HS11286
42% identity, 96% coverage
- Use of a combined antibacterial synergy approach and the ANNOgesic tool to identify novel targets within the gene networks of multidrug-resistant Klebsiella pneumoniae
Lee, mSystems 2024 - “...RNA_thermometer_37 NC_016845.1 + KPHS_00820 81970 82028 RF01859 Phe_leader 3.1E05 23.6 1 37 RNA_thermometer_39 NC_016845.1 + KPHS_00860 90457 90536 RF01859 Phe_leader 5.6E06 27.6 1 80 RNA_thermometer_606 NC_016845.1 + KPHS_11580 1215650 1215709 RF01859 Phe_leader 4.8E06 27.3 1 60 RNA_thermometer_1537 NC_016845.1 + KPHS_30060 2996291 2996377 RF01859 Phe_leader 0.00021 20.7...”
- “...riboswitch_10 NC_016845.1 + KPHS_00290 35097 35170 RF00519 suhB 5.6E05 21 1 74 riboswitch_39 NC_016845.1 + KPHS_00860 90473 90552 RF00516 ylbH 3.7E05 21.1 1 80 riboswitch_1426 NC_016845.1 + KPHS_27170 2724825 2724923 RF00442 ykkC-yxkD 0.00049 16.4 1 99 riboswitch_1610 NC_016845.1 + KPHS_31920 3173316 3173390 RF00519 suhB 0.00017 19.1...”
W5S_RS00965 cystathionine gamma-synthase from Pectobacterium parmentieri CFIA1002
43% identity, 96% coverage
- Metabolic Modeling of Pectobacterium parmentieri SCC3193 Provides Insights into Metabolic Pathways of Plant Pathogenic Bacteria
Zoledowska, Microorganisms 2019 - “...but not in rhizosphere. Seven of them belong to the thiamine and sulfur metabolism pathway: W5S_RS00965 (cystathionine gamma-synthase, WP_014698476.1), W5S_RS01140 (thiazole synthase ThiG, WP_012822036.1), W5S_RS01145 (sulfur carrier protein ThiS, WP_014698484.1), W5S_RS01150 (adenylyltransferase ThiF, WP_014698485.1), W5S_RS01155 (thiamine phosphate synthase ThiE, WP_014698486.1), W5S_RS01160 (phosphomethylpyrimidine synthase ThiC, WP_014698487.1), W5S_RS05940...”
SL1344_4049 cystathionine gamma-synthase from Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344
STM4100 cystathionine gamma-synthase from Salmonella typhimurium LT2
41% identity, 96% coverage
- Role of sapA and yfgA in Susceptibility to Antibody-Mediated Complement-Dependent Killing and Virulence of Salmonella enterica Serovar Typhimurium
Ondari, Infection and immunity 2017 - “...2.724 9.59E54 Putative regulatory protein SL1344_3929 tatC 1,223 8,324 2.671 1.35E51 sec-independent protein translocase protein SL1344_4049 metB 1,768 10,496 2.504 4.40E02 Cystathionine gamma-synthase SL1344_0448 131 1,206 2.499 5.01E45 Hypothetical protein SL1344_1442 dcp 372 2,505 2.464 9.45E44 Dipeptidyl carboxypeptidase II SL1344_0443 clpX 509 3,227 2.450 3.23E43 ATP-dependent...”
- Genome expression analyses revealing the modulation of the Salmonella Rcs regulon by the attenuator IgaA
Mariscotti, Journal of bacteriology 2009 - “...55 STM2118 wza 5.1 0.7 0.7 5.1 0.2 23, 55 STM2407 STM2801 STM4100 STM4105 ypeC ygaC metB metF 2.2 3.0 2.4 2.5 0.7 1.5 0.2 0.5 0.6 2.3 0.5 0.2 0.02 0.4 0.4 0.4...”
megL / A0A0J6G7P5 methionine γ-lyase (EC 4.4.1.11) from Pseudomonas deceptionensis (see paper)
MEGL_PSEDM / A0A0J6G7P5 L-methionine gamma-lyase; MGL; EC 4.4.1.11 from Pseudomonas deceptionensis (see paper)
43% identity, 94% coverage
- function: Catalyzes the alpha,gamma-elimination of L-methionine to produce methanethiol, 2-oxobutanoate and ammonia.
catalytic activity: L-methionine + H2O = methanethiol + 2-oxobutanoate + NH4(+) (RHEA:23800)
cofactor: pyridoxal 5'-phosphate
subunit: Homotetramer; dimer of active dimers.
disruption phenotype: Mutant cannot make methanethiol (MeSH) or dimethylsulfide (DMS) from either minimal medium or medium supplemented with methionine. However, it can make DMS when exogenous MeSH is added.
JHW33_RS15930 cystathionine gamma-synthase from Rahnella aceris
43% identity, 98% coverage
- Comparative Genomics Assisted Functional Characterization of Rahnella aceris ZF458 as a Novel Plant Growth Promoting Rhizobacterium
Xu, Frontiers in microbiology 2022 - “...synthase A JHW33_RS22245 WP_013574434.1 WP_013574434.1 100 WP_013574434.1 100 WP_013574434.1 100 WP_015696317.1 99 metB cystathionine gamma-synthase JHW33_RS15930 WP_013577576.1 WP_013577576.1 100 WP_013577576.1 100 WP_013577576.1 100 WP_015699179.1 99 metC cystathionine beta-lyase JHW33_RS19835 WP_200224006.1 WP_119261241.1 99 WP_013573978.1 99 WP_013573978.1 99 WP_015695874.1 96 metE 5-methyltetrahydropteroyl- triglutamate-homocysteine S-methyltransferase JHW33_RS15280 WP_200223241.1 WP_119262170.1 99...”
mdeA / P13254 MdeA from Pseudomonas putida (see 6 papers)
MEGL_PSEPU / P13254 L-methionine gamma-lyase; MGL; Homocysteine desulfhydrase; L-methioninase; EC 4.4.1.11; EC 4.4.1.2 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 5 papers)
1pg8A / P13254 Crystal structure of l-methionine alpha-, gamma-lyase
BAA13642.1 L-methionine gamma-lyase from Pseudomonas putida (see paper)
44% identity, 93% coverage
- function: Catalyzes the alpha,gamma-elimination of L-methionine to produce methanethiol, 2-oxobutanoate and ammonia (PubMed:6742420, PubMed:8586629). Is involved in L-methionine catabolism (PubMed:9190812). In fact, shows a multicatalytic function since it also catalyzes gamma-replacement of L-methionine with thiol compounds, alpha,gamma-elimination and gamma-replacement reactions of L- homocysteine and its S-substituted derivatives, O-substituted-L- homoserines and DL-selenomethionine, and, to a lesser extent, alpha,beta-elimination and beta-replacement reactions of L-cysteine, S- methyl-L-cysteine, and O-acetyl-L-serine (PubMed:22785484, PubMed:6742420). Also catalyzes deamination and gamma-addition reactions of L-vinylglycine (PubMed:6742420). Thus, the enzyme is able to cleave C-S, C-Se, and C-O bonds of sulfur, selenium, and oxygen amino acids, respectively (PubMed:22785484, PubMed:6742420).
catalytic activity: L-methionine + H2O = methanethiol + 2-oxobutanoate + NH4(+) (RHEA:23800)
catalytic activity: L-homocysteine + H2O = 2-oxobutanoate + hydrogen sulfide + NH4(+) + H(+) (RHEA:14501)
cofactor: pyridoxal 5'-phosphate
subunit: Homotetramer; dimer of active dimers. - Ligand: pyridoxal-5'-phosphate (1pg8A)
- Aspergillus flavipes L-methionine γ-lyase-β-cyclodextrin conjugates with improved stability, catalytic efficiency and anticancer activity
El-Sayed, Scientific reports 2024 - “...MGL with a 1.8 resolution (PDB ID: 3vk3) and 398 amino acid sequence (UniProtKB ID: P13254) ( https://www.uniprot.org/uniprotkb/P13254/entry ). The MGL of A. flavipes was conjugated by hostguest chemistry to -cyclodextrin. Energy minimization was conducted using open-source molecular builder, visualization tool ( http://avogadro.cc/ ), ligand preparation...”
- Structural Basis of the Inhibition of L-Methionine γ-Lyase from Fusobacterium nucleatum
Bu, International journal of molecular sciences 2023 - “...Partial sequence alignment of MGL enzymes from seven bacteria [ Pseudomonas putida (Uniprot accession no. P13254), Citrobacter freundii (Q84AR1), Clostridium sporogenes (A0A1J1CYV7), Bacillus cereus (Q818A3), Staphylococcus aureus (SAV0460), and P. aeruginosa (A0A2R3IX25)]. The PLP-binding residues are indicated by dotted boxes, and conserved residues for PLP binding...”
- Collective production of hydrogen sulfide gas enables budding yeast lacking MET17 to overcome their metabolic defect
Sonal,, PLoS biology 2023 - “...Fig S in S1 Figs , the MdeA protein sequence from Pseudomonas putida (UniProt ID P13254) was blasted against the S . cerevisiae genome, and graphics were generated using UniProt [ 63 ]. For Fig T in S1 Figs , protein sequences of Hsu1, Met17, and...”
- Predicting functional family of novel enzymes irrespective of sequence similarity: a statistical learning approach.
Han, Nucleic acids research 2004 - “...3.5 Prolinedipeptidase (O58885) EC 3.4 3.00E15 E1->F1;E2->F2 + Cystathionine gamma-synthase (P38675) EC 2.5 Methionine gamma-lyase (P13254) EC 4.4 2.00E15 E1->W;E2->F2 Exocellobiohydrolase 1 (P38676) EC 3.2 Cystathionine gamma-lyase (Q8VCN5) EC 4.4 1.00E12 E1->W;E2->F2 Maleylacetoacetate isomerase (P57109) EC 5.2 Glutathione S -transferase zeta class (P57108) EC 2.5 1.00E51...”
- SVM-Prot: Web-based support vector machine software for functional classification of a protein from its primary sequence.
Cai, Nucleic acids research 2003
MetB / b3939 O-succinylhomoserine(thiol)-lyase / O-succinylhomoserine lyase (EC 2.5.1.48) from Escherichia coli K-12 substr. MG1655 (see 3 papers)
metB / P00935 O-succinylhomoserine(thiol)-lyase / O-succinylhomoserine lyase (EC 2.5.1.48) from Escherichia coli (strain K12) (see 11 papers)
METB_ECOLI / P00935 Cystathionine gamma-synthase; CGS; O-succinylhomoserine (thiol)-lyase; EC 2.5.1.48 from Escherichia coli (strain K12) (see 2 papers)
NP_418374 O-succinylhomoserine(thiol)-lyase/O- succinylhomoserine lyase from Escherichia coli str. K-12 substr. MG1655
b3939 cystathionine gamma-synthase from Escherichia coli str. K-12 substr. MG1655
41% identity, 96% coverage
- function: Catalyzes the formation of L-cystathionine from O-succinyl-L- homoserine (OSHS) and L-cysteine, via a gamma-replacement reaction. In the absence of thiol, catalyzes gamma-elimination to form 2- oxobutanoate, succinate and ammonia.
catalytic activity: O-succinyl-L-homoserine + L-cysteine = L,L-cystathionine + succinate + H(+) (RHEA:20397)
cofactor: pyridoxal 5'-phosphate (Binds 1 pyridoxal phosphate per subunit.)
subunit: Homotetramer. - Exploration of the active site of Escherichia coli cystathionine γ-synthase.
Jaworski, Protein science : a publication of the Protein Society 2012 - GeneRIF: Studied Escherichia coli cystathionine gamma-synthase. Results suggest that the arginine residues at positions 48, 106 and 361 of eCGS, conserved in bacterial CGS sequences, tether the distal and alpha-carboxylate moieties, respectively, of the L-OSHS substrate.
- Appendix. Purification, molecular weight, and NH2-terminal sequence of cystathionine gamma-synthase of Escherichia coli.
Tran, The Journal of biological chemistry 1983 (PubMed)- GeneRIF: N-terminus verified by Edman degradation on mature peptide
- Interplay between Sulfur Assimilation and Biodesulfurization Activity in Rhodococcus qingshengii IGTS8: Insights into a Regulatory Role of the Reverse Transsulfuration Pathway
Martzoukou, mBio 2022 - “...C. glutamicum CS (UniProt accession no. Q79VD9 ), E. coli cystathionine -synthase (UniProt accession no. P00935 ), S. cerevisiae cystathionine -lyase (UniProt accession no. P31373 ), and human cystathionine -lyase (UniProt accession no. P32929 ). All multiple-sequence alignments were done using ClustalO. Asterisks indicate fully conserved...”
- Knowns and Unknowns of Vitamin B6 Metabolism in Escherichia coli
Tramonti, EcoSal Plus 2021 (secret) - Divergence of function in sequence-related groups of Escherichia coli proteins
Nahum, Genome research 2001 - “...pyruvate oxidase 572 metB metC b3939 b3008 P00935 P06721 O-succinylhomoserine(thiol)-lyase cystathionine-beta-lyase 386 395 hisA hisF b2024 b2025 P10371 P10373...”
- Molecular and functional analyses of the metC gene of Lactococcus lactis, encoding cystathionine beta-lyase
Fernández, Applied and environmental microbiology 2000 - “...cystathionine -lyase [CGL-BSUB]), Z99110 (B. subtilis CBL), P00935 (E. coli [ECOL] cystathionine -synthase), P06721 (E. coli CBL), and P44527 (Haemophilus...”
- Complete Genome Sequence of ER2796, a DNA Methyltransferase-Deficient Strain of Escherichia coli K-12
Anton, PloS one 2015 - “...+1 frameshift rph (b3643) 3787535 (C) between 38139023813903 ER2796_3754 metB1 (Fs) metB1 2 frameshift metB (b3939) between 41004684100469 41268364126837 (CG) 48386; ER2796_4061 (8 aa + aa 48386) (fimB-opgB)114 :: IS10 (RM ) f (mcr-hsd-mrr)114 :: IS10 deletion of 60,679 bp + insertion of 2 IS10 elements...”
- More than just a metabolic regulator--elucidation and validation of new targets of PdhR in Escherichia coli
Göhler, BMC systems biology 2011 - “...prpC 0.729 0.021 b2683 ygaH -0.077 3.628 b0331 prpB 0.713 0.024 b0436 tig -0.260 3.620 b3939 metB 0.677 2.667 b4290 fecB * 0.315 3.561 b3547 yhjX 0.668 2.931 b0083 ftsL $ 0.119 3.536 b3426 glpD 0.659 0.904 Top-ranking genes with putative phylogenetically conserved binding sites of...”
- Genome-scale analysis to the impact of gene deletion on the metabolism of E. coli: constraint-based simulation approach
Xu, BMC bioinformatics 2009 - “...b0185 b0522, b0523 b2687 b0386 b2585 b1092 b0945, b1062 b2942 b2818 b3018 b1094 b1131, b1281 b3939 b3172 b4041 b2316 b2312, b2476 b4013 b3957 b4160 b2323 b2499, b2507 s0001 b3958 b3255 b2557, b2780 b3959 b3256 b3642, b4005 b3960 b4006, b4177 s0001 b4244, b4245 SS NSP CAC GSM...”
- Experimental and computational assessment of conditionally essential genes in Escherichia coli
Joyce, Journal of bacteriology 2006 - “...leuC (b0072) leuD (b0071) lysA (b2838) metA (b4013) metB (b3939) metC (b3008) metF (b3941) metL (b3940) pabA (b3360) pabB (b1812) pheA (b2599) proA (b0243) proB...”
- luxS-dependent gene regulation in Escherichia coli K-12 revealed by genomic expression profiling
Wang, Journal of bacteriology 2005 - “...b1127 b1019 b1550 b4196 b0630 b1022 b1437 b4186 b2406 b3939 b3945 b0648 b1680 b0823 b1112 b4288 b4310 b3103 b0621 b1407 b0076 b2723 b3683 b3028 b2968 b0579...”
- Sulfur and nitrogen limitation in Escherichia coli K-12: specific homeostatic responses
Gyaneshwar, Journal of bacteriology 2005 - “...genes included metK (b2942), metC (b3008), metR (b3828), metBL (b3939 and b3940), and metA (b4013), and only the metA gene was detected in the taurine-sulfate...”
- Identification and mapping of self-assembling protein domains encoded by the Escherichia coli K-12 genome by use of lambda repressor fusions
Mariño-Ramírez, Journal of bacteriology 2004 - “...b0889 b1517 b1512 b2463 b1620 b4037 b4346 b4119 b3929 b3939 b0349 b0783 b4351 b0091 b2733 b2286 b1393 b1396 b0134 b3019 b2564 b4100 b1020 b3724 b0951 b4201...”
- Divergence of function in sequence-related groups of Escherichia coli proteins
Nahum, Genome research 2001 - “...b0871 P07003 pyruvate oxidase 572 metB metC b3939 b3008 P00935 P06721 O-succinylhomoserine(thiol)-lyase cystathionine-beta-lyase 386 395 hisA hisF b2024 b2025...”
- More
1cs1D / P00935 Cystathionine gamma-synthase (cgs) from escherichia coli (see paper)
41% identity, 97% coverage
- Ligand: 2,4-dioxo-pentanedioic acid (1cs1D)
WP_064302440 methionine gamma-lyase from Pseudomonas putida
45% identity, 94% coverage
Ssal_01840 cystathionine gamma-synthase from Streptococcus salivarius 57.I
42% identity, 99% coverage
Q86D28 methionine gamma-lyase (EC 4.4.1.11) from Entamoeba histolytica (see 3 papers)
metg / BAC75877.2 methionine gamma-lyase from Entamoeba histolytica (see paper)
42% identity, 91% coverage
EHI_144610 methionine gamma-lyase from Entamoeba histolytica HM-1:IMSS
42% identity, 91% coverage
- Screening and Structural Characterization of Heat Shock Response Elements (HSEs) in <i>Entamoeba histolytica</i> Promoters
Dorantes-Palma, International journal of molecular sciences 2024 - “...tRNA methyltransferase activity; Adenosine Deaminase (EHI_005040) with adenosine deaminase activity; and others like Methionine Gamma-Lyase (EHI_144610), Scavenger mRNA Decapping Enzyme (EHI_192480), and 2-Deoxy-D-Ribose 5-Phosphate Aldolase (EHI_121800), all involved in various metabolic processes in E. histolytica . The predominant HSEs in this category are also Ehpgp5, Ehhsp100,...”
- “...genes. Within this category, genes like Acetyltransferase (EHI_096770), involved in O-acyltransferase activity, and Methionine Gamma-Lyase (EHI_144610), with functions in binding to heterocyclic or cyclic organic compounds and lyase activity, are found. Similar to the first category, Ehpgp5 is the most frequently observed HSE in these genes...”
- Overexpression of Differentially Expressed Genes Identified in Non-pathogenic and Pathogenic Entamoeba histolytica Clones Allow Identification of New Pathogenicity Factors Involved in Amoebic Liver Abscess Formation
Meyer, PLoS pathogens 2016 (no snippet) - Gene expression profiling in Entamoeba histolytica identifies key components in iron uptake and metabolism
Hernández-Cuevas, PloS one 2014 - “...2.0 2.1 NM Methionine gamma lyase EHI_057550 XM_001913898 NM 2.6 NM Methionine gamma lyase MGL1 EHI_144610 XM_647004 NM 2.1 NM Phosphoglycerate dehydrogenase PSAT EHI_026360 XM_650291 2.0 2.2 NM For definition of columns please refer to footnote of Table 2 . An iron-containing superoxide dismutase transcript was...”
- “...downregulated, since transcripts of genes coding for D-3-phosphoglycerate dehydrogenase (PGDH, EHI_060860), methionine -lyase 1 (MGL1, EHI_144610), and phosphoserine aminotransferase (PSAT, EHI_026360) were downregulated in iron deficiency. The PGDH and PSAT transcripts were still downregulated after Hb supplementation. Stress responses, DNA repair and RNA synthesis A number...”
- Global analysis of gene expression in response to L-Cysteine deprivation in the anaerobic protozoan parasite Entamoeba histolytica
Husain, BMC genomics 2011 - “...containing amino acid metabolism. Gene IDs: CS1, EHI_171750; CS2, EHI_160930; CS3, EHI_060340; MAT, 70.m00173; MGL1, EHI_144610; MGL2, EHI_142250; NifS; EHI_136380; PGDH, EHI_060860; PSAT, EHI_026360; SAHH, EHI_068250; SAT2, EHI_021570; SAT3, EHI_153430. We have recently shown by metabolomic analysis that the synthesis of OAS and SMC markedly increased...”
T1E_0568 methionine gamma-lyase from Pseudomonas putida DOT-T1E
44% identity, 93% coverage
AB823649.2 / U6BYK3 mimosinase (EC 4.3.3.8) from Mimosa pudica (see 5 papers)
MIMOS_MIMPU / U6BYK3 Mimosinase, chloroplastic; Cystathionine beta-lyase; Cysteine-S-conjugate beta-lyase; EC 4.3.3.8; EC 4.4.1.13 from Mimosa pudica (Sensitive plant) (see paper)
U6BYK3 mimosinase (EC 3.5.1.61) from Mimosa pudica (see paper)
40% identity, 81% coverage
- function: Catalyzes the degradation of mimosine, which is a toxic secondary metabolite found in all Mimosa and Leucaena species (PubMed:31368041). Catalyzes the degradation of cystathionine, but seems to have lower preference toward cystathionine over mimosine (PubMed:31368041).
catalytic activity: L-mimosine + H2O = 3-hydroxy-4H-pyrid-4-one + pyruvate + NH4(+) (RHEA:75355)
catalytic activity: L,L-cystathionine + H2O = L-homocysteine + pyruvate + NH4(+) (RHEA:13965)
catalytic activity: an S-substituted L-cysteine + H2O = a thiol + pyruvate + NH4(+) (RHEA:18121)
cofactor: pyridoxal 5'-phosphate
subunit: Forms homodimers. May form homotetramers from two homodimers.
PP1308 methionine gamma-lyase from Pseudomonas putida KT2440
44% identity, 93% coverage
Pro0405 Cystathionine beta-lyase/cystathionine gamma-synthase from Prochlorococcus marinus str. SS120
43% identity, 97% coverage
HZ99_RS06735 methionine gamma-lyase from Pseudomonas fluorescens
44% identity, 91% coverage
CPH89_RS22860 methionine gamma-lyase from Pseudomonas fluorescens
43% identity, 91% coverage
3aejA / Q86D28 Reaction intermediate structure of entamoeba histolytica methionine gamma-lyase 1 tetramer containing michaelis complex and methionine- pyridoxal-5'-phosphate
42% identity, 91% coverage
- Ligand: n-[(3-hydroxy-2-methyl-5-{[(trihydroxyphosphoranyl)oxy]methyl}pyridin-4-yl)methylene]methionine (3aejA)
SSUSC84_1406 putative cystathionine beta-lyase from Streptococcus suis SC84
SSU1376 cystathionine beta-lyase from Streptococcus suis P1/7
43% identity, 98% coverage
- Comparative transcriptomic analysis reveal genes involved in the pathogenicity increase of Streptococcus suis epidemic strains
Wang, Virulence 2022 - “...NO. of UDC Subgroup of COGs 2h SSUSC84_1405 SSU1375 MUN40_07820 Cystathionine - lyase UDC14 E SSUSC84_1406 SSU1376 MUN40_07825 Cystathionine -synthase E SSUSC84_1600 SSU1574 MUN40_02800 Methionine ABC transporter permease UDC15 E SSUSC84_1601 SSU1575 MUN40_02795 Methionine ABC transporter ATP-binding proteinATPase component E SSUSC84_1602 SSU1576 MUN40_02790 Peptidase E SSUSC84_1603...”
- “...the remaining 25 DEGs belonged to core genes of three genomes. The homologous genes of SSUSC84_1406 , SSUSC84_1605 , and SSUSC84_1606 were also upregulated in both P1/7 and 891591 2h post-interaction groups. The upregulation of the homologous genes of SSUSC84_0921 and SSUSC84_0739 was also found in...”
- Comparative transcriptomic analysis reveal genes involved in the pathogenicity increase of Streptococcus suis epidemic strains
Wang, Virulence 2022 - “...of UDC Subgroup of COGs 2h SSUSC84_1405 SSU1375 MUN40_07820 Cystathionine - lyase UDC14 E SSUSC84_1406 SSU1376 MUN40_07825 Cystathionine -synthase E SSUSC84_1600 SSU1574 MUN40_02800 Methionine ABC transporter permease UDC15 E SSUSC84_1601 SSU1575 MUN40_02795 Methionine ABC transporter ATP-binding proteinATPase component E SSUSC84_1602 SSU1576 MUN40_02790 Peptidase E SSUSC84_1603 SSU1577...”
PMI2254 methionine gamma-lyase from Proteus mirabilis HI4320
44% identity, 95% coverage
AFUA_4G03950 cystathionine beta-lyase MetG from Aspergillus fumigatus Af293
43% identity, 81% coverage
- The sulfur-related metabolic status of <i>Aspergillus fumigatus</i> during infection reveals cytosolic serine hydroxymethyltransferase as a promising antifungal target
Alharthi, Virulence 2025 - “...normalized data (see Materials and Methods for details) revealed that five genes (AFUA_3G06492, AFUA_1G06940, AFUA_5G08600, AFUA_4G03950, and AFUA_6G00760) had very low counts (<20) in all samples. This could be due to the genes not being expressed at all or at very low levels in the tested...”
- Involvement of Sulfur in the Biosynthesis of Essential Metabolites in Pathogenic Fungi of Animals, Particularly Aspergillus spp.: Molecular and Therapeutic Implications
Traynor, Frontiers in microbiology 2019 - “...-synthase (CGS; AFUA_7G01590) was undetectable in egtA 26933 compared to ATCC26933, while cystathionine -lyase (CBL; AFUA_4G03950) exhibited a log 2 3.1-fold increase in abundance in egtA 26933 compared to ATCC26933 under ROS conditions ( Figure 6 ). This suggests that A. fumigatus egtA 26933 can switch...”
- Effects of amino acids on the lignocellulose degradation by Aspergillus fumigatus Z5: insights into performance, transcriptional, and proteomic profiles
Miao, Biotechnology for biofuels 2019 - “...during which the S -adenosylmethionine synthetase (AFUA_1G10630), adenosylhomocysteinase (AFUA_1G10130), cystathionine gamma-lyase (AFUA_8G04340), cystathionine beta-lyase MetG (AFUA_4G03950), cystathionine gamma-synthase (AFUA_7G01590), aspartate transaminase (AFUA_2G09650), and aspartate aminotransferase (AFUA_4G10410) were upregulated 1.11.7 times. Pyruvate decarboxylase PdcA (AFUA_3G11070), pyruvate decarboxylase (AFUA_6G00750), pyruvate dehydrogenase E1 component alpha subunit (AFUA_1G06960), pyruvate dehydrogenase...”
- Ergothioneine Biosynthesis and Functionality in the Opportunistic Fungal Pathogen, Aspergillus fumigatus
Sheridan, Scientific reports 2016 - “...O 2 , there was a significant increase (log 2 3.1-fold) in cystathionine -lyase (CBL; AFUA_4G03950). CBL catalyses the conversion of cystathionine to homocysteine, ammonia and pyruvate 32 . Homocysteine can be converted into methionine, required for SAM biosynthesis. EGT biosynthesis requires SAM for the tri-methylation...”
- “...possible degradative pathway for EGT. In addition, increased abundance of HisF (AFUA_2G06230) and cystathionine -lyase (AFUA_4G03950) shows an increased requirement for histidine and SAM respectively, necessary for the biosynthesis of EGT. Furthermore, the increased abundance of a sulphite reductase (AFUA_2G15590) observed could indicate an increased need...”
T303_02895 cystathionine gamma-synthase from Streptococcus thermophilus ASCC 1275
41% identity, 99% coverage
VC2683 cystathionine gamma-synthase from Vibrio cholerae O1 biovar eltor str. N16961
43% identity, 96% coverage
- CBS-derived H2S facilitates host colonization of Vibrio cholerae by promoting the iron-dependent catalase activity of KatB
Ma, PLoS pathogens 2021 - “...a result, multiple homologous proteins were identified for CBS (VC1061, VC0968, and VC0537) and CSE (VC2683 and VC1671), while only one was found for 3MST (VCA0620). We further examined the presence of key active-site residues [ 17 , 25 29 ] by multiple sequence alignment, and...”
- “...pfam01053) is the conserved domain in CSE proteins. V . cholerae encodes two Cys_Met_Meta_PP enzymes VC2683 and VC1671. Red and blue asterisks indicate key active-site residues in binging with co-factor pyridoxal-5-phosphate (PLP) and inhibitor DL-propargylglycine (PAG), respectively [ 26 ]. VC1671 is not a CSE homolog,...”
MIMOS_LEULE / A8CEI3 Mimosinase, chloroplastic; EC 4.3.3.8 from Leucaena leucocephala (White popinac) (Leucaena glauca) (see 2 papers)
A8CEI3 mimosinase (EC 3.5.1.61) from Leucaena leucocephala (see 2 papers)
40% identity, 81% coverage
- function: Catalyzes the degradation of mimosine, which is a toxic secondary metabolite found in all Leucaena and Mimosa species.
catalytic activity: L-mimosine + H2O = 3-hydroxy-4H-pyrid-4-one + pyruvate + NH4(+) (RHEA:75355)
cofactor: pyridoxal 5'-phosphate
subunit: Forms homodimers. May form homotetramers from two homodimers.
O02215 Cystathionine gamma-lyase from Caenorhabditis elegans
41% identity, 84% coverage
- A role for SKN-1/Nrf in pathogen resistance and immunosenescence in Caenorhabditis elegans
Papp, PLoS pathogens 2012 - “...p<0.001, *** p<0.0001. Accession numbers C. elegans proteins/genes: Q17941, Q9XTG7, Q2MGF0, Q17450, O61213, P54145, Q9U3Q6, O02215, G5EC10, Q18198, Q9XUH3, Q9XUF9, O44552, Q27487, Q18938, O17725, O16849, Q968Y9, Q9XVB4, Q9XVA9, Q19223, O62146, G5EGH6, Q8MNR8, Q19774, O02357, Q09321, Q9UAQ9, P91316, Q20770, Q20840, G5EC22, P90893, Q20968, Q21009, Q20117, Q9U2Q9, Q21355,...”
Q86D27 methionine gamma-lyase (EC 4.4.1.11) from Entamoeba histolytica (see 3 papers)
metg / BAC75878.2 methionine gamma-lyase 2 from Entamoeba histolytica (see paper)
EHI_142250, XP_648806 methionine gamma-lyase from Entamoeba histolytica HM-1:IMSS
42% identity, 96% coverage
- Global analysis of gene expression in response to L-Cysteine deprivation in the anaerobic protozoan parasite Entamoeba histolytica
Husain, BMC genomics 2011 - “...acid metabolism. Gene IDs: CS1, EHI_171750; CS2, EHI_160930; CS3, EHI_060340; MAT, 70.m00173; MGL1, EHI_144610; MGL2, EHI_142250; NifS; EHI_136380; PGDH, EHI_060860; PSAT, EHI_026360; SAHH, EHI_068250; SAT2, EHI_021570; SAT3, EHI_153430. We have recently shown by metabolomic analysis that the synthesis of OAS and SMC markedly increased upon L-cysteine...”
- Kinetic characterization of methionine gamma-lyases from the enteric protozoan parasite Entamoeba histolytica against physiological substrates and trifluoromethionine, a promising lead compound against amoebiasis.
Sato, The FEBS journal 2008 (PubMed)- GeneRIF: Results support the use of trifluoromethionine to target methionine gamma-lyase.
- Crystallization and preliminary X-ray analysis of L-methionine gamma-lyase 1 from Entamoeba histolytica.
Sato, Acta crystallographica. Section F, Structural biology and crystallization communications 2008 - GeneRIF: The presence of a tetramer in the asymmetric unit of L-methionine gamma lyase 1 gives a Matthews coefficient of 2.8 A(3) Da(-1) and a solvent content of 56%. The structure was solved by the molecular-replacement method
MUN40_07825 cystathionine gamma-synthase from Streptococcus suis 89-1591
42% identity, 98% coverage
CPZ21_10075 PLP-dependent transferase from Staphylococcus epidermidis
41% identity, 98% coverage
- Antibacterial Activity and Membrane-Targeting Mechanism of Aloe-Emodin Against Staphylococcus epidermidis
Li, Frontiers in microbiology 2021 - “...1.8.1.2), NADPH-dependent assimilatory sulfite reductase hemoprotein subunit (CPZ21_11545, EC 1. 8. 4. 8), cystathionine gamma-synthase (CPZ21_10075, EC 2.5. 1. 48), sulfate adenylyl transferase (sat, EC 2. 7. 7. 4), adenylyl-sulfate kinase (cysC, EC 2. 7. 1. 25), DoxX family protein (CPZ21_08425, EC 4. 4. 1. 2),...”
SERP0037 trans-sulfuration enzyme family protein from Staphylococcus epidermidis RP62A
41% identity, 98% coverage
SE2379 cystathionine gamma-synthase from Staphylococcus epidermidis ATCC 12228
41% identity, 98% coverage
SSO2368 O-succinylhomoserine (thiol)-lyase (cystathionine gamma-synthase) (metB) from Sulfolobus solfataricus P2
43% identity, 96% coverage
- Global analysis of viral infection in an archaeal model system
Maaty, Frontiers in microbiology 2012 - “...Prolidase, SSO0363 (48,72); d -3-phosphoglycerate dehydrogenase, SO0905 (36); FkbR2, putative, SSO1154 (12,24,36,48); O -succinylhomoserine (thiol)-lyase, SSO2368 (72); 3-isopropylmalate dehydratase, SSO2471 (36) Nucleotide transport and metabolism Uracil phosphoribosyltransferase, SSO0231 (48), Glutamine amidotransferase, SSO0571 (72) Carbohydrate transport and metabolism Phosphomannomutase, SSO0207 (12, 24)(48), phosphoenolpyruvate synthase, SSO0883 (12,24); bifunctional...”
SGO_1636 cystathionine gamma-synthase from Streptococcus gordonii str. Challis substr. CH1
41% identity, 99% coverage
- Propionate Attenuates Growth of Oral Streptococci through Enhancing Methionine Biosynthesis
Park, Journal of microbiology and biotechnology 2022 - “...reverse transcriptase (Promega, USA). Then, the mRNA expressions of metA , metE , SGO_1635 , SGO_1636 , and 16S rRNA were determined by real-time PCR analysis using StepOnePlus real-time system (Applied Biosystems, USA) under the following reaction conditions: initial denaturation at 95C for 10 min, then...”
- “...6A . Thus, the mRNA expression levels of methionine synthesis related genes, including metA , SGO_1636 , SGO_1635 , and metE were determined by real-time PCR analysis. As shown in Fig. 6B , gene expression levels of the methionine synthesis related genes in S. gordonii CH1...”
An14g00930 uncharacterized protein from Aspergillus niger
42% identity, 83% coverage
- Enhancement of protein production in Aspergillus niger by engineering the antioxidant defense metabolism
Chen, Biotechnology for biofuels and bioproducts 2024 - “...GS4(Grx3) OEGrx4 P-WT An18g04790 GS5(Grx4) OEGSH1 P-WT An02g09720 G1(GSH1) OEGSH2 P-WT An09g03030 G2(GSH2) OEMetG P-WT An14g00930 G3(MetG) OEMecB P-WT An16g08720 G4(MecB) OEYap1 P-WT An11g07980 T1(Yap1) OEPrx P-WT An04g00120 T2(Prx) OEGpxA P-WT An02g08110 T3(GpxA) OESodC P-WT An07g03770 T4(SodC) OESod2 P-WT An04g04870 T5(Sod2) OESodB P-WT An01g12530 T6(SodB) OEHacA...”
- “...included the GSH synthesis pathway in our analysis, which encompasses GSH1 (An02g09720), GSH2 (An09g03030), MetG (An14g00930), and MecB (An16g08720). The systems regulated by Yap1 are dependent on NADPH for their activity, represented in the figure by NAD kinase (An03g05090). Consequently, we segmented this system into the...”
TEL01S_RS05650 bifunctional L-alanine/L-glutamate racemase from Pseudothermotoga elfii DSM 9442 = NBRC 107921
41% identity, 96% coverage
- Adaptation Strategies to High Hydrostatic Pressures in Pseudothermotoga species Revealed by Transcriptional Analyses
Fenouil, Microorganisms 2023 - “...4 , Table 1 ), while genes metB , metH , mtnK , and mtnA (TEL01S_RS05650, TEL01S_RS06970, TEL01S_RS08685, and TEL01S_RS08690), which are involved in methionine metabolism, were over-expressed at 20 and 30 MPa. The gene cluster TEL01S_RS01770TEL01S_RS01785, which encodes ArgGHCJ, was over-expressed at 30 and 40...”
- “...and methionine metabolism 1 0 0 TEL01S_RS08690 mtnA ko00270:Cysteine and methionine metabolism 1 0 0 TEL01S_RS05650 ko00270:Cysteine and methionine metabolism|ko00260:Glycine, serine, and threonine metabolism 0 1 0 TEL01S_RS06970 metH ko00270:Cysteine and methionine metabolism 0 1 1 TEL01S_RS03640 dapB ko00300:Lysine biosynthesis 0 1 1 TEL01S_RS00130 dapA ko00300:Lysine...”
Q6J9X7 cysteine-S-conjugate beta-lyase (Fragment) from Medicago sativa
45% identity, 79% coverage
O04981 Cystathionine gamma-synthase from Zea mays
40% identity, 73% coverage
7nl1D / A0A125YN40 Crystal structure of cystathionine gamma-lyase from toxoplasma gondii (see paper)
40% identity, 94% coverage
- Ligand: pyridoxal-5'-phosphate (7nl1D)
B6K8Y1 cystathionine gamma-lyase (EC 4.4.1.1) from Toxoplasma gondii (see paper)
TGME49_112930 cystathione gamma lyase, putative from Toxoplasma gondii ME49
40% identity, 90% coverage
- Functional Characterization and Structure-Guided Mutational Analysis of the Transsulfuration Enzyme Cystathionine γ-Lyase from Toxoplasma gondii
Maresi, International journal of molecular sciences 2018 - “...by the reverse transsulfuration pathway. The presence of genes for the enzymes CBS (TGME49_059180), CGL (TGME49_112930), and CS (TGME49_078910) in the genome of the protozoan parasite Toxoplasma gondii , the causative agent of toxoplasmosis in humans, raises the possibility that this parasite possesses both the reverse...”
- “...2.1. Properties of Recombinant TgCGL The putative TgCGL enzyme is encoded by a single gene (TGME49_112930) and displays the highest sequence identity with CGLs from Trypanosomes and Leishmania parasites (~58% identity). However, it showed also ~40% and ~37% sequence identity with the human and Saccharomyces cerevisiae...”
- Global proteomic analysis of the oocyst/sporozoite of Toxoplasma gondii reveals commitment to a host-independent lifestyle
Possenti, BMC genomics 2013 - “...247 2.54E-12 TGME49_078910 O-acetylserine (thiol) lyase, putative 2.5.1.47 amino acid metabolism 20 3 5 2.39E-10 TGME49_112930 cystathionine beta-lyase, putative 4.4.1.1 amino acid metabolism 23 2 3 2.90E-10 TGME49_115260 alanine dehydrogenase, putative 1.4.1.1 amino acid metabolism 98 211 331 2.89E-14 TGME49_019230 acetoacetyl-CoA synthetase, putative 6.2.1.16 butanoate metabolism...”
- “...of T. gondii , i.e., proline (TGME49_069110), alanine (TGME49_115260, TGME-49_003500), threonine (TGME49_016640), cysteine (TG-ME49_059180, TGME49_078910, TGME49_112930), lysine (TGME49_005420) and tyrosine (TGME49_08-7510, TGME49_012740). The two forms of alanine dehydrogenase (EC 1.4.1.1), which catalyses the unidirectional conversion of pyruvate into l -alanine, share 39% sequence identity and differ...”
FGSG_01932 cystathionine beta-lyase from Fusarium graminearum PH-1
40% identity, 81% coverage
CBL_NEUCR / Q1K8G0 Cystathionine beta-lyase; Cysteine-S-conjugate beta-lyase; EC 4.4.1.13 from Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) (see paper)
Q1K8G0 cysteine-S-conjugate beta-lyase (EC 4.4.1.13) from Neurospora crassa (see paper)
NCU07987 cystathionine beta-lyase from Neurospora crassa OR74A
40% identity, 79% coverage
- function: Involved in de novo synthesis of methionine.
catalytic activity: L,L-cystathionine + H2O = L-homocysteine + pyruvate + NH4(+) (RHEA:13965)
catalytic activity: an S-substituted L-cysteine + H2O = a thiol + pyruvate + NH4(+) (RHEA:18121)
cofactor: pyridoxal 5'-phosphate - Sulfur-regulated control of the met-2⁺ gene of Neurospora crassa encoding cystathionine β-lyase
Reveal, BMC research notes 2013 - “...to the completion of the N. crassa genomic sequence. Subsequently, the locus has been designated NCU07987 in the Broad Institute database [ 24 ]. The GenBank AF401237 sequence features as reported here are identical to those reported in NCU07987. The met-2 + gene has a single...”
- “...submitted to GenBank as AF401237. The met-2 + gene has been assigned the locus designation NCU07987 in the Broad Institute Neurospora crassa database [ 24 ]. Northern analysis Total RNA was isolated by the phenol extraction procedure described previously [ 29 ]. Following sodium acetate washes,...”
L0EKR2 cystathionine gamma-synthase (EC 2.5.1.48) from Lens culinaris (see paper)
40% identity, 70% coverage
EAMY_0138 cystathionine gamma-synthase from Erwinia amylovora CFBP1430
43% identity, 96% coverage
- The stringent response regulator (p) ppGpp mediates virulence gene expression and survival in Erwinia amylovora
Yang, BMC genomics 2020 - “...EAMY_0208 metE , methionine synthase II 4.86 13.30 EAMY_0141 metF , 5,10-methylenetetrahydrofolate reductase 4.71 10.82 EAMY_0138 metB , cystathionine gamma-synthase 4.56 10.43 EAMY_0603 metK , S-adenosylmethionine synthetase 4.32 11.75 EAMY_3342 metA , homoserine transsuccinylase 3.4 9.95 EAMY_0139 metL , bifunctional aspartokinase 3.31 10.48 EAMY_0137 metJ ,...”
- “..., homoserine transsuccinylase 1.36 8.37 EAMY_2728 metN , methionine ABC transporter ATP-binding protein 1.15 7.49 EAMY_0138 metB , cystathionine gamma-synthase 1.04 7.60 Arginine EAMY_1630 astD , NAD-dependent aldehyde dehydrogenase 1.32 6.62 EAMY_1631 astB , succinylarginine dihydrolase 1.27 7.00 EAMY_1628 astC , succinylornithine transaminase 1.22 7.40 EAMY_1629...”
spr1377 Cystathionine gamma-synthase from Streptococcus pneumoniae R6
SPD_1353 Cys/Met metabolism PLP-dependent enzyme, putative from Streptococcus pneumoniae D39
41% identity, 99% coverage
- Multiple mutations and increased RNA expression in tetracycline-resistant Streptococcus pneumoniae as determined by genome-wide DNA and mRNA sequencing
Lupien, The Journal of antimicrobial chemotherapy 2015 - “...G-48A G-48A G860A G287E WT WT spr1262 spr1377 spr1777 DNA-directed RNA polymerase subunit b spr1885 (patB) ABC transporter ATP-binding protein/permease spr1887...”
- Transcriptional regulation and signature patterns revealed by microarray analyses of Streptococcus pneumoniae R6 challenged with sublethal concentrations of translation inhibitors
Ng, Journal of bacteriology 2003 - “...1.4 5.1 3.2 5.4 3.6 3.9 3.8 2.2 1.2 2.8 1.2 spr1181 spr1377 spr1434 spr1631 spr1634 spr1635 spr1636 3.1 2.9 2.1 2.0 2.2 2.4 5.1 3.5 3.2 1.4 2.0 2.1 2.4 6.1 1.7...”
- Cysteine-Mediated Gene Expression and Characterization of the CmbR Regulon in Streptococcus pneumoniae
Afzal, Frontiers in microbiology 2016 - “...1.5 spd_1290 Cystine ABC transporter, permease protein, TcyB 1.5 spd_1352 Aminotransferase, class II, Csd 2.3 spd_1353 Cys/Met metabolism PLP-dependent enzyme, putative, MetB 1.6 spd_1406 Homoserine O -succinyltransferase, MetA 1.7 spd_1898 Hypothetical protein 4.5 spd_1899 Glutamine amidotransferase, class 1, YvdE 6.9 spd_2037 Cysteine synthase A, CysK 3.7...”
FVEG_07318 cystathionine beta-lyase from Fusarium verticillioides 7600
40% identity, 78% coverage
- Careful with That Axe, Gene, Genome Perturbation after a PEG-Mediated Protoplast Transformation in Fusarium verticillioides
Scala, Toxins 2017 - “...genomic variations, we analyzed the relative expression of FVEG_03821, FVEG_03822, FVEG_13121, FVEG_13122, FVEG_13123, FVEG_07317 and FVEG_07318 ( Figure 5 ). Results indicated a profound alteration of gene expression in Fv_ lds1 D and Fv_ lds1 T strains at two and seven days after inoculation (dai) compared...”
- “...loss of the stop codon in FVEG_07317 and the loss of the 5 upstream of FVEG_07318. This SV variation affected in Fv_ lds1 D the expression of FVEG_07317 and FVEG_07318 genes that are more expressed with respect to WT. In Fv_ lds1 T, the FVEG_07317 and...”
B4F935 Cystathionine gamma-synthase 1 chloroplastic from Zea mays
39% identity, 77% coverage
- Genotype-Specific Growth and Proteomic Responses of Maize Toward Salt Stress
Soares, Frontiers in plant science 2018 - “...High A0A096QFM0 Guaiacol peroxidase 2 2.1E-03 6 71.84 Low A0A096S9W1 Remorin 8.2E-04 5 30.12 Low B4F935 Cystathionine gamma-synthase 1 chloroplastic 7.4E-03 5 43.29 Low B4F9A4 NAD(P)-linked oxidoreductase superfamily protein 1.1E-03 16 63.73 Low B6UGK8 3-isopropylmalate dehydratase small subunit 2 3.2E-02 4 67.87 Low K7VC35 S -adenosylmethionine...”
A4IBL4 Putative cystathione gamma lyase from Leishmania infantum
40% identity, 90% coverage
- Potential selection of antimony and methotrexate cross-resistance in Leishmania infantum circulating strains
Bernardo, PLoS neglected tropical diseases 2024 - “...subunit beta-like protein 44.55 44.35 0.20 A4HRT1 LINF 030006800 Multifunctional fusion protein 44.09 43.93 0.16 A4IBL4 LINF 350037700 Cystathione gamma lyaseputative 44.64 44.48 0.16 A4HZS1 LINF 220009800 40S ribosomal protein S15putative 47.19 47.03 0.16 A4I5F6 LINF 300018100 Pyridoxal kinase 46.94 46.78 0.16 A4IA34 LINF 340031800 Albaputative...”
- “...histoneputative 45.56 45.18 0.38 A4I4C9 LINF 290012700 Heat shock protein 90 putative 44.26 43.96 0.30 A4IBL4 LINF 350037700 Putative cystathione gamma lyase 45.82 45.53 0.29 A4I5X6 LINF 300035000 Glyceraldehyde-3-phosphate dehydrogenase 44.25 43.99 0.26 A4HY43 LINF 190006800 ADPATP carrier protein 1 43.94 43.78 0.16 A4HX65 LINF 170005000...”
DR_0921 trans-sulfuration enzyme from Deinococcus radiodurans R1
42% identity, 96% coverage
A4HMZ0 Cystathione gamma lyase from Leishmania braziliensis
40% identity, 90% coverage
CGS1 / P55217 cystathionine γ-synthase (EC 2.5.1.48) from Arabidopsis thaliana (see 2 papers)
CGS1_ARATH / P55217 Cystathionine gamma-synthase 1, chloroplastic; AtCGS1; METHIONINE OVERACCUMULATION 1; O-succinylhomoserine (thiol)-lyase; EC 2.5.1.48 from Arabidopsis thaliana (Mouse-ear cress) (see 4 papers)
AT3G01120 MTO1 (METHIONINE OVERACCUMULATION 1); cystathionine gamma-synthase from Arabidopsis thaliana
NP_186761 Pyridoxal phosphate (PLP)-dependent transferases superfamily protein from Arabidopsis thaliana
40% identity, 66% coverage
- function: Catalyzes the first committed step of methionine (Met) biosynthesis. Catalyzes the formation of L-cystathionine from homoserine esters and L-cysteine, via a gamma-replacement reaction. Substrate preference for cystathionine synthesis is O-phospho-L- homoserine (OPH) > O(4)-succinyl-L-homoserine (OSH) >> O-acetyl-L- homoserine (OAH). Is able, at extremely low rate, to catalyze a gamma- elimination of OPH in the absence of cysteine to produce inorganic phosphate (Pi), 2-oxobutanoate and ammonia.
catalytic activity: O-succinyl-L-homoserine + L-cysteine = L,L-cystathionine + succinate + H(+) (RHEA:20397)
cofactor: pyridoxal 5'-phosphate (Binds 1 pyridoxal 5'-phosphate per subunit.) - Oligosaccharide production and signaling correlate with delayed flowering in an Arabidopsis genotype grown and selected in high [CO2]
Kinmonth-Schultz, PloS one 2023 - “...] explaining their presence in clusters associated with that term ( S2H Table ). CGS (AT3G01120) was lower in SG relative to CG, as was a threonine synthase ( MTO1 , AT3G01120). Additionally, MTO2 showed a within-genotype effect to [CO 2 ] as it decreased in...”
- Overexpressing GmCGS2 Improves Total Amino Acid and Protein Content in Soybean Seed
Zhang, International journal of molecular sciences 2023 - “...NCBI Protein Blast Local Alignment Search Tool according to the amino acid sequence of AtCGS1 (At3G01120). Phylogenetic analysis of the amino acid sequences of CGS proteins from A. thaliana (Arabidopsis), Zea mays (maize), Oryza sativa (rice), Solanum tuberosum (potato), Nicotiana tabacum (tobacco), and soybean showed that...”
- Comparative transcriptional and co-expression network analysis of two upland cotton accessions with extreme phenotypic differences reveals molecular mechanisms of fiber development
He, Frontiers in plant science 2023 - “...ATP synthase alpha/beta family protein darkolivegreen module (EZ_15DPA) GH_D08G2099 0.971 AT5G12250 Beta-6 tubulin GH_A05G3885 0.961 AT3G01120 PLP-dependent transferases superfamily protein GH_A08G2085 0.959 AT5G12250 Beta-6 tubulin GH_A08G0145 0.954 AT4G08810 Calcium ion binding GH_D11G1234 0.954 AT4G15800 RALF-like 33 maroon module (ZR_20DPA) GH_A01G2058 0.945 AT1G77120 Alcohol dehydrogenase 1 GH_D08G0287...”
- Global Survey, Expressions and Association Analysis of CBLL Genes in Peanut
Ren, Frontiers in genetics 2022 - “...(2005) Goyer et al. (2007) Joshi and Jander, (2009) Atkinson et al. (2013) AdCBLL5/AdCBLL8/AiCBLL4/AhCBLL9 AtMTO1/AtCGS (AT3G01120) Influences Met metabolism in seeds, related to light, sucrose and salt and osmotic stresses regulation Hacham et al. (2013) Cohen et al. (2014) Cohen et al. (2017) Whitcomb et al....”
- Genomic Regions Associated With Seed Meal Quality Traits in Brassica napus Germplasm
Bhinder, Frontiers in plant science 2022 - “...Methionine biosynthesis CYSD1 SNC_027759.2_21536878 21536878 25775 AT3G04940 A03 3.17 Methionine biosynthesis MTO1 SNC_027767.2_23748159 23748159 8113 AT3G01120 C01 4.47 Methionine accumulation Tryptophan HEMA2 SNC_027765.2_44309263 44309263 39699 AT1G09940 A09 3.19 Tryptophan biosynthesis GLU1 SNC_027766.2_21272659 21272659 34503 AT5G04140 A10 3.07 Tryptophan biosynthesis PGM SNC_027766.2_21272659 21272659 31690 AT5G04120 A10 3.07...”
- Proteomic Analysis of Arabidopsis pldα1 Mutants Revealed an Important Role of Phospholipase D Alpha 1 in Chloroplast Biogenesis
Takáč, Frontiers in plant science 2019 - “...mitochondrial Unique in Col-0 Unique in Col-0 n.a. n.a. 8.21/8.21 2/2 8.31/8.31 2/2 METABOLISM P55217 At3g01120 Cystathionine gamma-synthase 1, chloroplastic mutant unique mutant unique n.a. n.a. 6.36/7.77 2/2 7.82/6.93 2/2 Q9FIJ7 At5g47840 Adenylate kinase 2, chloroplastic mutant unique mutant unique n.a. n.a. 11.01/8.51 3/2 19.43/14.49 3/4...”
- Alteration of S-adenosylhomocysteine levels affects lignin biosynthesis in switchgrass
Bai, Plant biotechnology journal 2018 - “...1991 . Identification and cloning of PvCGS and PvSAHH1 Arabidopsis thaliana nucleic acid sequences AtCGS (AT3G01120) and AtSAHH1 (AT4G13940) were used as a query to BLAST against the Panicum virgatum v4.1 genome sequences (Phytozome). PvCGS (Pavir.9NG556700) and PvSAHH1 (Pavir.1NG430900) were identified as the most homologous genes....”
- Pre-symptomatic transcriptome changes during cold storage of chilling sensitive and resistant peach cultivars to elucidate chilling injury mechanisms
Pons, BMC genomics 2015 - “...1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 3 AT4G14710 ARD2 Yang Cycle associated to VN tissue PPN072E05 Cystathionine gamma synthase AT3G01120 MTO1/CGS1 Antioxidant system GLUTHATHIONE - GLUTAREDOXIN AND THIOREDOXIN REDOX HOMEOSTASIS PPN039H11 Glutathione S-transferase AT5G17220 TT19/GSTF12 PA monomer transporter Cytoskeleton organization and biogenesis Actin microfilament - actin depolimerization PPN047E05 Actin depolymerizing...”
- More
- Cystathionine γ-synthase expression in seeds alters metabolic and DNA methylation profiles in Arabidopsis.
Girija, Plant physiology 2023 (PubMed)- GeneRIF: Cystathionine gamma-synthase expression in seeds alters metabolic and DNA methylation profiles in Arabidopsis.
- Repression of CYSTATHIONINE γ-SYNTHASE in Seeds Recruits the S-Methylmethionine Cycle.
Cohen, Plant physiology 2017 - GeneRIF: Seed-specific repression of AtCGS in RNA interference seeds triggered the induction of genes operating in the SMM cycle of rosette leaves.
- Ribosomes in a stacked array: elucidation of the step in translation elongation at which they are stalled during S-adenosyl-L-methionine-induced translation arrest of CGS1 mRNA.
Yamashita, The Journal of biological chemistry 2014 - GeneRIF: Data indicate that stacked ribosomes play in the control of cystathionine gamma-synthase CGS1 mRNA degradation.
- Seed-specific expression of a feedback-insensitive form of CYSTATHIONINE-γ-SYNTHASE in Arabidopsis stimulates metabolic and transcriptomic responses associated with desiccation stress.
Cohen, Plant physiology 2014 - GeneRIF: Cystathione-gamma-synthase stimulates metabolic and transcriptomic responses associated with desiccation stress in seeds.
- Light and sucrose up-regulate the expression level of Arabidopsis cystathionine γ-synthase, the key enzyme of methionine biosynthesis pathway.
Hacham, Amino acids 2013 (PubMed)- GeneRIF: Light and sucrose up-regulate the expression level of cystathionine gamma-synthase.
- A halt in poly(A) shortening during S-adenosyl-L-methionine-induced translation arrest in CGS1 mRNA of Arabidopsis thaliana.
Yamashita, Genes & genetic systems 2013 (PubMed)- GeneRIF: Report shows that the poly(A) tail of the full-length CGS1 mRNA showed an apparent increase from 50-80 nucleotides (nt)to 140-150 nt after the induction of CGS1 mRNA degradation.
- Ribosome stacking defines CGS1 mRNA degradation sites during nascent peptide-mediated translation arrest.
Haraguchi, Plant & cell physiology 2008 (PubMed)- GeneRIF: These results show that S-adenosyl-L-methionine induces the stacking of ribosomes on CGS1 mRNA and that multiple mRNA degradation sites probably correspond to each stacked ribosome.
- Nascent peptide-mediated translation elongation arrest of Arabidopsis thaliana CGS1 mRNA occurs autonomously.
Onouchi, Plant & cell physiology 2008 (PubMed)- GeneRIF: CGS1 mRNA degradation involves a plant-specific mechanism.
- More
- Proteomic Analysis of Arabidopsis pldα1 Mutants Revealed an Important Role of Phospholipase D Alpha 1 in Chloroplast Biogenesis
Takáč, Frontiers in plant science 2019 - “...2, mitochondrial Unique in Col-0 Unique in Col-0 n.a. n.a. 8.21/8.21 2/2 8.31/8.31 2/2 METABOLISM P55217 At3g01120 Cystathionine gamma-synthase 1, chloroplastic mutant unique mutant unique n.a. n.a. 6.36/7.77 2/2 7.82/6.93 2/2 Q9FIJ7 At5g47840 Adenylate kinase 2, chloroplastic mutant unique mutant unique n.a. n.a. 11.01/8.51 3/2 19.43/14.49...”
- Subgroup 4 R2R3-MYBs in conifer trees: gene family expansion and contribution to the isoprenoid- and flavonoid-oriented responses
Bedon, Journal of experimental botany 2010 - “...BT116465 ATP:citrate lyase b-subunit Q9AXR6 3E-78 TCA 1.6 1.1E-03 1.7 2.0E-03 GQ03230_I01 BT102565 Cystathionine -synthase P55217 9E-69 1.3 5.8E-04 1.4 9.7E-04 GQ02802_I24 BT103811 Fructokinase, putative Q9C524 4E-41 1.5 1.1E-05 1.4 1.0E-03 GO:0006810 Transport GQ03810_L15 BT101863 ABC transporter, PRD-like Q8GU87 1E-35 FV 2.2 1.2E-05 1.9 1.0E-03 GQ03810_L15...”
L0EK12 cystathionine gamma-synthase (EC 2.5.1.48) from Cicer arietinum (see paper)
NP_001265950 cystathionine gamma-synthase, chloroplastic-like from Cicer arietinum
39% identity, 70% coverage
DA471_RS08555 PLP-dependent transferase from Staphylococcus aureus
40% identity, 96% coverage
E9AFE7 cystathionine gamma-lyase (EC 4.4.1.1) from Leishmania major (see paper)
LMJF_35_3230 putative cystathione gamma lyase from Leishmania major strain Friedlin
39% identity, 90% coverage
- Identification of protein profile in metacyclic and amastigote-like stages of Leishmania tropica: a proteomic approach
Ashrafmansouri, AMB Express 2022 - “...LMJF_23_0690 (L7836.03) LDDFTFPCLFAK, KHPDFGK 14.28 E9ACG7 Putative delta-1-pyrroline-5-carboxylate dehydrogenase LMJF_03_0200 YGLTGAVFSR, GAFEFQGQK, CTGAVVGQQPFGGSR, GYFVEPTIIETK 9.32 E9AFE7 Putative cystathione gamma lyase LMJF_35_3230 NNLHGGMLWFEVK, VGITDGFVR, NNLHGGMLWFEVK, NNLHGGMLWFEVK Down-regulated proteins list during metacyclic conversion into amastigote-like form of L. tropica 8.28 O62591 Probable eukaryotic initiation factor 4A LMJF_01_0770 HNLIQGLVLSPTR,...”
- Identification of protein profile in metacyclic and amastigote-like stages of Leishmania tropica: a proteomic approach
Ashrafmansouri, AMB Express 2022 - “...E9ACG7 Putative delta-1-pyrroline-5-carboxylate dehydrogenase LMJF_03_0200 YGLTGAVFSR, GAFEFQGQK, CTGAVVGQQPFGGSR, GYFVEPTIIETK 9.32 E9AFE7 Putative cystathione gamma lyase LMJF_35_3230 NNLHGGMLWFEVK, VGITDGFVR, NNLHGGMLWFEVK, NNLHGGMLWFEVK Down-regulated proteins list during metacyclic conversion into amastigote-like form of L. tropica 8.28 O62591 Probable eukaryotic initiation factor 4A LMJF_01_0770 HNLIQGLVLSPTR, VLVTTDLVAR,HNLIQGLVLSPTR, ESLTLEGIK 28.72 Q4FX73 40S...”
NP_001234489 cystathionine gamma synthase from Solanum lycopersicum
40% identity, 69% coverage
NWMN_0351 Cys/Met metabolism PLP-dependent enzyme from Staphylococcus aureus subsp. aureus str. Newman
SA0347 hypothetical protein from Staphylococcus aureus subsp. aureus N315
SAUSA300_0360 Cys/Met metabolism PLP-dependent enzyme from Staphylococcus aureus subsp. aureus USA300_FPR3757
SACOL0431 trans-sulfuration enzyme family protein from Staphylococcus aureus subsp. aureus COL
SA_RS01985 PLP-dependent transferase from Staphylococcus aureus subsp. aureus N315
39% identity, 96% coverage
- Methionine biosynthesis in Staphylococcus aureus is tightly controlled by a hierarchical network involving an initiator tRNA-specific T-box riboswitch
Schoenfelder, PLoS pathogens 2013 - “...operon-like structure and are annotated as SACOL0431 - SACOL0427 in S. aureus COL and as NWMN_0351 - NWM_0347 in S. aureus Newman, respectively, with metF being named metH in the latter strain ( Figure 1A ). Northern blot analysis using a double-stranded DNA probe confirmed the...”
- CodY in Staphylococcus aureus: a regulatory link between metabolism and virulence gene expression
Pohl, Journal of bacteriology 2009 - “...16, 2019 by guest NWMN_0349 NWMN_0350 NWMN_0351 NWMN_0425 NWMN_0436 NWMN_0437 NWMN_0516 NWMN_0831 NWMN_0855 NWMN_0858 NWMN_0860 NWMN_0883 NWMN_1239 NWMN_1240...”
- Characterization of RNA Helicase CshA and Its Role in Protecting mRNAs and Small RNAs of Staphylococcus aureus Strain Newman
Kim, Infection and immunity 2016 - “...sa1885 glmM, fmtB sa2094, saS083 sa2169, sa2168 sa0348, sa0347 saS014, ndhF sa0434, sa0435 sa0468, ftsH sa0574, sarA sa0574, sarA saS023, sa0769 sa0892, sa0891...”
- Single-pass classification of all noncoding sequences in a bacterial genome using phylogenetic profiles
Marchais, Genome research 2009 - “...high molecular weight signals. Sequence analysis suggests that SA0347 (metB) is regulated by a T-box riboswitch and SA0667 (queC) by a preQ1 type riboswitch...”
- An in silico analysis of T-box regulated genes and T-box evolution in prokaryotes, with emphasis on prediction of substrate specificity of transporters
Wels, BMC genomics 2008 - “...Histidine transport system permease protein hisM lmo2587 Met Met related cytosolic hypothetical Staphylococcus aureus 2 SA0347 Met Cystathionine gamma-synthase SA1199 Trp Anthranilate synthase component I Streptococcus agalactiae 3 SAG0809 Ala Ala-tRNA ligase related hypothetical Streptococcus pneumoniae 4 spr0489 Val Val-tRNA ligase related hypothetical spr1241 Ala Ala-tRNA...”
- Cigarette Smoke Extract-Exposed Methicillin-Resistant Staphylococcus aureus Regulates Leukocyte Function for Pulmonary Persistence
Kulkarni, American journal of respiratory cell and molecular biology 2016 - “...SAUSA300_2436 SAUSA300_0796 SAUSA300_0207 SAUSA300_2389 SAUSA300_0360 SAUSA300_2609 SAUSA300_0557 SAUSA300_1814 SAUSA300_2618 SAUSA300_2282 SAUSA300_0641...”
- Nutrient limitation governs Staphylococcus aureus metabolism and niche adaptation in the human nose
Krismer, PLoS pathogens 2014 - “...form L-cystathionine and L-homocysteine ( Fig. 6 ). The genes for cystathionine--synthase ( metI , SAUSA300_0360) and cystathionine--lyase ( metC , SAUSA300_0359), whose gene products are responsible for these enzymatic reactions, were 26- to 32-fold up-regulated and exhibited the strongest up-regulation of all genes in SNM3....”
- “...were up-regulated in SNM3 compared to BM as determined by microarray analysis, with SAUSA300_0357 to SAUSA300_0360 exhibiting the strongest effects (13 to 32-fold). The metK gene, shown in green, was expressed at similar levels in BM and SNM3. The cystathionine--synthase (MetI) represents the target for DL-propargylglycin....”
- Anti-quorum Sensing Activities of Selected Coral Symbiotic Bacterial Extracts From the South China Sea
Ma, Frontiers in cellular and infection microbiology 2018 - “...high sequence identity to another species of the same genus, Staphylococcus aureus (GenBank accession numbers SACOL0431 - ACOL0427 ) (Schoenfelder et al., 2013 ). Our analysis predicts the presence of these genes identified in isolate D11 might be involved in methionine (or its intermediate product homocysteine...”
- In vitro and in vivo models of Staphylococcus aureus endophthalmitis implicate specific nutrients in ocular infection
Sadaka, PloS one 2014 - “...homocysteineS-methyltransferase/5,10-methylenetetrahydrofolate reductase 28.3 (1.2) 11.5 (1.4) SACOL0430 Trans-sulfuration enzyme family protein 36.1 (1.1) 12.8 (1.1) SACOL0431 Trans-sulfuration enzyme family protein 30.9 (1.1) 10.4 (1.1) SACOL0431 rev comp Reverse complement of interior105 nt region of SACOL0431 11.1 (1.4) ig_SACOL0431-2 121 nt region upstream of SACOL0431 12.3 (1.7)...”
- Methionine biosynthesis in Staphylococcus aureus is tightly controlled by a hierarchical network involving an initiator tRNA-specific T-box riboswitch
Schoenfelder, PLoS pathogens 2013 - “...metF, metE, mdh (metal-dependent hydrolase)) are organized in an operon-like structure and are annotated as SACOL0431 - SACOL0427 in S. aureus COL and as NWMN_0351 - NWM_0347 in S. aureus Newman, respectively, with metF being named metH in the latter strain ( Figure 1A ). Northern...”
- “...aligned with the genomes of S. haemolyticus and S. saprophyticus for the intergenic region between SACOL0431 and SACOL0432. The multiple sequence alignment was done with ClustalW2 [3] on the server of the European Bioinformatics Institute ( http://www.ebi.ac.uk/Tools/msa/clustalw2/ ). Known motifs are highlighted. Purple boxes contain conserved...”
- A new oxidative sensing and regulation pathway mediated by the MgrA homologue SarZ in Staphylococcus aureus
Chen, Molecular microbiology 2009 - “...+ Conserved hypothetical protein SACOL0219 -2.5 Conserved hypothetical protein SACOL0430 -2.6 Cystathionine -lyase family protein SACOL0431 -2.3 Cystathionine -synthase family protein SACOL0505 -3.1 ABC transporter SACOL0507 -2.3 N-acetylmuramoyl-L-Ala amidase precursor SACOL0602 -2.3 Haloacid dehydrogenase-like protein SACOL0883 -2.7 ABC transporter SACOL0910 -3.0 Hypothetical protein SACOL1164 -3.1 Fibrinogen-binding...”
- Nitric oxide stress induces different responses but mediates comparable protein thiol protection in Bacillus subtilis and Staphylococcus aureus
Hochgräfe, Journal of bacteriology 2008 - “...class I Amino acid and protein biosynthesis SACOL0431 SACOL0545 SACOL0594 SACOL1276 SACOL2045 SACOL2223 RplY Tuf Tsf IlvC RplR Trans-sulfuration enzyme family...”
- Development of a Single-nucleotide Polymorphism Genotyping Assay for the Rapid Detection of Vancomycin-intermediate Resistance in Staphylococcus aureus Epidemic Lineage ST5
Kim, Annals of laboratory medicine 2023 - “...362,625 GC S55T RpiR family transcriptional regulator 78.6 SA_RS01845 378,175 CA P530H Hypothetical protein 85.7 SA_RS01985 / SA_RS01990 407,772 AC Intergenic (302/360) Cystathionine gamma synthase/chromosome-partitioning protein ParB 78.6 SA_RS02445 493,702 AG A1013A Glutamate synthase 82.1 SA_RS02450 495,666 AG P162P Glutamate synthase subunit beta 85.7 SA_RS02640 528,901...”
U876_13000 trans-sulfuration enzyme family protein from Aeromonas hydrophila NJ-35
40% identity, 94% coverage
XP_818034 cystathione gamma lyase, putative from Trypanosoma cruzi
40% identity, 91% coverage
SPOA0318 methionine gamma-lyase from Silicibacter pomeroyi DSS-3
SPOA0318 methionine gamma-lyase from Ruegeria pomeroyi DSS-3
41% identity, 90% coverage
L0102 cystathionine gamma-synthase (EC 4.2.99.9) from Lactococcus lactis subsp. lactis Il1403
39% identity, 99% coverage
- Factors Affecting Spontaneous Endocytosis and Survival of Probiotic Lactobacilli in Human Intestinal Epithelial Cells
Ramirez-Sánchez, Microorganisms 2022 - “...Reagents Used IEC cultures of Caco-2 were maintained in DMEM (High Glucose, -Na-Pyruvate, Cat. No. L0102, Biowest, Riverside, MO, USA) supplemented with 10% heat inactivated fetal bovine serum (FBS), 1% non-essential amino acids (Cat. No. X0557, Biowest), 1% sodium pyruvate (NPY-B, Capricorn Scientific GmbH, Ebsdorfergrund, Germany),...”
PP2001 O-succinylhomoserine sulfhydrylase from Pseudomonas putida KT2440
40% identity, 85% coverage
- Impact of CFTR Modulation on Pseudomonas aeruginosa Infection in People With Cystic Fibrosis
Ledger, The Journal of infectious diseases 2024 - “...Isolation and Culture A small plug of sputum was inoculated onto horse blood Columbia agar (PP2001; Thermo Fisher Scientific) and MacConkey agar (base 3, CM0115; OXOID). Plates were incubated for up to 72 hours at 37 C 5% CO 2 . Morphologically distinct colonies were selected,...”
- Streptococcus pyogenes emm98.1 variants activate inflammatory caspases in human neutrophils
Williams, Virulence 2023 - “...previously [ 16 ]. GAS were cultured from storage at 37C on horse-blood agar (Oxoid, PP2001). For experimental enumeration of colony forming units (CFU)/mL, GAS were but cultured on 1% yeast supplemented (w/v) Todd-Hewitt broth (THY, Bacto Laboratories 249,240) agar. For in vitro infection, GAS were...”
- Reconciliation of genome-scale metabolic reconstructions for comparative systems analysis
Oberhardt, PLoS computational biology 2011 - “...genes) was 64%. The reconciled GENRE included one gene more from the set of mutants (PP2001), and made correct predictions in the case of three more genes. This caused an increase in accuracy to 69%. Complete results are given in Table 3 in Text S1 ....”
ASA_2347 methionine gamma-lyase from Aeromonas salmonicida subsp. salmonicida A449
A4SNC4 Methionine gamma-lyase from Aeromonas salmonicida (strain A449)
40% identity, 94% coverage
SVEN_6204 trans-sulfuration enzyme family protein from Streptomyces venezuelae ATCC 10712
41% identity, 87% coverage
- Silencing cryptic specialized metabolism in Streptomyces by the nucleoid-associated protein Lsr2
Gehrke, eLife 2019 - “...Butyrolactone T2PKS SVEN_5951 SVEN_6002 19 45.10 6 (SVEN_5963*4, 5968*9, 59723, 5974, 59756, 5979) Other SVEN_6112 SVEN_6204 3 (1 repressed) 3.26 1 (SVEN_6199) NRPS-ladderane SVEN_6134 SVEN_6282 50 36.49 7 (SVEN_6199, 62167, 621920, 6225*, 6230, 62478, 6251) Terpene SVEN_6436 SVEN_6490 6 16.67 1 (SVEN_6458) Bacteriocin SVEN_6527 SVEN_6535 (1...”
XP_006500878 cystathionine gamma-lyase isoform X1 from Mus musculus
49% identity, 68% coverage
- Weakening of M1 macrophage and bone resorption in periodontitis cystathionine γ-lyase-deficient mice.
Li, Oral diseases 2024 (PubMed)- GeneRIF: Weakening of M1 macrophage and bone resorption in periodontitis cystathionine gamma-lyase-deficient mice.
- The crucial relationship between miRNA-27 and CSE/H2S, and the mechanism of action of GLP-1 in myocardial hypertrophy.
Gao, International journal of medical sciences 2024 - GeneRIF: The crucial relationship between miRNA-27 and CSE/H2S, and the mechanism of action of GLP-1 in myocardial hypertrophy.
- Cystathionine gamma-lyase (Cth) induces efferocytosis in macrophages via ERK1/2 to modulate intestinal barrier repair.
Zhao, Cell communication and signaling : CCS 2023 - GeneRIF: Cystathionine gamma-lyase (Cth) induces efferocytosis in macrophages via ERK1/2 to modulate intestinal barrier repair.
- Cystine/Glutamate Xc- Antiporter Induction Compensates for Transsulfuration Pathway Repression by 2,3,7,8-Tetrachlorodibenzo-p-dioxin (TCDD) to Ensure Cysteine for Hepatic Glutathione Biosynthesis.
Orlowska, Chemical research in toxicology 2023 - GeneRIF: Cystine/Glutamate Xc[-] Antiporter Induction Compensates for Transsulfuration Pathway Repression by 2,3,7,8-Tetrachlorodibenzo-p-dioxin (TCDD) to Ensure Cysteine for Hepatic Glutathione Biosynthesis.
- Cystathionine gamma-lyase (CTH) inhibition attenuates glioblastoma formation.
Peleli, Redox biology 2023 - GeneRIF: Cystathionine gamma-lyase (CTH) inhibition attenuates glioblastoma formation.
- Hydrogen sulfide regulates the redox state of soluble guanylate cyclase in CSE-/- mice corpus cavernosum microcirculation.
Olivencia, Pharmacological research 2023 (PubMed)- GeneRIF: Hydrogen sulfide regulates the redox state of soluble guanylate cyclase in CSE[-/-] mice corpus cavernosum microcirculation.
- Disrupted Binding of Cystathionine γ-Lyase to p53 Promotes Endothelial Senescence.
Hu, Circulation research 2023 (PubMed)- GeneRIF: Disrupted Binding of Cystathionine gamma-Lyase to p53 Promotes Endothelial Senescence.
- The DR1‑CSE/H2S system inhibits renal fibrosis by downregulating the ERK1/2 signaling pathway in diabetic mice.
Li, International journal of molecular medicine 2022 - GeneRIF: The DR1CSE/H2S system inhibits renal fibrosis by downregulating the ERK1/2 signaling pathway in diabetic mice.
- More
NMA1808 O-succinylhomoserine sulfhydrolase from Neisseria meningitidis Z2491
38% identity, 97% coverage
PP0659 cystathionine gamma-synthase from Pseudomonas putida KT2440
39% identity, 89% coverage
MSMEG_1652 bifunctional o-acetylhomoserine/o-acetylserine sulfhydrylase from Mycolicibacterium smegmatis
MSMEG_1652 O-acetylhomoserine sulfhydrylase from Mycobacterium smegmatis str. MC2 155
39% identity, 85% coverage
ACIAD3382 homocysteine synthase from Acinetobacter sp. ADP1
38% identity, 88% coverage
- Wax ester production in nitrogen-rich conditions by metabolically engineered Acinetobacter baylyi ADP1
Luo, Metabolic engineering communications 2020 - “...was described previously ( Lehtinen etal., 2018a ), with three adjacent genes poxB (ACIAD3381), metY (ACIAD3382) and acr1 (ACIAD3383) being replaced with the gene luxAB . The genes poxB and metY are neutral targets for deletion; their deletions have been shown not to have a negative...”
- “...and luxB and was designed to knock out the three adjacent genes poxB (ACIAD3381), metY (ACIAD3382) and acr1 (ACIAD3383). The kanamycin resistance marker in the original cassette was replaced with a spectinomycin resistance marker. 2.3 Flux balance analysis Flux balance analysis (FBA) ( Orth etal., 2010...”
- iTRAQ-Based Comparative Proteomic Analysis of Acinetobacter baylyi ADP1 Under DNA Damage in Relation to Different Carbon Sources
Jiang, Frontiers in microbiology 2019 - “...4.53 Acetolactate synthase 3 regulatory subunit ilvH ACIAD3103 3.87 2.88 2.33 1.96 Homocysteine synthase metY ACIAD3382 2.17 4.74 3.22 2.65 Dihydrolipoamide acetyltransferase aceF ACIAD3506 2.38 6.31 4.13 3.53 UDP- N -acetylmuramate L -alanine ligase murC ACIAD3516 1.47 1.84 1.89 2.11 5-methyltetrahydropteroyltriglutamatehomocysteine methyltransferase metE ACIAD3523 28.31 3.37...”
- Improved fatty aldehyde and wax ester production by overexpression of fatty acyl-CoA reductases
Lehtinen, Microbial cell factories 2018 - “...production in an earlier study [ 32 ]. In addition to these two genes, the ACIAD3382 gene was deleted for practical reasons to allow the deletion of ACIAD3383 and ACIAD3381 with a single cassette. ACIAD3382 encodes for a homocysteine synthase, and its deletion has been shown...”
- Improved triacylglycerol production in Acinetobacter baylyi ADP1 by metabolic engineering
Santala, Microbial cell factories 2011 - “...chloramphenicol. The strain was designated as MT. In addition to the target genes, the gene ACIAD3382 was deleted for practical reasons; the group of the three adjacent genes ACIAD3381 - ACIAD3383 could be deleted using single knock-out cassette. The gene ACIAD3382 encodes a homocysteine synthase, metY...”
- “...such modulation in theory is possible. The strain MT with four gene deletions (ACIAD3309, ACIAD3381, ACIAD3382, ACIAD3383) was constructed using a synthetic gene cassette. For practical reasons (see: strain construction) ACIAD3382 was also deleted, although the gene is not known to be involved in lipid metabolism....”
W8R7K4 Cystathionine gamma synthase from Nicotiana tabacum
39% identity, 71% coverage
- Cucurbit Chlorotic Yellows Virus p22 Protein Interacts with Cucumber SKP1LB1 and Its F-Box-Like Motif Is Crucial for Silencing Suppressor Activity
Chen, Viruses 2019 - “...Six proteins involved in methionine metabolism were expressed only in p22 del - expressing leaves (W8R7K4, A0A1S3ZRH2, A0A1J6IRB6, Q069K2, A0A1U7Y5G0, and A0A1J6KI60) ( Figure 7 B). We further detected the expression of four genes in methionine metabolism using qRT-PCR and found that the mRNA level was...”
- “...p22, suggesting that p22 regulates methionine metabolism. Proteinprotein interaction (PPI) analysis showed that three proteins (W8R7K4, A0A1S3ZRH2, and Q069K2) contributed to S-adenosyl- l -methionine synthase (SAMS; A0A1J6IRB6) synthesis. Because SAMS is essential for HEN1 methyltransferase activity [ 42 ] and affects sRNA stability, we speculate that...”
1qgnA / Q9ZPL5 Cystathionine gamma-synthase from nicotiana tabacum (see paper)
39% identity, 93% coverage
- Ligand: pyridoxal-5'-phosphate (1qgnA)
A8J355 Uncharacterized protein from Chlamydomonas reinhardtii
38% identity, 80% coverage
metZ / P55218 O-succinyl-L-homoserine sulfhydrylase (EC 2.5.1.48) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
METZ_PSEAE / P55218 O-succinylhomoserine sulfhydrylase; OSH sulfhydrylase; OSHS sulfhydrylase; EC 2.5.1.- from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
PA3107 O-succinylhomoserine sulfhydrylase from Pseudomonas aeruginosa PAO1
41% identity, 85% coverage
MA2715 O-acetylhomoserine (thiol)-lyase from Methanosarcina acetivorans C2A
39% identity, 85% coverage
- Methanosarcina acetivorans contains a functional ISC system for iron-sulfur cluster biogenesis
Deere, BMC microbiology 2020 - “...hypothetical protein; MA0809, DrsEsuperfamily protein; MA0810, SirA-like protein; MA0811, histidine triad protein; MA2714, homoserine O-acetyltransferase; MA2715, O-acetylhomoserine (thiol)-lyase; MA2716, quinolinatesynthetase A; MA2719, helix-turn-helix XRE-family like protein; MA3262, LrgBsuperfamily protein; MA3263, LrgAsuperfamily protein. Fig. S2. Amino acid sequence alignment of M. acetivorans IscS13 with IscSfrom Escherichia coli...”
metG cystathionine beta-lyase; EC 4.4.1.8 from Emericella nidulans (see 3 papers)
metG / AAB03241.1 cystathionine beta-lyase from Aspergillus nidulans (see paper)
41% identity, 82% coverage
- CharProtDB Description: Cystathionine beta-lyase, enzyme of the methionine biosynthesis pathway; mutants show a reduced rate of DNA damage repair; Source:AspGD
NMB1609 trans-sulfuration enzyme family protein from Neisseria meningitidis MC58
38% identity, 97% coverage
CSP5_0202 trans-sulfuration enzyme family protein from Cuniculiplasma divulgatum
40% identity, 97% coverage
- Proteome Cold-Shock Response in the Extremely Acidophilic Archaeon, Cuniculiplasma divulgatum
Bargiela, Microorganisms 2020 - “...and cysteine cycles were demonstrated in proteomic data to be overexpressed (cystathionine -synthase /cystathionine -lyase (CSP5_0202, up 1.16 fold), threonine synthase (CSP5_1396, 1.49-fold), homoserine dehydrogenase (CSP5_0597, 1.18-fold), aspartate aminotransferase (CSP5_0812, 1.24-fold) and aspartate ammonia-lyase (CSP5_1895, 1.14-fold)). We expect that overexpression of methionine production is required for...”
Tneu_0243 cystathionine gamma-synthase from Thermoproteus neutrophilus V24Sta
41% identity, 93% coverage
ACIAD2314 o-succinylhomoserine sulfhydrylase from Acinetobacter sp. ADP1
37% identity, 90% coverage
SJAG_03671 cystathionine beta-lyase from Schizosaccharomyces japonicus yFS275
37% identity, 92% coverage
Q8KNG3 methionine gamma-lyase (EC 4.4.1.11) from Micromonospora echinospora (see 2 papers)
39% identity, 99% coverage
PF1266 cystathionine gamma-lyase (gamma-cystathionase) from Pyrococcus furiosus DSM 3638
40% identity, 93% coverage
- Impact of growth mode, phase, and rate on the metabolic state of the extremely thermophilic archaeon Pyrococcus furiosus
Khatibi, Biotechnology and bioengineering 2017 - “...D4 vs. D2 D4 vs. D1 Amino acid biosynthesis PF1052 serine/threonine biosynthesis --- 5 8 PF1266 cystathionine gamma-synthase --- 18 11 PF1267 5, 10-methylenetetrahydrofolate reductase --- 15 9 PF1268 homosysteine methyltransferase --- 8 5 Biosynthesis of cofactors, prosthetic groups, and carriers PF1528 pyridoxal 5-phosphate synthase PdxT...”
- A mutant ('lab strain') of the hyperthermophilic archaeon Pyrococcus furiosus, lacking flagella, has unusual growth physiology
Lewis, Extremophiles : life under extreme conditions 2015 - “...13.9 Asp-semialdehyde dehydrogenase Asp metabolism PF1133 5.7 8.6 13.0 hypothetical protein (68 aa) PF1132 mutated PF1266 10.6 2.5 13.0 cystathionine gamma-synthase Met biosynthesis PF1267 12.1 3.5 13.0 hypothetical protein Mutated PF1268 24.3 3.5 24.3 homocysteinemethyltransferase Mutated PF1269 13.0 2.0 7.5 methionine synthase Met biosynthesis PF1472 2.5...”
- Experimental and computational analysis of the secretome of the hyperthermophilic archaeon Pyrococcus furiosus
Schmid, Extremophiles : life under extreme conditions 2013 - “...oxidoreductase alpha-2 44 7 17 No PF1203 18893290 Formaldehyde ferredoxin oxidoreductase 70 18 24 No PF1266 18893362 Cystathionine gamma-lyase 41 8 32 No PF1283 18893381 Rubrerythrin 20 5 26 No PF1394 18893507 Phosphoglycerate dehydrogenase 34 5 16 No PF1421 18893540 Hypothetical 4-aminobutyrate aminotransferase 51 15 42...”
- Cold shock of a hyperthermophilic archaeon: Pyrococcus furiosus exhibits multiple responses to a suboptimal growth temperature with a key role for membrane-bound glycoproteins
Weinberg, Journal of bacteriology 2005 - “...PF1054 PF1055 PF1056 PF1062 PF1104 PF1137 Methionine biosynthesis PF1266 PF1267 PF1268 PF1270 PF1344 PF1348 PF1408 1.6 0.5 (3.1) 1.7 0.7 (3.2) 2.0 0.5 (4.0)...”
- “...of branched-chain amino acids (PF0934 to PF0940) and methionine (PF1266 to PF1270), none of which are up-regulated even after 2 h, and of the operon involved in...”
- Whole-genome DNA microarray analysis of a hyperthermophile and an archaeon: Pyrococcus furiosus grown on carbohydrates or peptides
Schut, Journal of bacteriology 2003 - “...PF1110 [Unknown] PF1129 PF1130 [Methionine biosynthesis] PF1266 PF1267 PF1268 PF1269 Ferredoxin:NADPH oxidoreductase I PF1327 PF1328 [Unknown] PF1536 PF1537...”
bll1105 O-succinylhomoserine sulfhydrylase from Bradyrhizobium japonicum USDA 110
Q89VE2 O-succinylhomoserine sulfhydrylase from Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
36% identity, 90% coverage
- Pleiotropic Effects of PhaR Regulator in Bradyrhizobium diazoefficiens Microaerobic Metabolism
Quelas, International journal of molecular sciences 2024 - “...2.5 235228 TGCGATGCGCAC CGCACCGCGGGC - bll0958 acd Q89VT7 acyl-CoA dehydrogenase 3.0 1.7 52 GGCATCGCGAAT - bll1105 metZ Q89VE2 O-succinylhomoserine sulfhydrylase 2.3 1.5 - - - blr1496 - Q89UC1 unknown protein 2.1 19.9 156 48 GGCGCGGCGCTG TGCGCTGCGCCT - blr2221 bioA Q89T29 adenosylmethionine-8-amino-7-oxononanoate aminotransferase 2.3 1.1 189 176...”
- Pleiotropic Effects of PhaR Regulator in Bradyrhizobium diazoefficiens Microaerobic Metabolism
Quelas, International journal of molecular sciences 2024 - “...TGCGATGCGCAC CGCACCGCGGGC - bll0958 acd Q89VT7 acyl-CoA dehydrogenase 3.0 1.7 52 GGCATCGCGAAT - bll1105 metZ Q89VE2 O-succinylhomoserine sulfhydrylase 2.3 1.5 - - - blr1496 - Q89UC1 unknown protein 2.1 19.9 156 48 GGCGCGGCGCTG TGCGCTGCGCCT - blr2221 bioA Q89T29 adenosylmethionine-8-amino-7-oxononanoate aminotransferase 2.3 1.1 189 176 CGCTTGGCAAGC CGCGCTGCGACA...”
SPCC11E10.01 cystathionine beta-lyase (predicted) from Schizosaccharomyces pombe
37% identity, 96% coverage
- Response to sulfur in Schizosaccharomyces pombe
Ohtsuka, FEMS yeast research 2021 - “...as Sul1, and the SPAC869.05c protein is denoted as Sul2. The cystathionine -lyase encoded by SPCC11E10.01 is referred to here as Cbl1. The at least doubled expression after 3 or 6h of sulfur starvation is marked with a green circle on the left or right side...”
- “...that SPAC23A1.14c also encodes cystathionine -synthase (Harrison etal . 2005 ). Cystathionine -lyase encoded by SPCC11E10.01 converts cystathionine to homocysteine (Ejim etal . 2004 ; Holt etal . 2011 ). Although SPCC11E10.01 was reported as str3 + in 2004, SPAC1F8.03c encoding a heme transporter was already...”
- The Loz1 transcription factor from Schizosaccharomyces pombe binds to Loz1 response elements and represses gene expression when zinc is in excess
Wilson, Molecular microbiology 2019 - “...211 SPCC576.03c tpx1 thioredoxin peroxidase unfolded protein binding 1.54 CGCCGATCATT 194 This study TGCAGATCCTG 156 SPCC11E10.01 $ Cystathionine betalyase 1.37 AGCTAATCATA 989 SPBC12C2.03c Methionine synthase reductase 1.18 CGCAGATCTTT 1648 CGTCGATCCTG 1761 CGTCGATCTTG 1731 TGTCGATCACG 1722 TGGTGATCCAA 1696 CGTCGATCTTT 882 SPCC757.12 Alphaamylase homolog 1.04 GGCCGATCGCT 702 Numbers...”
- CPF Recruitment to Non-canonical Transcription Termination Sites Triggers Heterochromatin Assembly and Gene Silencing
Vo, Cell reports 2019 - “...cis -acting regulatory lncRNAs (such as lncRNAs located upstream of byr2 , phol , and SPCC11E10.01 ; Figures 5A and S5A ) with peaks precisely coinciding with peaks of Mmi1 ( Figure 5B ). Importantly, loss of Mmi1 abolished CPF localization at these loci ( Figures...”
- “...CPF subunit Iss1-GFP at the lncRNAs adjacent to the genes byr2 , pho1 , and SPCC11E10.01 in WT or mmi1 cells. Enrichment values represent the subtraction of whole-cell extract (WCE, input) from immunoprecipitated chromatin (IP). (B) ChIP-chip analysis of CFP-Mmi1 in WT cells at the indicated...”
- A conserved dimer interface connects ERH and YTH family proteins to promote gene silencing
Xie, Nature communications 2019 - “...cells (Fig. 8c bottom panel). Similar changes are detected at other loci such as the SPCC11E10.01 gene, which is also repressed by read-through lncRNA in mmi1 cells (Supplementary Fig. 7 ). Thus, the Mmi1 W112A mutant that affects Mmi1-Erh1 interaction without disrupting the termination function of...”
- Regulation of mRNA Levels by Decay-Promoting Introns that Recruit the Exosome Specificity Factor Mmi1
Kilchert, Cell reports 2015 - “...part of the intergenic feature INT_0_2957], and nc-spcc11e10.01 [annotated as the extended 5 UTR of spcc11e10.01 ]) ( Figures S2 CS2E). Strikingly, Mmi1 frequently crosslinked with transcripts derived from intergenic regions, which also tended to be upregulated in mmi1 . This included some non-annotated ncRNAs like...”
- Mtr4-like protein coordinates nuclear RNA processing for heterochromatin assembly and for telomere maintenance
Lee, Cell 2013 - “...Red1, Mtl1 and Rrp6 peaks upstream of several protein-coding genes, such as pho1, SPBC1271.09 and SPCC11E10.01 ( Figures 4A and S3AD ). These peaks correlate with ncRNAs that accumulate in red1 , mtl1-1 and rrp6 cells ( Figures S3AC ). We hypothesized that upstream ncRNAs recruit...”
- The roles of stress-activated Sty1 and Gcn2 kinases and of the protooncoprotein homologue Int6/eIF3e in responses to endogenous oxidative stress during histidine starvation
Nemoto, Journal of molecular biology 2010 - “...BRP44L ortholog C1259.09c SPCC1259.09c 2.7 0.9 Probable pyruvate dehydrogenase protein component, mitochondrial Homocysteine synthesis str3 SPCC11E10.01 3.0 1.2 cystathionine -lyase (predicted) a,b Fold increase in mRNA abundance after 3 hrs of 3AT treatment, compared to the value in wild-type at time 0. c Based on Gene...”
- Global transcriptional responses of fission and budding yeast to changes in copper and iron levels: a comparative study
Rustici, Genome biology 2007 - “...to the cluster involved in copper uptake ( ctr4 , ctr5 , ctr6 , and SPCC11E10.01; Figures 1 and 2a ). The timing of induction of the copper uptake systems is similar in both yeasts, with strong induction of ctr5 in S. pombe and CTR1 in...”
- “..., str1 , str3 , SPBC947.05c, and SPAC8C9.12c). The function of the other three genes (SPCC11E10.01, vht1 , and isu1 ) is less well understood, but their conserved regulation suggests an important role in metal metabolism. SPCC11E10.01 is the fission yeast counterpart to YFR055W, which encodes...”
bglu_2g08500 O-succinylhomoserine sulfhydrylase from Burkholderia glumae BGR1
38% identity, 85% coverage
Achr_14240 O-succinylhomoserine sulfhydrylase from Azotobacter chroococcum NCIMB 8003
41% identity, 85% coverage
- Holistic view of biological nitrogen fixation and phosphorus mobilization in Azotobacter chroococcum NCIMB 8003
Biełło, Frontiers in microbiology 2023 - “...Achr_14230; phosphoribosylamine-glycine ligase, A0A0C4WVR5, Achr_34370), as well as L -methionine ( O -succinylhomoserine sulfhydrylase, A0A0C4WHE2, Achr_14240; aspartate-semialdehyde dehydrogenase, A0A0C4WRB7, Achr_14130), was strongly induced in the FP condition. In addition, in the FPb condition, a connection with copper was also observed since the multicopper oxidase type 2...”
MAP3457 MetC from Mycobacterium avium subsp. paratuberculosis str. k10
40% identity, 81% coverage
MAV_4315 O-acetylhomoserine sulfhydrylase from Mycobacterium avium 104
40% identity, 81% coverage
- RNA-Seq analysis of Mycobacterium avium non-coding transcriptome
Ignatov, PloS one 2013 - “...RFAM database ( Table 3 ) [37] . The SAM-IV riboswitch was found upstream of MAV_4315. SAM-IV riboswitches specifically bind S -adenosylmethionine, a cofactor used in many methylation reactions [38] , whereas MAV_4315 encodes O -acetylhomoserine sulfhydrylase, an enzyme implicated in cysteine and methionine metabolism. 10.1371/journal.pone.0074209.t003...”
ZMO0676 Cystathionine gamma-synthase from Zymomonas mobilis subsp. mobilis ZM4
37% identity, 93% coverage
- Systems biology analysis of Zymomonas mobilis ZM4 ethanol stress responses
Yang, PloS one 2013 - “...elongation factor Ts (ZMO1155) were the most abundant proteins down-regulated by ethanol treatment. Cystathione gamma-synthase (ZMO0676), iron-containing alcohol dehydrogenase (ZMO1596) and a hypothetical protein (ZMO1109) were among the most abundant up-regulated proteins. Enzymes that were abundant in both the ethanol-treated and control conditions included key enzymes...”
plu3517 No description from Photorhabdus luminescens subsp. laumondii TTO1
37% identity, 89% coverage
VpaChn25_0576 O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase family protein from Vibrio parahaemolyticus
38% identity, 89% coverage
- Genomic and transcriptomic analyses reveal distinct biological functions for cold shock proteins (VpaCspA and VpaCspD) in Vibrio parahaemolyticus CHN25 during low-temperature survival
Zhu, BMC genomics 2017 - “...oxidase subunit CcoP VpaChn25_1521 0.4651 cbb3-type cytochrome c oxidase subunit II Cysteine and methionine metabolism VpaChn25_0576 0.293 Homocysteine synthase VpaChn25_0788 0.2948 Cysteine synthase A VpaChn25_0937 2.3269 Cysteine synthase/cystathionine beta-synthase family protein VpaChn25_1880 2.8826 5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase VpaChn25_2471 0.4433 S-ribosylhomocysteinase VpaChn25_2646 2.2961 Aspartate kinase Arginine and proline metabolism...”
- “...on low-temperature survival of V. parahaemolyticus CHN25. In cysteine and methionine metabolism, a homocysteine synthase (VpaChn25_0576) and S-ribosylhomocysteinase (VpaChn25_2471), which are involved in converting O-acetyl-L-homoserine and S-ribosyl-L-homocysteine to L-homocysteine, were down-regulated (0.2930- and 0.4433-fold, respectively) in the VpacspAD mutant. However, a 5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase (VpaChn25_1880) that catalyses...”
A1S_1683 O-succinylhomoserine sulfhydrylase from Acinetobacter baumannii ATCC 17978
40% identity, 85% coverage
- Genome-wide identification of Acinetobacter baumannii genes necessary for persistence in the lung
Wang, mBio 2014 - “...( 26 ). Insertions in genes involved in the synthesis of methionine (A1S_0471, A1S_0737, A1S_0778, A1S_1683, A1S_2122, and A1S_2324) and arginine (A1S_0259, A1S_0610, A1S_1980, A1S_2686, A1S_2687, and A1S_3129) caused significantly decreased persistence, ranging from 2- to 6-fold, in the mouse pneumonia model of A.baumannii . Methionine...”
BT2387 O-acetylhomoserine (thiol)-lyase from Bacteroides thetaiotaomicron VPI-5482
BT_RS12065 O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase family protein from Bacteroides thetaiotaomicron VPI-5482
36% identity, 89% coverage
For advice on how to use these tools together, see
Interactive tools for functional annotation of bacterial genomes.
The PaperBLAST database links 793,807 different protein sequences to 1,259,118 scientific articles. Searches against EuropePMC were last performed on March 13 2025.
PaperBLAST builds a database of protein sequences that are linked
to scientific articles. These links come from automated text searches
against the articles in EuropePMC
and from manually-curated information from GeneRIF, UniProtKB/Swiss-Prot,
BRENDA,
CAZy (as made available by dbCAN),
BioLiP,
CharProtDB,
MetaCyc,
EcoCyc,
TCDB,
REBASE,
the Fitness Browser,
and a subset of the European Nucleotide Archive with the /experiment tag.
Given this database and a protein sequence query,
PaperBLAST uses protein-protein BLAST
to find similar sequences with E < 0.001.
To build the database, we query EuropePMC with locus tags, with RefSeq protein
identifiers, and with UniProt
accessions. We obtain the locus tags from RefSeq or from MicrobesOnline. We use
queries of the form "locus_tag AND genus_name" to try to ensure that
the paper is actually discussing that gene. Because EuropePMC indexes
most recent biomedical papers, even if they are not open access, some
of the links may be to papers that you cannot read or that our
computers cannot read. We query each of these identifiers that
appears in the open access part of EuropePMC, as well as every locus
tag that appears in the 500 most-referenced genomes, so that a gene
may appear in the PaperBLAST results even though none of the papers
that mention it are open access. We also incorporate text-mined links
from EuropePMC that link open access articles to UniProt or RefSeq
identifiers. (This yields some additional links because EuropePMC
uses different heuristics for their text mining than we do.)
For every article that mentions a locus tag, a RefSeq protein
identifier, or a UniProt accession, we try to select one or two
snippets of text that refer to the protein. If we cannot get access to
the full text, we try to select a snippet from the abstract, but
unfortunately, unique identifiers such as locus tags are rarely
provided in abstracts.
PaperBLAST also incorporates manually-curated protein functions:
- Proteins from NCBI's RefSeq are included if a
GeneRIF
entry links the gene to an article in
PubMed®.
GeneRIF also provides a short summary of the article's claim about the
protein, which is shown instead of a snippet.
- Proteins from Swiss-Prot (the curated part of UniProt)
are included if the curators
identified experimental evidence for the protein's function (evidence
code ECO:0000269). For these proteins, the fields of the Swiss-Prot entry that
describe the protein's function are shown (with bold headings).
- Proteins from BRENDA,
a curated database of enzymes, are included if they are linked to a paper in PubMed
and their full sequence is known.
- Every protein from the non-redundant subset of
BioLiP,
a database
of ligand-binding sites and catalytic residues in protein structures, is included. Since BioLiP itself
does not include descriptions of the proteins, those are taken from the
Protein Data Bank.
Descriptions from PDB rely on the original submitter of the
structure and cannot be updated by others, so they may be less reliable.
(For SitesBLAST and Sites on a Tree, we use a larger subset of BioLiP so that every
ligand is represented among a group of structures with similar sequences, but for
PaperBLAST, we use the non-redundant set provided by BioLiP.)
- Every protein from EcoCyc, a curated
database of the proteins in Escherichia coli K-12, is included, regardless
of whether they are characterized or not.
- Proteins from the MetaCyc metabolic pathway database
are included if they are linked to a paper in PubMed and their full sequence is known.
- Proteins from the Transport Classification Database (TCDB)
are included if they have known substrate(s), have reference(s),
and are not described as uncharacterized or putative.
(Some of the references are not visible on the PaperBLAST web site.)
- Every protein from CharProtDB,
a database of experimentally characterized protein annotations, is included.
- Proteins from the CAZy database of carbohydrate-active enzymes
are included if they are associated with an Enzyme Classification number.
Even though CAZy does not provide links from individual protein sequences to papers,
these should all be experimentally-characterized proteins.
- Proteins from the REBASE database
of restriction enzymes are included if they have known specificity.
- Every protein with an evidence-based reannotation (based on mutant phenotypes)
in the Fitness Browser is included.
- Sequence-specific transcription factors (including sigma factors and DNA-binding response regulators)
with experimentally-determined DNA binding sites from the
PRODORIC database of gene regulation in prokaryotes.
- Putative transcription factors from RegPrecise
that have manually-curated predictions for their binding sites. These predictions are based on
conserved putative regulatory sites across genomes that contain similar transcription factors,
so PaperBLAST clusters the TFs at 70% identity and retains just one member of each cluster.
- Coding sequence (CDS) features from the
European Nucleotide Archive (ENA)
are included if the /experiment tag is set (implying that there is experimental evidence for the annotation),
the nucleotide entry links to paper(s) in PubMed,
and the nucleotide entry is from the STD data class
(implying that these are targeted annotated sequences, not from shotgun sequencing).
Also, to filter out genes whose transcription or translation was detected, but whose function
was not studied, nucleotide entries or papers with more than 25 such proteins are excluded.
Descriptions from ENA rely on the original submitter of the
sequence and cannot be updated by others, so they may be less reliable.
Except for GeneRIF and ENA,
the curated entries include a short curated
description of the protein's function.
For entries from BioLiP, the protein's function may not be known beyond binding to the ligand.
Many of these entries also link to articles in PubMed.
For more information see the
PaperBLAST paper (mSystems 2017)
or the code.
You can download PaperBLAST's database here.
Changes to PaperBLAST since the paper was written:
- November 2023: incorporated PRODORIC and RegPrecise. Many PRODORIC entries were not linked to a protein sequence (no UniProt identifier), so we added this information.
- February 2023: BioLiP changed their download format. PaperBLAST now includes their non-redundant subset. SitesBLAST and Sites on a Tree use a larger non-redundant subset that ensures that every ligand is represented within each cluster. This should ensure that every binding site is represented.
- June 2022: incorporated some coding sequences from ENA with the /experiment tag.
- March 2022: incorporated BioLiP.
- April 2020: incorporated TCDB.
- April 2019: EuropePMC now returns table entries in their search results. This has expanded PaperBLAST's database, but most of the new entries are of low relevance, and the resulting snippets are often just lists of locus tags with annotations.
- February 2018: the alignment page reports the conservation of the hit's functional sites (if available from from Swiss-Prot or UniProt)
- January 2018: incorporated BRENDA.
- December 2017: incorporated MetaCyc, CharProtDB, CAZy, REBASE, and the reannotations from the Fitness Browser.
- September 2017: EuropePMC no longer returns some table entries in their search results. This has shrunk PaperBLAST's database, but has also reduced the number of low-relevance hits.
Many of these changes are described in Interactive tools for functional annotation of bacterial genomes.
PaperBLAST cannot provide snippets for many of the papers that are
published in non-open-access journals. This limitation applies even if
the paper is marked as "free" on the publisher's web site and is
available in PubmedCentral or EuropePMC. If a journal that you publish
in is marked as "secret," please consider publishing elsewhere.
Many important articles are missing from PaperBLAST, either because
the article's full text is not in EuropePMC (as for many older
articles), or because the paper does not mention a protein identifier such as a locus tag, or because of PaperBLAST's heuristics. If you notice an
article that characterizes a protein's function but is missing from
PaperBLAST, please notify the curators at UniProt
or add an entry to GeneRIF.
Entries in either of these databases will eventually be incorporated
into PaperBLAST. Note that to add an entry to UniProt, you will need
to find the UniProt identifier for the protein. If the protein is not
already in UniProt, you can ask them to create an entry. To add an
entry to GeneRIF, you will need an NCBI Gene identifier, but
unfortunately many prokaryotic proteins in RefSeq do not have
corresponding Gene identifers.
References
PaperBLAST: Text-mining papers for information about homologs.
M. N. Price and A. P. Arkin (2017). mSystems, 10.1128/mSystems.00039-17.
Europe PMC in 2017.
M. Levchenko et al (2017). Nucleic Acids Research, 10.1093/nar/gkx1005.
Gene indexing: characterization and analysis of NLM's GeneRIFs.
J. A. Mitchell et al (2003). AMIA Annu Symp Proc 2003:460-464.
UniProt: the universal protein knowledgebase.
The UniProt Consortium (2016). Nucleic Acids Research, 10.1093/nar/gkw1099.
BRENDA in 2017: new perspectives and new tools in BRENDA.
S. Placzek et al (2017). Nucleic Acids Research, 10.1093/nar/gkw952.
The EcoCyc database: reflecting new knowledge about Escherichia coli K-12.
I. M. Keeseler et al (2016). Nucleic Acids Research, 10.1093/nar/gkw1003.
The MetaCyc database of metabolic pathways and enzymes.
R. Caspi et al (2018). Nucleic Acids Research, 10.1093/nar/gkx935.
CharProtDB: a database of experimentally characterized protein annotations.
R. Madupu et al (2012). Nucleic Acids Research, 10.1093/nar/gkr1133.
The carbohydrate-active enzymes database (CAZy) in 2013.
V. Lombard et al (2014). Nucleic Acids Research, 10.1093/nar/gkt1178.
The Transporter Classification Database (TCDB): recent advances
M. H. Saier, Jr. et al (2016). Nucleic Acids Research, 10.1093/nar/gkv1103.
REBASE - a database for DNA restriction and modification: enzymes, genes and genomes.
R. J. Roberts et al (2015). Nucleic Acids Research, 10.1093/nar/gku1046.
Deep annotation of protein function across diverse bacteria from mutant phenotypes.
M. N. Price et al (2016). bioRxiv, 10.1101/072470.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory