PaperBLAST
PaperBLAST Hits for SwissProt::Q6NWF1 Solute carrier family 2, facilitated glucose transporter member 12; Glucose transporter type 12; GLUT-12 (Danio rerio (Zebrafish) (Brachydanio rerio)) (610 a.a., MDAPEESIRM...)
Show query sequence
>SwissProt::Q6NWF1 Solute carrier family 2, facilitated glucose transporter member 12; Glucose transporter type 12; GLUT-12 (Danio rerio (Zebrafish) (Brachydanio rerio))
MDAPEESIRMTSDPQSKIYVQNPDTHIHLEQGPSAKSGNGRALVLCSVSVACLSGLLMGY
EMSLISGALLQLRDVLTLSCPEQEQVVGSLLLGAFLLSLGGGTILDHYGRRFTIILTALL
CVLGTLLSVCVVSFWALVVGRMLVGMSVALSGTASCLYAAEVAPAAWRGRCVCVYELMVV
LGMLLGFGLSWAFAGVPDGWRFTFGGALLPALLQAGVMPLLPDSPRFLLAQQREKEAHAT
LLRLRAGIKEVEPVEDELRAIRLAMGAERLHGFLDLFQSRDNMLQRLLVGAALVFLQQAT
GQPNILAYASTVLSSVGFHGNEAATLASTGFGVVKVGGTIPAIFLVDKVGPKALLCVGVV
VMMLSTATLGAITMQSRTHVSSLCRGPGNTANFTLFETGDETDIQTNTPLGLYQPQNKLK
TNTFLTSINDTREHWILNHTYNHRTALMETAELSKKDSAKIALQSLHEVSPSLKWISLVS
LLVYVAGFSISLGPMVHVVLSAIFPTGIRGKAVSVISAFNWATNLLISMTFLTLTERIGL
PTVIFSYSAMSFLLVVFVIVFVPETKGRSLEQISKELAMKNHLRGTLLCHRRKHKATAQP
SQEEKALATV
Running BLASTp...
Found 409 similar proteins in the literature:
GTR12_DANRE / Q6NWF1 Solute carrier family 2, facilitated glucose transporter member 12; Glucose transporter type 12; GLUT-12 from Danio rerio (Zebrafish) (Brachydanio rerio) (see paper)
100% identity, 100% coverage
- function: Insulin-regulated facilitative glucose transporter.
catalytic activity: D-glucose(out) = D-glucose(in) (RHEA:60376)
disruption phenotype: Morpholino knockdown of the protein impairs the development of the embryonic heart resulting in abnormal valve formation (PubMed:25326603). Embryos also show poor glycemic control (PubMed:25326603).
GTR12_BOVIN / Q5J316 Solute carrier family 2, facilitated glucose transporter member 12; Glucose transporter type 12; GLUT-12 from Bos taurus (Bovine) (see paper)
45% identity, 92% coverage
- function: Insulin-independent facilitative glucose transporter.
catalytic activity: D-glucose(out) = D-glucose(in) (RHEA:60376)
Q9BE72 Solute carrier family 2, facilitated glucose transporter member 12 from Macaca fascicularis
46% identity, 92% coverage
GTR12_HUMAN / Q8TD20 Solute carrier family 2, facilitated glucose transporter member 12; Glucose transporter type 12; GLUT-12 from Homo sapiens (Human) (see paper)
TC 2.A.1.1.87 / Q8TD20 solute carrier family 2, member 12, Glut12 of 617 aas and 12 TMSs from Homo sapiens (see 4 papers)
NP_660159 solute carrier family 2, facilitated glucose transporter member 12 from Homo sapiens
46% identity, 93% coverage
- function: Insulin-independent facilitative glucose transporter.
catalytic activity: D-glucose(out) = D-glucose(in) (RHEA:60376) - substrates: glucose
tcdb comment: In contrast to most mammalian members of this family, this protein has been reported to be a glucose:proton symporter (Wilson-O'Brien et al. 2010) - Insights into Substrate and Inhibitor Selectivity among Human GLUT Transporters through Comparative Modeling and Molecular Docking
Ferreira, ACS omega 2019 - “...GLUT5: P22732; GLUT6: Q9UGQ3; GLUT7: Q6PXP3; GLUT8: Q9NY64; GLUT9: Q9NRM0; GLUT10: O95528; GLUT11: Q9BYW1; GLUT12: Q8TD20; GLUT13 (MYCT): Q96QE2; GLUT14: Q8TDB8). Sequence alignment was manually checked in ViTO, 39 taking into account secondary structure prediction by the PSIPRED server. 47 Models were then built based on...”
- “...obtained from UniProt, were Q9NRM0 for human GLUT9, O95528 for GLUT10, Q9BYW1 for human GLUT11, Q8TD20 for GLUT12, and Q96QE2 for human GLUT13. The sequences obtained were then aligned with Clustal Omega and the resulting file was visualized and analyzed with Jalview, to determine conservation and...”
- THE CONCISE GUIDE TO PHARMACOLOGY 2017/18: Transporters
Alexander, British journal of pharmacology 2017 - “...UniProt SLC2A11 , Q9BYW1 SLC2A6 , Q9UGQ3 SLC2A8 , Q9NY64 SLC2A10 , O95528 SLC2A12 , Q8TD20 Common abreviation GLUT11 GLUT6 GLUT8 GLUT10 GLUT12 Substrates Dfructose [ 368 ], Dglucose [ 134 ] Dglucose [ 260 ] dehydroascorbic acid [ 339 ], Dglucose [ 339 ] Dglucose...”
- The Concise Guide to PHARMACOLOGY 2015/16: Transporters
Alexander, British journal of pharmacology 2015 - “...GLUT10 GLUT12 HGNC, UniProt SLC2A6 , Q9UGQ3 SLC2A8 , Q9NY64 SLC2A10 , O95528 SLC2A12 , Q8TD20 Substrates Dglucose [ 238 ] dehydroascorbic acid [ 308 ], Dglucose [ 308 ] Dglucose [ 409 ] Protoncoupled inositol transporter Overview Protoncoupled inositol transporters are expressed predominantly in the...”
- Proton-coupled sugar transport in the prototypical major facilitator superfamily protein XylE
Wisedchaisri, Nature communications 2014 - “...STP1 (P23586); Parachlorella kessleri hexose/H + symporter HUP1 (P15686); Homo sapiens facilitated glucose transporter GLUT12 (Q8TD20); Homo sapiens H + /myo-inositol transporter GLUT13 (HMIT) (Q96QE2); Homo sapiens facilitated glucose transporter GLUT2 (P11168); Homo sapiens facilitated glucose transporter GLUT10 (O95528); Homo sapiens facilitated glucose transporter GLUT1 (P11166);...”
- The Concise Guide to PHARMACOLOGY 2013/14: transporters
Alexander, British journal of pharmacology 2013 - “...Common abbreviation GLUT6 GLUT8 GLUT10 GLUT12 HGNC, UniProt SLC2A6, Q9UGQ3 SLC2A8, Q9NY64 SLC2A10, O95528 SLC2A12, Q8TD20 Substrates D-glucose 101 D-glucose 102 , dehydroascorbic acid 102 D-glucose 103 Proton-coupled inositol transporter Overview Proton-coupled inositol transporters are expressed predominantly in the brain and can be inhibited by phloretin...”
- Inhibition of androgen receptor enhanced the anticancer effects of everolimus through targeting glucose transporter 12.
Cao, International journal of biological sciences 2023 - GeneRIF: Inhibition of androgen receptor enhanced the anticancer effects of everolimus through targeting glucose transporter 12.
- Hypoxia promotes the growth and metastasis of ovarian cancer cells by suppressing ferroptosis via upregulating SLC2A12.
Li, Experimental cell research 2023 (PubMed)- GeneRIF: Hypoxia promotes the growth and metastasis of ovarian cancer cells by suppressing ferroptosis via upregulating SLC2A12.
- Epithelial mesenchymal transition regulator TWIST1 transcription factor stimulates glucose uptake through upregulation of GLUT1, GLUT3, and GLUT12 in vitro.
Pehlivanoglu, In vitro cellular & developmental biology. Animal 2021 (PubMed)- GeneRIF: Epithelial mesenchymal transition regulator TWIST1 transcription factor stimulates glucose uptake through upregulation of GLUT1, GLUT3, and GLUT12 in vitro.
- Let-7a-5p inhibits triple-negative breast tumor growth and metastasis through GLUT12-mediated warburg effect.
Shi, Cancer letters 2020 (PubMed)- GeneRIF: Let-7a-5p inhibits triple-negative breast tumor growth and metastasis through GLUT12-mediated warburg effect.
- Alternative Splicing and Cleavage of GLUT8.
Alexander, Molecular and cellular biology 2020 - GeneRIF: Alternative Splicing and Cleavage of GLUT8.
- GLUT12 expression and regulation in murine small intestine and human Caco-2 cells.
Gil-Iturbe, Journal of cellular physiology 2019 (PubMed)- GeneRIF: GLUT12 rapid translocation to the enterocytes apical membrane in response to glucose and insulin could be related to GLUT12 participation in sugar absorption during postprandial periods. In the pathological condition of obesity, in which insulin sensitivity is reduced, the contribution of GLUT12 to sugar absorption would be affected.
- GLUT12 and adipose tissue: Expression, regulation and its relation with obesity in mice.
Gil-Iturbe, Acta physiologica (Oxford, England) 2019 (PubMed)- GeneRIF: We hypothesize that GLUT12 would contribute to modulate sugar absorption in physiological and pathophysiological situations such as obesity.
- Potential Roles of GLUT12 for Glucose Sensing and Cellular Migration in MCF-7 Human Breast Cancer Cells Under High Glucose Conditions.
Matsui, Anticancer research 2017 (PubMed)- GeneRIF: GLUT12-knockdown completely abrogated high glucose-induced migration, indicating that GLUT12 functionally participates in sensing high glucose concentrations.
- More
NP_001301144 solute carrier family 2, facilitated glucose transporter member 12 from Capra hircus
44% identity, 92% coverage
GTR12_MOUSE / Q8BFW9 Solute carrier family 2, facilitated glucose transporter member 12; Glucose transporter type 12; GLUT-12 from Mus musculus (Mouse) (see 3 papers)
44% identity, 92% coverage
- function: Insulin-independent facilitative glucose transporter.
catalytic activity: D-glucose(out) = D-glucose(in) (RHEA:60376)
GTR10_DANRE / F1R0H0 Solute carrier family 2, facilitated glucose transporter member 10; Glucose transporter type 10; GLUT-10 from Danio rerio (Zebrafish) (Brachydanio rerio) (see 2 papers)
XP_005172836 solute carrier family 2, facilitated glucose transporter member 10 isoform X1 from Danio rerio
34% identity, 92% coverage
B2RCT7 Solute carrier family 2, facilitated glucose transporter member 10 from Homo sapiens
38% identity, 93% coverage
GTR10_HUMAN / O95528 Solute carrier family 2, facilitated glucose transporter member 10; Glucose transporter type 10; GLUT-10 from Homo sapiens (Human) (see 3 papers)
TC 2.A.1.1.59 / O95528 The glucose transporter, GLUT10, was originally believed to be responsible for Type 2 diabetes. It is now believed to be responsible for arterial tortuosity, a rare autosomal recessive connective tissue disease (Callewaert et al., 2007). GLUT10 transports glucose and 2-deoxy glucose (Km=0.3 mM), and is inhibited by galactose and phloretin from Homo sapiens (Human) (see 8 papers)
38% identity, 93% coverage
- function: Facilitative glucose transporter required for the development of the cardiovascular system.
catalytic activity: D-glucose(out) = D-glucose(in) (RHEA:60376) - substrates: 2-deoxyglucose, glucose
- Insights into Substrate and Inhibitor Selectivity among Human GLUT Transporters through Comparative Modeling and Molecular Docking
Ferreira, ACS omega 2019 - “...GLUT3: P11169; GLUT4: P14672; GLUT5: P22732; GLUT6: Q9UGQ3; GLUT7: Q6PXP3; GLUT8: Q9NY64; GLUT9: Q9NRM0; GLUT10: O95528; GLUT11: Q9BYW1; GLUT12: Q8TD20; GLUT13 (MYCT): Q96QE2; GLUT14: Q8TDB8). Sequence alignment was manually checked in ViTO, 39 taking into account secondary structure prediction by the PSIPRED server. 47 Models were...”
- “...which was set to 250. Query sequences, obtained from UniProt, were Q9NRM0 for human GLUT9, O95528 for GLUT10, Q9BYW1 for human GLUT11, Q8TD20 for GLUT12, and Q96QE2 for human GLUT13. The sequences obtained were then aligned with Clustal Omega and the resulting file was visualized and...”
- THE CONCISE GUIDE TO PHARMACOLOGY 2017/18: Transporters
Alexander, British journal of pharmacology 2017 - “...SLC2A10 SLC2A12 HGNC, UniProt SLC2A11 , Q9BYW1 SLC2A6 , Q9UGQ3 SLC2A8 , Q9NY64 SLC2A10 , O95528 SLC2A12 , Q8TD20 Common abreviation GLUT11 GLUT6 GLUT8 GLUT10 GLUT12 Substrates Dfructose [ 368 ], Dglucose [ 134 ] Dglucose [ 260 ] dehydroascorbic acid [ 339 ], Dglucose [...”
- The Concise Guide to PHARMACOLOGY 2015/16: Transporters
Alexander, British journal of pharmacology 2015 - “...abreviation GLUT6 GLUT8 GLUT10 GLUT12 HGNC, UniProt SLC2A6 , Q9UGQ3 SLC2A8 , Q9NY64 SLC2A10 , O95528 SLC2A12 , Q8TD20 Substrates Dglucose [ 238 ] dehydroascorbic acid [ 308 ], Dglucose [ 308 ] Dglucose [ 409 ] Protoncoupled inositol transporter Overview Protoncoupled inositol transporters are expressed...”
- Proton-coupled sugar transport in the prototypical major facilitator superfamily protein XylE
Wisedchaisri, Nature communications 2014 - “...(HMIT) (Q96QE2); Homo sapiens facilitated glucose transporter GLUT2 (P11168); Homo sapiens facilitated glucose transporter GLUT10 (O95528); Homo sapiens facilitated glucose transporter GLUT1 (P11166); Homo sapiens facilitated glucose transporter GLUT3 (P11169); Homo sapiens facilitated glucose transporter GLUT4 (P14672); Homo sapiens facilitated glucose transporter GLUT5 (P22732); Homo sapiens...”
- The Concise Guide to PHARMACOLOGY 2013/14: transporters
Alexander, British journal of pharmacology 2013 - “...SLC2A10 SLC2A12 Common abbreviation GLUT6 GLUT8 GLUT10 GLUT12 HGNC, UniProt SLC2A6, Q9UGQ3 SLC2A8, Q9NY64 SLC2A10, O95528 SLC2A12, Q8TD20 Substrates D-glucose 101 D-glucose 102 , dehydroascorbic acid 102 D-glucose 103 Proton-coupled inositol transporter Overview Proton-coupled inositol transporters are expressed predominantly in the brain and can be inhibited...”
- An insulin-like modular basis for the evolution of glucose transporters (GLUT) with implications for diabetes.
Root-Bernstein, Evolutionary bioinformatics online 2007 - “...GTR2 P11168; GTR3 11169; GTR4 P14672; GTR5 P22732; GTR6 Q9UGQ3; GTR8 Q9NY64; GTR9 Q9NRM0; GTR10 O95528; GTR11 Q9BYW1; GTR14 Q8TDB8). A further set of similarity searches was carried out in November 2006 involving the sodium/glucose cotransporters 1, 2 and 3 (P13866, P31639, and Q9NY91), using as...”
NP_569718 solute carrier family 2, facilitated glucose transporter member 10 from Mus musculus
36% identity, 88% coverage
- Mustn1 ablation in skeletal muscle results in increased glucose tolerance concomitant with upregulated GLUT expression in male mice.
Kim, Physiological reports 2023 - GeneRIF: Mustn1 ablation in skeletal muscle results in increased glucose tolerance concomitant with upregulated GLUT expression in male mice.
- Glut10 restrains neointima formation by promoting SMCs mtDNA demethylation and improving mitochondrial function.
Wu, Translational research : the journal of laboratory and clinical medicine 2023 (PubMed)- GeneRIF: Glut10 restrains neointima formation by promoting SMCs mtDNA demethylation and improving mitochondrial function.
- Slc2a10 knock-out mice deficient in ascorbic acid synthesis recapitulate aspects of arterial tortuosity syndrome and display mitochondrial respiration defects.
Boel, Human molecular genetics 2020 (PubMed)- GeneRIF: Slc2a10 knock-out mice deficient in ascorbic acid synthesis recapitulate aspects of arterial tortuosity syndrome and display mitochondrial respiration defects.
- Glucose transporter 10 modulates adipogenesis via an ascorbic acid-mediated pathway to protect mice against diet-induced metabolic dysregulation.
Jiang, PLoS genetics 2020 - GeneRIF: Data show that GLUT10 regulates adipogenesis via ascorbic acid-dependent DNA demethylation to benefit proper white adipose tissue development and protect mice against high-fat diet (HFD)-induced metabolic dysregulation. These findings suggest that SLC2A10 may be an important HFD-associated susceptibility locus for type 2 diabetes mellitus.
- Localization of Glucose Transporter 10 to Hair Cells' Cuticular Plate in the Mouse Inner Ear.
Chen, BioMed research international 2018 - GeneRIF: Glut10 may contribute to glucose transport from the endolymph to the hair cells across the cuticular plate in the mouse inner ear
- Mitochondrial GLUT10 facilitates dehydroascorbic acid import and protects cells against oxidative stress: mechanistic insight into arterial tortuosity syndrome.
Lee, Human molecular genetics 2010 (PubMed)- GeneRIF: GLUT10 protects cells from oxidative injury.
- Absence of arterial phenotype in mice with homozygous slc2A10 missense substitutions.
Callewaert, Genesis (New York, N.Y. : 2000) 2008 (PubMed)- GeneRIF: report that two mouse models, homozygous respectively for G128E and S150F missense substitutions in glut10 do not present any of the vascular, anatomical, or immunohistological abnormalities as encountered in human Arterial tortuosity syndrome patients.
- Expression of Class III facilitative glucose transporter genes (GLUT-10 and GLUT-12) in mouse and human adipose tissues.
Wood, Biochemical and biophysical research communications 2003 (PubMed)- GeneRIF: expression in adipose tissue
XP_011527366 solute carrier family 2, facilitated glucose transporter member 10 isoform X7 from Homo sapiens
39% identity, 74% coverage
- Revisiting the roles of glucose transporters in skeletal muscle physiology: is GLUT10 a novel player?
Lin, Biochemical and biophysical research communications 2024 (PubMed)- GeneRIF: Revisiting the roles of glucose transporters in skeletal muscle physiology: is GLUT10 a novel player?
- H22954, a long non-coding RNA, inhibits glucose uptake in leukemia cells in a GLUT10-dependent manner.
Bai, Hematology (Amsterdam, Netherlands) 2022 (PubMed)- GeneRIF: H22954, a long non-coding RNA, inhibits glucose uptake in leukemia cells in a GLUT10-dependent manner.
- Arterial Tortuosity Syndrome: An Ascorbate Compartmentalization Disorder?
Boel, Antioxidants & redox signaling 2021 (PubMed)- GeneRIF: Arterial Tortuosity Syndrome: An Ascorbate Compartmentalization Disorder?
- Slc2a10 knock-out mice deficient in ascorbic acid synthesis recapitulate aspects of arterial tortuosity syndrome and display mitochondrial respiration defects.
Boel, Human molecular genetics 2020 (PubMed)- GeneRIF: Slc2a10 knock-out mice deficient in ascorbic acid synthesis recapitulate aspects of arterial tortuosity syndrome and display mitochondrial respiration defects.
- Glucose transporter 10 modulates adipogenesis via an ascorbic acid-mediated pathway to protect mice against diet-induced metabolic dysregulation.
Jiang, PLoS genetics 2020 - GeneRIF: Data show that GLUT10 regulates adipogenesis via ascorbic acid-dependent DNA demethylation to benefit proper white adipose tissue development and protect mice against high-fat diet (HFD)-induced metabolic dysregulation. These findings suggest that SLC2A10 may be an important HFD-associated susceptibility locus for type 2 diabetes mellitus.
- Arterial tortuosity syndrome: 40 new families and literature review.
Beyens, Genetics in medicine : official journal of the American College of Medical Genetics 2018 (PubMed)- GeneRIF: We delineate the clinical spectrum and describe the histology in arterial tortuosity syndrome (ATS), a rare connective tissue disorder characterized by tortuosity of the large and medium-sized arteries, caused by mutations in SLC2A10
- Glucose transporter type 10-lacking in arterial tortuosity syndrome-facilitates dehydroascorbic acid transport.
Németh, FEBS letters 2016 (PubMed)- GeneRIF: GLUT10 is a dehydroascorbic acid (DAA) transporter and DAA transport is diminished in the endomembranes of fibroblasts from Arterial Tortuosity syndrome patients.
- GLUT10 deficiency leads to oxidative stress and non-canonical αvβ3 integrin-mediated TGFβ signalling associated with extracellular matrix disarray in arterial tortuosity syndrome skin fibroblasts.
Zoppi, Human molecular genetics 2015 - GeneRIF: GLUT10 deficiency leads to oxidative stress and non-canonical alphavbeta3 integrin-mediated TGFbeta signalling associated with extracellular matrix disarray in arterial tortuosity syndrome skin fibroblasts
- More
INT2_ARATH / Q9C757 Probable inositol transporter 2 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
TC 2.A.1.1.63 / Q9C757 Low affinity inositol (myoinsoitol (Km = 1 mM), scylloinositol, d-chiroinositol and mucoinositol):H+ symporter (expressed in the anther tapetum, the vasculature, and the leaf mesophyll from Arabidopsis thaliana (Mouse-ear cress) (see 4 papers)
AT1G30220, NP_174313 inositol transporter 2 from Arabidopsis thaliana
NP_174313 INT2 (INOSITOL TRANSPORTER 2); carbohydrate transmembrane transporter/ sugar:hydrogen symporter from Arabidopsis thaliana
29% identity, 90% coverage
- function: Plasma membrane inositol-proton symporter. Specific for several inositol epimers, such as myoinositol and scylloinositol. D- chiroinositol, mucoinositol, alloinositol and pinitol are also transported with a lower activity. Not active with galactinol and phytate.
disruption phenotype: No visible phenotype. - substrates: H+, Mucoinositol, Myoinositol, Scylloinositol, d-chiroinositol
- SA and NHP glucosyltransferase UGT76B1 affects plant defense in both SID2- and NPR1-dependent and independent manner
Zhang, Plant cell reports 2024 - “...serine-rich protein-related 1.77 4.27 9.26E-04 AT4G23280 CRK20 1.73 4.29 1.44E-03 AT3G16410 NSP4 1.66 3.27 3.12E-01 AT1G30220 INT2 1.66 4.37 6.89E-04 AT1G17020 SRG1 1.61 4.58 4.12E-03 AT1G10070 BCAT-2 1.58 6.84 2.52E-02 AT3G45130 LAS1 1.51 4.22 7.09E-04 AT4G08770 PRX37 1.47 5.38 9.62E-03 AT5G07100 WRKY26 1.46 7.88 4.05E-03 AT4G10120...”
- From genes to ecosystems: Decoding plant tolerance mechanisms to arsenic stress
Gracia-Rodriguez, Heliyon 2024 - “...Os04g49900 OsABCC7 ATP-binding cassette Arsenite-PC Oryza sativa Root cells Xylem parenchyma cells [ 48 ] At1g30220 AtINT2 Inositol transporters Arsenite A. thaliana Shoot cells Cell membrane [ 62 ] At4g16480 AtINT4 Os01g0142800 OsPTR7 Peptide transporter Dimethylarsinate Oryza sativa Shoot cells Cell membrane [ 63 ] At5g64410...”
- Genome-wide identification, expression, and association analysis of the monosaccharide transporter (MST) gene family in peanut (Arachis hypogaea L.)
Wan, 3 Biotech 2020 - “...AhMST41 AhMST54 AhMST69 AtSTP11 (AT5G23270) STP12 (AT4G21480) AtINT2 (AT1G30220) AtPMT1 (AT2G16120) Stadler et al. (2003), Sherson et al. (2000, 2010) Aluri and...”
- Identification of Circular RNAs from the Parental Genes Involved in Multiple Aspects of Cellular Metabolism in Barley
Darbani, Frontiers in plant science 2016 - “...Ch2:476367671-476368169 Sec 23/ Sec 24 transport protein_circular RNA Ch2:482080734-482081397/MLOC_37573 AT2G27460 Inositol transporter 2_circular RNA Ch2:483514445-483514888/MLOC_38368 AT1G30220 ARID/BRIGHT DNA-binding domain protein_circular RNA Ch2:532048153-532048410 AT2G17410 Alpha-mannosidase 1_circular RNA Ch2:566491430-566492027/MLOC_75116 AT1G51590 Probable long non-coding RNA_circular RNA Ch2:605441109-605441443 Unknown_circular RNA Ch3:100501939-100502294 Mitogen-activated protein kinase ( Ctr 1-like)_circular RNA Ch3:351423944-351425007/MLOC_56360 AT3G58640...”
- RNA-Seq and Gene Network Analysis Uncover Activation of an ABA-Dependent Signalosome During the Cork Oak Root Response to Drought
Magalhães, Frontiers in plant science 2015 - “...PMT5 polyol/monosaccharide transporter 5 QSDrought_01264 Down AT1G11260 STP1 ATSTP1 STP1 sugar transporter 1 QSDrought_02773 Up AT1G30220 ATINT2 ATINT2 INT2 inositol transporter 2 QSDrought_04922 Up AT5G26340 MSS1 ATSTP13 MSS1 STP13 Major facilitator superfamily protein QSDrought_07023 Down AT1G22710 SUC2 ATSUC2 SUC2 SUT1 sucrose-proton symporter 2 Functional Data Mining...”
- Phylloxera (Daktulosphaira vitifoliae Fitch) alters the carbohydrate metabolism in root galls to allowing the compatible interaction with grapevine (Vitis ssp.) roots
Griesser, Plant science : an international journal of experimental plant biology 2015 - “...GSVIVT01010741001 Inositol transporter VvINT1 (at2g43330) 0.65 0.0004 1.0 0.7 0.8 TC113429 GSVIVT01021530001 Inositol transporter VvINT2 (at1g30220) 0.71 0.0113 0.9 * 1.1 1.5 ** TC104946 GSVIVT01034886001 Sucrose transporter VvSUC27 (at1g22710) n.s. n.s. 0.7 ** 0.9 1.8 TC104917 GSVIVT01009254001 Sucrose transporter VvSUT4/VvSUC11 (at1g09960) 0.74 0.0001 1.8 1.5 2.0...”
- High-level expression of sugar inducible gene2 (HSI2) is a negative regulator of drought stress tolerance in Arabidopsis
Sharma, BMC plant biology 2013 - “...activity GO:0016491 2.54 8.39E-04 FERREDOXIN3 At2g27510 F protein ser/thr phosphatase activity GO:0004722 5.43 6.47E-03 PP2CA2 At1g30220 Repressed by Drought and Up-regulated at Stage 1 ( hsi2 :Col-0) P cellular carbohydrate metabolism GO:0044262 4.24 3.01E-03 Cellulose synthase-like B1 At2g32610 F hydrolase activity GO:0016787 1.86 9.05E-03 Methyl IAA...”
- The Vitis vinifera sugar transporter gene family: phylogenetic overview and macroarray expression profiling
Afoufa-Bastien, BMC plant biology 2010 - “...Accession numbers for Arabidopsis thaliana transporters are: At1g20840 (AtTMT1), At4g35300 (AtTMT2), At3g51490 (AtTMT3), At2g43330 (AtINT1), At1g30220 (AtINT2), At2g35740 (AtINT3), At4g16480 (AtINT4), At3g03090 (AtVGT1), At5g17010 (AtVGT2), At5g59250 (AtVGT3), At2g16120 (AtPMT1), At2g16130 (AtPMT2), At2g18480 (AtPMT3), At2g20780 (AtPMT4), At3g18830 (AtPMT5), At4g36670 (AtPMT6); for Vitis ones see Additional file 1...”
- More
- Analysis of cDNA libraries from developing seeds of guar (Cyamopsis tetragonoloba (L.) Taub)
Naoumkina, BMC plant biology 2007 - “...sugar transporter [Arabidopsis] 2e-079 GUAR_UG_04227 1 0 NP_850835 sugar transporter [Arabidopsis] 1e-056 GUAR_UG_02250 1 0 NP_174313 sugar transporter [Arabidopsis] 4e-049 GUAR_UG_00912 2 0 NP_174313 sugar transporter [Arabidopsis] 7e-015 GUAR_UG_02913 1 0 NP_567083 nucleotide-sugar transporter [Arabidopsis] 8e-072 GUAR_UG_03734 1 0 AAU07980 hexose transporter [Vitis vinifera] 2e-055 GUAR_UG_03820...”
INT3_ARATH / Q9ZQP6 Probable inositol transporter 3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
AT2G35740 INT3 (NOSITOL TRANSPORTER 3); carbohydrate transmembrane transporter/ sugar:hydrogen symporter from Arabidopsis thaliana
27% identity, 90% coverage
- function: Plasma membrane inositol-proton symporter.
- The Arabidopsis altered in stress response2 is Impaired in Resistance to Root and Leaf Necrotrophic Fungal Pathogens
Thatcher, Plants (Basel, Switzerland) 2019 - “...narrowed to four candidate loci. disease susceptibility GSTF8 necrotroph jasmonate At2g31320 At2g31400 At2g31990 At2g33170 At2g35170 At2g35740 At2g36420 At2g36835 At5g53060 CPL1 At4g21670 1. Introduction Crop damage caused by pathogen and pest attack costs the global economy billions of dollars annually, with the Food and Agriculture Organization of...”
- “...Exostosin family protein, At2g33170 a Leucine-rich repeat receptor-like protein, At2g35170 a Histone H3 K4-specific methyltransferase, At2g35740 NOSITOL TRANSPORTER 3 ( ATINT3/INT3 ), At2g36420 TON1 RECRUITING MOTIF 27 ( TRM27 ), and At2g36835 an unknown protein. We undertook the same genetic complementation studies used to clone the...”
- Species-Wide Variation in Shoot Nitrate Concentration, and Genetic Loci Controlling Nitrate, Phosphorus and Potassium Accumulation in Brassica napus L
Alcock, Frontiers in plant science 2018 - “...concentration Bo4g185840.1 AT2G38940 4 10 116 PHOSPHATE TRANSPORTER 1.4 C4 Bo4g182560.1:642:G Leaf P concentration Bo4g184590.1 AT2G35740 6 10 137 INOSITOL TRANSPORTER 3 C4 Bo4g182560.1:642:G Leaf P concentration Bo8g108330.1 AT1G12240 0.0 BFRUCT4; plays a role in mobilizing sucrose to sink organs and in root elongation C8 Bo8g108620.1:687:A...”
- The paralogous R3 MYB proteins CAPRICE, TRIPTYCHON and ENHANCER OF TRY AND CPC1 play pleiotropic and partly non-redundant roles in the phosphate starvation response of Arabidopsis roots
Chen, Journal of experimental botany 2015 - “...controlled by CPC, ETC1 and TRY Antisense gene Overlaps with Description Fold-change etc1 Pi-replete At2g35738 At2g35740 INOSITOL TRANSPORTER 3 (INT3) 0.52 etc1 low Pi At1g74205 At1g74210 GLYCEROPHOSPHODIESTER PHOSPHODIESTERASE 5 (GDPD5) 1.69 At4g26795 At4g26790 GDSL-like lipase/acylhydrolase superfamily protein 2.18 At1g60505 At1g60510 DYNAMIN RELATED PROTEIN 4D (DRP4D) 1.90...”
- “...cpc Pi-replete At1g72852 At1g72850 Disease resistance protein 0.42 At1g67365 At1g67370 ASYNAPTIC 1 (ASY1) 0.33 At2g35738 At2g35740 INOSITOL TRANSPORTER 3 (INT3) 0.35 At5g07152 At5g07150 Leucine-rich repeat protein kinase family protein 2.42 cpc low Pi At4g27852 At4g27850; At4g27860 Glycine-rich protein family; MEMBRANE OF ER BODY 1 (MEB1) 0.35...”
- Sucrose phosphate synthase and sucrose phosphate phosphatase interact in planta and promote plant growth and biomass accumulation
Maloney, Journal of experimental botany 2015 - “...tagged with hRLUC in N- and C-terminal orientations (SPS R and R SPS), and AtSPP (At2g35740) was tagged with YFP at the C-terminus (SPP Y ). The Arabidopsis ubiqutin5 gene was used as an internal control, and results are given as relative transgene transcript abundance. AtSPPSPS...”
- The Vitis vinifera sugar transporter gene family: phylogenetic overview and macroarray expression profiling
Afoufa-Bastien, BMC plant biology 2010 - “...for Arabidopsis thaliana transporters are: At1g20840 (AtTMT1), At4g35300 (AtTMT2), At3g51490 (AtTMT3), At2g43330 (AtINT1), At1g30220 (AtINT2), At2g35740 (AtINT3), At4g16480 (AtINT4), At3g03090 (AtVGT1), At5g17010 (AtVGT2), At5g59250 (AtVGT3), At2g16120 (AtPMT1), At2g16130 (AtPMT2), At2g18480 (AtPMT3), At2g20780 (AtPMT4), At3g18830 (AtPMT5), At4g36670 (AtPMT6); for Vitis ones see Additional file 1 . Vitis...”
- Localization of myo-inositol-1-phosphate synthase to the endosperm in developing seeds of Arabidopsis
Mitsuhashi, Journal of experimental botany 2008 - “...3 kinase. The following primer sets were used for RT-PCR, AtITR1 (At4g16480) 5-GCATGTCTTATCATCTTAGCCACG-3, 5-GCCCCAAAAACACTATAGCTAAGA-3, AtITR2 (At2g35740) 5-ACTTGCCTTGTCATTTTGGCT-3 and 5-AAGGAAGACAATGGCCAGGT-3, AtITR3 (At2g43330) 5-GATAGTCCAAATGGCTGGATTTC-3 and 5-CTAAGCCAAGCACAGCGAG-3, AtITR4 (At1g30220) 5-CATTATCTCGCTAGGAATACTAACCG-3 and 5-GTCCCAATCCAAGAAGAGCA-3, PPK1 (At5g16760) 5-TCGAACACTCAAGGCAACGA-3 and 5-TCCGGGACACCAAATCTCTC-3, PPK2 (At4g08170) 5-CCGGAGGCTGTCAATAATGC-3 and 5-CACAAGAGACCCGTGGGAAG-3, PPK3 (At4g33770) 5-GCAGACTTGGACCCTCGTGT-3 and 5-TTTGACCTGCGCCAGATTTT-3, AtIPK2 (At5g07370)...”
INT4_ARATH / O23492 Inositol transporter 4; Myo-inositol-proton symporter INT4; Protein INOSITOL TRANSPORTER 4 from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
TC 2.A.1.1.62 / O23492 High affinity (0.24mM) plasma membrane myoinositol-specific H+ symporter, INT4 from Arabidopsis thaliana (Mouse-ear cress) (see 5 papers)
INT4 / RF|NP_193381.1 inositol transporter 4 from Arabidopsis thaliana (see paper)
NP_001328028 inositol transporter 4 from Arabidopsis thaliana
AT4G16480 INT4 (INOSITOL TRANSPORTER 4); carbohydrate transmembrane transporter/ myo-inositol:hydrogen symporter/ sugar:hydrogen symporter from Arabidopsis thaliana
25% identity, 89% coverage
- function: Plasma membrane inositol-proton symporter. Mediates high- affinity myoinositol-proton symport across the plasma membrane. Active with myoinositol, scylloinositol and D-chiroinositol. Low activity with mucoinositol and alloinositol.
- substrates: myo-inositol
- Routes to the tonoplast: the sorting of tonoplast transporters in Arabidopsis mesophyll protoplasts.
Wolfenstetter, The Plant cell 2012 - GeneRIF: C-terminal di-leucine motif in INT1 can reroute other proteins, such as INT4, SUCROSE TRANSPORTER2 (SUC2), or SWEET1, to the tonoplast.
- From genes to ecosystems: Decoding plant tolerance mechanisms to arsenic stress
Gracia-Rodriguez, Heliyon 2024 - “...] At1g30220 AtINT2 Inositol transporters Arsenite A. thaliana Shoot cells Cell membrane [ 62 ] At4g16480 AtINT4 Os01g0142800 OsPTR7 Peptide transporter Dimethylarsinate Oryza sativa Shoot cells Cell membrane [ 63 ] At5g64410 PvOCT4 Cation transporter Arsenite Pteris vittata Vesicle membrane [ 57 ] Another type of...”
- Phylogenetic relationships of sucrose transporters (SUTs) in plants and genome-wide characterization of SUT genes in Orchidaceae reveal roles in floral organ development
Wang, PeerJ 2021 - “...), and P. equestris ( Peq ). (A) Phylogenetic tree of the SUT proteins using AT4G16480 as outgroup; (B) schematic presentation of the conserved motifs in Orchidaceae SUTs; (C) sequence logos of all the 10 motifs. In addition, motif 10 was observed in 17 SUT proteins...”
- Genome-wide identification, expression, and association analysis of the monosaccharide transporter (MST) gene family in peanut (Arachis hypogaea L.)
Wan, 3 Biotech 2020 - “...AhMST13 AhMST9 AtVGT1 (AT3G03090) STP12 (AT4G21480) AtINT4 (AT4G16480) Uptake of extracellular sugars by the embryo and in seedlings Influences flowering and...”
- “...pollen and young xylem cells AtINT4 (AT4G16480) Regulate arsenic accumulation AhMST76 AhMST43 AhMST57 PGLCT (AT5G16150) Affecting chloroplast AtPLT6/AtPMT6...”
- High expression in maize pollen correlates with genetic contributions to pollen fitness as well as with coordinated transcription from neighboring transposable elements
Warman, PLoS genetics 2020 - “...syntelog tdsgR35A03 51.10% 7.46E-01 AT1G19360 Arabinosyltransferase RRA3 Sperm Cell GRMZM2G160069 Zm00001d025834 singleton tdsgR31B01 47.96% 7.46E-01 AT4G16480 Inositol transporter 4 Sperm Cell GRMZM2G114899 Zm00001d034788 syntelog tdsgR91F11 49.24% 7.46E-01 AT1G77280 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain Sperm Cell GRMZM2G007659 Zm00001d042810 syntelog tdsgR26G07 51.03% 7.46E-01 AT2G29680...”
- Species-Wide Variation in Shoot Nitrate Concentration, and Genetic Loci Controlling Nitrate, Phosphorus and Potassium Accumulation in Brassica napus L
Alcock, Frontiers in plant science 2018 - “...3 - concentration Bo9g147000.1 AT5G60770 0.0 NITRATE TRANSPORTER 2.4 C9 Bo9g143680.1:1029:T Leaf P concentration Cab013031.3 AT4G16480 2 10 297 INOSITOL TRANSPORTER 4 A1 Cab013058.2:573:G Leaf P concentration Cab012953.1 AT4G17230 7 10 252 SCARECROW-LIKE 13; required for the regulation of hypocotyl elongation A1 Cab013058.2:573:G Leaf P concentration...”
- Evidence for an unusual transmembrane configuration of AGG3, a class C Gγ subunit of Arabidopsis
Wolfenstetter, The Plant journal : for cell and molecular biology 2015 - “...al. 2012 ). As a PM marker for co-localization studies the myo -inositol transporter AtINT4 (At4g16480) carrying a C-terminal RFP fusion was used ( Wolfenstetter et al. 2012 ). Mesophyll protoplast transformation Protoplasts from Arabidopsis Col-0 WT plants and gpa1-4/agb1-2 mutants were generated as described (...”
- Transcriptional profiling analysis in Populus yunnanensis provides insights into molecular mechanisms of sexual differences in salinity tolerance
Jiang, Journal of experimental botany 2012 - “...molecular function unknown 3.85 3.27 gw1.VII.1749.1 AT4G39970 T5J17.140; catalytic activity, hydrolase activity 2.3 1.25 estExt_fgenesh4_pm.C_LG_VI0047 AT4G16480 INT4; carbohydrate transmembrane transporter activity, myo-inositol:hydrogen symporter activity, sugar:hydrogen symporter activity 1.01 1.08 estExt_fgenesh4_pg.C_LG_VIII0748 AT2G02990 RNS1; endoribonuclease activity, ribonuclease activity 1.4 3.75 e_gw1.XVIII.760.1 AT5G11700 T22P22.90; similar to glycine-rich protein, putative...”
- The Vitis vinifera sugar transporter gene family: phylogenetic overview and macroarray expression profiling
Afoufa-Bastien, BMC plant biology 2010 - “...thaliana transporters are: At1g20840 (AtTMT1), At4g35300 (AtTMT2), At3g51490 (AtTMT3), At2g43330 (AtINT1), At1g30220 (AtINT2), At2g35740 (AtINT3), At4g16480 (AtINT4), At3g03090 (AtVGT1), At5g17010 (AtVGT2), At5g59250 (AtVGT3), At2g16120 (AtPMT1), At2g16130 (AtPMT2), At2g18480 (AtPMT3), At2g20780 (AtPMT4), At3g18830 (AtPMT5), At4g36670 (AtPMT6); for Vitis ones see Additional file 1 . Vitis ORFs names...”
- More
ETAE_2966 sugar transporter from Edwardsiella tarda EIB202
31% identity, 57% coverage
Bm5053 Uncharacterized protein from Brugia malayi
24% identity, 90% coverage
- Profiling the macrofilaricidal effects of flubendazole on adult female Brugia malayi using RNAseq
O'Neill, International journal for parasitology. Drugs and drug resistance 2016 - “...with only 5 overlapping genes, including an uncharacterized protein (Bm982), clec-1 (Bm3563), a sugar transporter (Bm5053), oxidoreductase (Bm2014) and snf-11 (Bm5517). At 48h, eight genes overlapped between the two concentrations: an uncharacterized protein (Bm8094), two ground-like domain containing proteins (Bm3090, Bm14305), clec-1 (Bm3563), snpn-1 (Bm1903), membrane-anchored...”
MYCT_RAT / Q921A2 Proton myo-inositol cotransporter; H(+)-myo-inositol cotransporter; Hmit; H(+)-myo-inositol symporter; Solute carrier family 2 member 13 from Rattus norvegicus (Rat) (see paper)
NP_598295 proton myo-inositol cotransporter from Rattus norvegicus
26% identity, 84% coverage
MYCT_HUMAN / Q96QE2 Proton myo-inositol cotransporter; H(+)-myo-inositol cotransporter; Hmit; H(+)-myo-inositol symporter; Solute carrier family 2 member 13 from Homo sapiens (Human) (see 2 papers)
TC 2.A.1.1.25 / Q96QE2 Myoinositol:H+ symporter, HMIT (also transport other inositols including scyllo-, muco- and chiro-, but not allo-inositol) (Aouameur et al., 2007). Expressed in the Golgi of the hippocampus and cortex. May also transport inositoltriphosphate (Di Daniel et al., 2009). Interacts directly with γ-secretase (9.B.47.1.1) to regulate its activity and the production of Abeta production, important in Alzheimer's disease from Homo sapiens (Human) (see 4 papers)
26% identity, 82% coverage
- function: H(+)-myo-inositol cotransporter (PubMed:11500374). Can also transport related stereoisomers (PubMed:11500374).
catalytic activity: myo-inositol(out) + H(+)(out) = myo-inositol(in) + H(+)(in) (RHEA:60364) - substrates: H+, Inositol, Myoinositol
- Raphe and ventrolateral medulla proteomics in sudden unexplained death in childhood with febrile seizure history
Leitner, Acta neuropathologica 2024 - “...kinase 4 O95819 3.74E03 1.9 ANXA7 Annexin A7 P20073 3.77E03 1.3 SLC2A13 Proton myo-inositol cotransporter Q96QE2 3.97E03 24.9 CLASP1 CLIP-associating protein 1 Q7Z460 4.39E03 1.6 MAPT Microtubule-associated protein tau P10636 4.45E03 1.5 TXN Thioredoxin P10599 4.56E03 1.6 LSAMP Limbic system-associated membrane protein Q13449 5.04E03 1.6 ISYNA1...”
- Do mitochondria use efflux pumps to protect their ribosomes from antibiotics?
Islam, Microbiology (Reading, England) 2023 - “...O15439, 3.6E^213 [ 73 ] HXT2 High-affinity glucose transporter MFS|| KGR01337.1, 0** P23586, 1 .9E^54 Q96QE2, 6.5E^41 [ 40, 73 ] JEN1 Carboxylic acid transporter protein homologue MFS KGU09375.1, 9E^121** Q9SYQ1, 0.00014 A0A286YF51, 0.0019 [ 73 ] TPO1 Polyamine transporter 1 MFS G1UAY0, 1.9E^141# Q56ZZ7, 0.00017...”
- “...2.3E^6 Q56ZZ7, 2.3E^7 Q8NBP5, 8.4E^9 [ 78 ] NCU10021 Q7S0I5 MFS Q8J2J7, 8.1E^102 Q9FMX3, 2.3E^55 Q96QE2, 2.8E^41 [ 78 ] *Information gathered from NCBI Protein BLAST, algorithm: PSI-BLAST ( https://www.ncbi.nlm.nih.gov/ ) and HMMER phmmer, Database: Reference Proteomes ( http://hmmer.org/ ) . The accession code from UniprotKB...”
- Detection of N‑glycoprotein associated with IgA nephropathy in urine as a potential diagnostic biomarker using glycosylated proteomic analysis.
Liu, Experimental and therapeutic medicine 2023 - “...5 0 0 0 O00712 NFIB 2.869x10 5 7.288x10 5 6.267x10 5 0 0 0 Q96QE2 SLC2A13 2.868x10 5 1.313x10 5 2.685x10 5 0 0 0 Q6ZQN7 SLCO4C1 4.135x10 5 1.348x10 5 2.590x10 5 0 0 0 Q6UY50 UNQ172 6.541x10 5 2.338x10 5 6.071x10 5 0...”
- Insights into Substrate and Inhibitor Selectivity among Human GLUT Transporters through Comparative Modeling and Molecular Docking
Ferreira, ACS omega 2019 - “...Q9UGQ3; GLUT7: Q6PXP3; GLUT8: Q9NY64; GLUT9: Q9NRM0; GLUT10: O95528; GLUT11: Q9BYW1; GLUT12: Q8TD20; GLUT13 (MYCT): Q96QE2; GLUT14: Q8TDB8). Sequence alignment was manually checked in ViTO, 39 taking into account secondary structure prediction by the PSIPRED server. 47 Models were then built based on templates PDB 4ZW9...”
- “...Q9NRM0 for human GLUT9, O95528 for GLUT10, Q9BYW1 for human GLUT11, Q8TD20 for GLUT12, and Q96QE2 for human GLUT13. The sequences obtained were then aligned with Clustal Omega and the resulting file was visualized and analyzed with Jalview, to determine conservation and occupancy of specific residues...”
- Proteomics-based insights into mitogen-activated protein kinase inhibitor resistance of cerebral melanoma metastases
Zila, Clinical proteomics 2018 - “...magnesium transporter 1 MMGT1 1.19 3.22E02 Q8TBB6 Probable cationic amino acid transporter SLC7A14 1.78 6.86E03 Q96QE2 Proton myo-inositol cotransporter SLC2A13 2.68 1.94E06 * Q99726 Zinc transporter 3 SLC30A3 2.03 2.95E02 Q9H1V8 Sodium-dependent neutral amino acid transporter SLC6A17 SLC6A17 2.51 1.39E02 Q9NS82 Asc-type amino acid transporter 1...”
- THE CONCISE GUIDE TO PHARMACOLOGY 2017/18: Transporters
Alexander, British journal of pharmacology 2017 - “...B [ 537 ]. Nomenclature Proton myoinositol cotransporter Systematic nomenclature SLC2A13 HGNC, UniProt SLC2A13 , Q96QE2 Common abreviation HMIT Substrates Dchiroinositol [ 555 ], myoinositol [ 537 ], scylloinositol [ 555 ], mucoinositol [ 537 ] Stoichiometry 1 H + : 1 inositol (in) [ 129...”
- Identification of prostate cancer biomarkers in urinary exosomes
Øverbye, Oncotarget 2015 - “...3.08 91 14 Q9NVJ2 ADP-ribosylation factor-like protein 8B 13 15 63% 10 2.79 49 15 Q96QE2 Proton myo-inositol cotransporter 2 11 63% 10 2.66 100 16 P20340 Ras-related protein Rab-6A 10 16 63% 10 3.36 240 17 O43657 Tetraspanin-6 9 16 63% 10 4.03 3067 18...”
- The Concise Guide to PHARMACOLOGY 2015/16: Transporters
Alexander, British journal of pharmacology 2015 - “...]. Nomenclature Proton myoinositol cotransporter Systematic nomenclature SLC2A13 Common abreviation HMIT HGNC, UniProt SLC2A13 , Q96QE2 Substrates Dchiroinositol [ 487 ], myoinositol [ 487 ], scylloinositol [ 487 ], mucoinositol [ 487 ] Stoichiometry 1 H + : 1 inositol (in) [ 118 ] Further Reading...”
- More
HAH_5129 sugar porter family MFS transporter from Haloarcula hispanica ATCC 33960
35% identity, 55% coverage
- A conserved transcription factor controls gluconeogenesis via distinct targets in hypersaline-adapted archaea with diverse metabolic capabilities
Hackley, PLoS genetics 2024 - “...4 * 92.46 yes promoter HAH_4332 gdh glucose dehydrogenase 5 * 85.71 5.96 yes promoter HAH_5129 4.72 sugar porter family MFS transporter 6 * 49.84 4.46 yes promoter promoter HAH_1365 HAH_1366 porA flavodoxin reductase family I pyruvate:ferredoxin oxidoreductase 7 * 47.56 yes promoter HAH_0887 cysK -1.36...”
- “...5 , hypergeometric test). Notably, the second largest peak is located in the promoter of HAH_5129, a sugar major facilitator superfamily (MFS) transporter (PF00083, e-value < 3.0 10 123 ), highlighting this gene as a candidate for the primary glucose transporter in Har. hispanica . Computational...”
LOC4349512 D-xylose-proton symporter-like 2 from Oryza sativa Japonica Group
35% identity, 50% coverage
NP_001028805 proton myo-inositol cotransporter from Mus musculus
Q3UHK1 Proton myo-inositol cotransporter from Mus musculus
26% identity, 84% coverage
- Proton myo-inositol cotransporter is a novel γ-secretase associated protein that regulates Aβ production without affecting Notch cleavage.
Teranishi, The FEBS journal 2015 (PubMed)- GeneRIF: SLC2A13 is a novel gamma-secretase associated protein that regulates amyloid beta production without affecting Notch cleavage.
- Contributions in astrocytes of SMIT1/2 and HMIT to myo-inositol uptake at different concentrations and pH.
Fu, Neurochemistry international 2012 (PubMed)- GeneRIF: astrocytes obtained directly from the brain express HMIT and is expressed in neurons
- Evaluation of expression and function of the H+/myo-inositol transporter HMIT.
Di, BMC cell biology 2009 - GeneRIF: Inositol transport and homeostasis were unaffected in H+/myo-inositol transporter targeted null-mutant mice.
- Pyridazine-derivatives Enhance Structural and Functional Plasticity of Tripartite Synapse Via Activation of Local Translation in Astrocytic Processes.
Foster, Neuroscience 2018 - “...3.485 F8WHB1 Calcium-transporting ATPase, PMCA2 1.75 2.31 2.550 A2ALL9 Calcium-transporting ATPase, PMCA3 1.90 2.28 2.155 Q3UHK1 Proton myo-inositol cotransporter 1.67 2.09 2.582 E9Q828 Calcium-transporting ATPase, PMCA4 1.75 1.92 2.708 Protein Folding/Chaperone Q542X7 Chaperonin containing Tcp1, subunit 2 (beta) 1.84 5.79 2.481 P38647 Stress-70 protein, mitochondrial 3.52...”
- The proteome of mouse cerebral arteries
Badhwar, Journal of cerebral blood flow and metabolism : official journal of the International Society of Cerebral Blood Flow and Metabolism 2014 (secret)
Q9LLE0 Hexose transporter (Fragment) from Solanum tuberosum
34% identity, 54% coverage
- Comparative Membrane-Associated Proteomics of Three Different Immune Reactions in Potato
Burra, International journal of molecular sciences 2018 - “...Q43775 Glycolate oxidase (EC 1.1.3.15) 1.01 0.18 0.67 PGSC0003DMP400009092 Glyoxisomal malate dehydrogenase 1.65 1.01 1.34 Q9LLE0 Hexose transporter 0.7 0.15 0.24 PGSC0003DMP400035078 Hydrolase, acting on ester bonds 1.91 2.36 2.58 B2D2G3 Hydroxypyruvate reductase (EC 1.1.1.81) 1.25 0.55 0.88 B9JNE9 Insertion sequence transposase protein 2.02 2.43 2.78...”
C5965_09300 sugar porter family MFS transporter from Cronobacter sakazakii
31% identity, 57% coverage
ITR2_YEAST / P30606 Myo-inositol transporter 2 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 3 papers)
TC 2.A.1.1.104 / P30606 Myo-inositol transporter 2 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (see 7 papers)
HRB612 myo-inositol transporter ITR2 from Saccharomyces cerevisiae S288C
YOL103W Itr2p from Saccharomyces cerevisiae
28% identity, 52% coverage
- function: Minor transporter for myo-inositol.
catalytic activity: myo-inositol(out) + H(+)(out) = myo-inositol(in) + H(+)(in) (RHEA:60364) - substrates: myo-inositol
- Major facilitator superfamily
Pao, Microbiology and molecular biology reviews : MMBR 1998 - “...P43581 P40885 P39924 P42833 P47185 Z71687 P30605 X98622 P30606 S51081 P07921 P38156 P15685 P18631 X96876 Q10710 P38142 S58778 U32274 P43562 Z72626 P40441 P47186...”
- Metabolism and regulation of glycerolipids in the yeast Saccharomyces cerevisiae
Henry, Genetics 2012 - “...None ITR1 a Opi Inositol transporter 63.5 6.51 ND Plasma membrane 12 Several ITR2 ( HRB612 ) Inositol transporter 66.7 8.25 468 Plasma membrane 12 None HNM1 ( CTR1 ) a Choline transporter 62 6.83 ND Plasma membrane 12 Few GIT1 GroPIns/GroPCho transporter 57.3 8.64 ND...”
- Yeast Double Transporter Gene Deletion Library for Identification of Xenobiotic Carriers in Low or High Throughput
Almeida, mBio 2021 - “...YMR243C, YMR279C, YMR319C, YNL065W, YNL142W, YNL268W, YNL270C, YNL275W, YNL291C, YNL318C, YNR002C, YNR055C, YNR056C, YNR072W, YOL020W, YOL103W, YOL122C, YOL158C, YOR011W, YOR071C, YOR153W, YOR192C, YOR202W, YOR273C, YOR306C, YOR328W, YOR348C, YPL036W, YPL058C, YPL092W, YPL265W, YPL274W, YPR124W, YPR138C, YPR156C, YPR192W, YPR198W, and YPR201W ( 54 ). In the Y7092 background,...”
- Involvement of FST1 from Fusarium verticillioides in virulence and transport of inositol
Niu, Molecular plant pathology 2017 (secret) - Identification of Genes in Candida glabrata Conferring Altered Responses to Caspofungin, a Cell Wall Synthesis Inhibitor
Rosenwald, G3 (Bethesda, Md.) 2016 - “...transporter CAGL0E03311g YGR163w GTR2 Putative GTP binding protein that negatively regulates Ran/Tc4 GTPase cycle CAGL0I07447g YOL103w ITR2 Myo-inositol transporter CAGL0J07436g YNL231c PDR16 PITP controlled by the multiple drug resistance regulator Pdr1 CAGL0H04213g YML081W TDA1 Protein kinase with unknown role; localizes to cytosol and nucleus CAGL0J09966g YNL064c...”
- Using Gene Essentiality and Synthetic Lethality Information to Correct Yeast and CHO Cell Genome-Scale Models
Chowdhury, Metabolites 2015 - “...by 15 precursor molecules in appropriate biological ratios in Yeast 7.11. The in silico YDR497C YOL103W ( itr1 itr2 ) double deletion strain cannot uptake myo-inositol thereby showing decrease in vegetative growth in corroboration with in vivo studies [ 77 ]. YJL153C ( ino1 ) cannot...”
- “.... Figure 10 Lipid metabolism disrupted due deletion of synthetic lethal gene triplet. YDR497C and YOL103W are isozymes coding for the protein catalyzing the myo-inositol transport into the cytosol from media. Reactions catalyzed by SL gene triplet are marked with red crosses. The essentiality and synthetic...”
- AVID: an integrative framework for discovering functional relationships among proteins
Jiang, BMC bioinformatics 2005 - “...also see, however, that YOL137W is predicted to share functional similarity with other proteins, e.g. YOL103W (GO:0005365, "myo-inositol transporter activity"), also on the basis of sequence similarity and mRNA co-expression. This demonstrates how examining AVID network relationships can provide a broader picture than the stage 4-assigned...”
- A novel design of whole-genome microarray probes for Saccharomyces cerevisiae which minimizes cross-hybridization
Talla, BMC genomics 2003 - “...YNL143c (flip ratios at the tested spots range from -2.1 to -1.2) but not for YOL103w , YDR497c , YGR086c , YJR148w and YLR058c (flip ratios at the tested spots range from -50 to -9). Note that, with the exception of YGR148c (missing spot of the...”
- “...YLR109w , YML072c , YML113w , YMR011w , YMR169c , YMR170c , YNL143c , and YOL103w . The correct replacement of the target gene by the KANMX4 cassette in each deletion strain was confirmed by PCR amplification. All the deletant strains have normal growth phenotype. mRNA...”
EcolC_0874 sugar transporter from Escherichia coli C str. ATCC 8739
33% identity, 56% coverage
- New xylose transporters support the simultaneous consumption of glucose and xylose in <i>Escherichia coli</i>
Zhu, mLife 2022 - “...ATG (full length of 2574bp) Mutations in strain AE2.0 EcolC_0872 kduI Hexanoate isomerase G93C (G277T) EcolC_0874 araE Arabinoseproton symporter D223Y (G667T) EcolC_0878 galR Transcriptional regulator 72 bp/coding (2394/1032 nt) EcolC_3593 araC Transcriptional regulator, AraC family L156I (C466A) PTS, phosphotransferase system. John Wiley & Sons, Ltd. Characterization...”
- “...Product Relative expression level in AE2.0 versus PS2.0 Relative expression level in REV2.0 versus PS2.0 EcolC_0874 araE Arabinoseproton symporter 58 42 EcolC_1734 araF Larabinosebinding periplasmic protein 2.3 2 EcolC_1735 araG Arabinose import ATPbinding protein 9 4.8 EcolC_1736 araH Arabinose ABC transporter permease 3.9 3.5 EcolC_3593 araC...”
S3049 low-affinity L-arabinose transport system proton symport protein from Shigella flexneri 2a str. 2457T
33% identity, 56% coverage
AraE / b2841 arabinose:H+ symporter from Escherichia coli K-12 substr. MG1655 (see 5 papers)
araE / P0AE24 arabinose:H+ symporter from Escherichia coli (strain K12) (see 5 papers)
ARAE_ECOLI / P0AE24 Arabinose-proton symporter; Arabinose transporter from Escherichia coli (strain K12) (see 4 papers)
TC 2.A.1.1.2 / P0AE24 Arabinose (xylose; galactose):H+ symporter, AraE (low affinity high capacity) from Escherichia coli (see 6 papers)
b2841 arabinose transporter from Escherichia coli str. K-12 substr. MG1655
33% identity, 56% coverage
- function: Uptake of L-arabinose across the cytoplasmic membrane with the concomitant transport of protons into the cell (symport system) (PubMed:2836407, PubMed:6282256, PubMed:7030324). D-fucose, a nonmetabolizable analog of L-arabinose, is also a good substrate (PubMed:6282256).
catalytic activity: L-arabinose(in) + H(+)(in) = L-arabinose(out) + H(+)(out) (RHEA:28951)
catalytic activity: D-fucose(in) + H(+)(in) = D-fucose(out) + H(+)(out) (RHEA:35011) - substrates: Arabinose, D-galactose, D-xylose, L-arabinose
- Co-translational protein aggregation and ribosome stalling as a broad-spectrum antibacterial mechanism
Khodaparast, Nature communications 2025 (no snippet) - Contribution of Stenotrophomonas maltophilia MfsC transporter to protection against diamide and the regulation of its expression by the diamide responsive repressor DitR
Boonyakanog, PloS one 2022 - “...(B2FTN0), Mmr (P11545), Pur8 (P42670), QacA (Q1XG09), QacB (Q7WUJ5), SmvA (P37594), VceB (O51919). DHA12; AraE (P0AE24), Bcr (P28246), Blt (P39843), Bmr (P33449), CmlA (Q83V15), EmrD (P31442), EmrD-3 (C3LUT7), GalP (P0AEP1), LacY (P02920), LmrP (Q48658), MdfA (P0AEY8), MdtG (P25744), MhpT (P77589), NorA (P0A0J7), TetA (P02981), XylE (P0AGF4),...”
- Proton-coupled sugar transport in the prototypical major facilitator superfamily protein XylE
Wisedchaisri, Nature communications 2014 - “...+ symporter XylT (O52733); Escherichia coli galactose permease GalP (P0AEP1); Escherichia coli arabinose permease AraE (P0AE24); Bacillus subtilis myo-inositol/H + transporter IolT (O34718); Arabidopsis thaliana inositol/H + symporter INT1 (Q8VZR6); Arabidopsis thaliana hexose/H + symporter STP1 (P23586); Parachlorella kessleri hexose/H + symporter HUP1 (P15686); Homo sapiens...”
- CyuR is a dual regulator for L-cysteine dependent antimicrobial resistance in Escherichia coli
Rodionova, Communications biology 2024 - “...- 2.4 17 raiA b2597 Ribosome-associated inhibitor A 89 4.89 GAcaAAATTaTgAgAtTTTcaTC 2.2 4.0 18 araE b2841 Arabinose symporter 5 4.7 GAAaAAATgGTTACtATcaATaC - 1.6 19 yhiJ b3488 DUF4049 protein 49 4.97 GAtaAAATgtTAACtATgTATTC - 3.4 20 aldB b3588 Aldehyde dehydrogenase 199 5.61 GAAgAAATTGTgGCgATTTATCg 1.2 - 21 pfkA b3916...”
- The asymptomatic bacteriuria Escherichia coli strain 83972 outcompetes uropathogenic E. coli strains in human urine
Roos, Infection and immunity 2006 - “...b0063 c3624 b1498 b0593 b1616 b2737 c1599 b2841 b2736 c3623 b4451 c1250 b2704 c4310 Hypothetical protein Putative glucosyltransferase Ferric enterobactin...”
DR76_1762 arabinose-proton symporter AraE from Escherichia coli ATCC 25922
34% identity, 53% coverage
- Chemogenomic Screen for Imipenem Resistance in Gram-Negative Bacteria
El, mSystems 2019 - “...Rnf DR76_3209 (2) DR88_4075 (2) rnfC G COG2814 Predicted arabinose efflux permease DR76_1590 (2) nanT DR76_1762 (2) DR76_4561 (2) araJ DR88_690 (3) J COG0445 tRNA U34 5-carboxymethylaminomethy modifying enzyme MnmG/GidA DR76_727 (4) DR88_3339 (2) gidA COG0215 Cysteinyl-tRNA synthetase DR76_4436 (2) DR88_4524 (3) cysS L COG0847 DNA...”
XYLT_LEVBR / O52733 D-xylose transporter; D-xylose-proton symporter from Levilactobacillus brevis (Lactobacillus brevis) (see paper)
TC 2.A.1.1.41 / O52733 The D-xylose:H+ symporter, XylT (Km=220 μM; inhibited competitively by 6-deoxyglucose (Ki=220 μM), but not by other sugars tested) from Lactobacillus brevis
34% identity, 52% coverage
- function: Uptake of D-xylose across the boundary membrane with the concomitant transport of protons into the cell (symport system). Transport is driven by the proton motive force generated by either malolactic fermentation or by the metabolism of D-glucose.
- substrates: Xylose
- Proton-coupled sugar transport in the prototypical major facilitator superfamily protein XylE.
Wisedchaisri, Nature communications 2014 - “...accession number in parentheses: Escherichia coli XylE (P0AGF4); Lactobacillus brevis D -xylose/H + symporter XylT (O52733); Escherichia coli galactose permease GalP (P0AEP1); Escherichia coli arabinose permease AraE (P0AE24); Bacillus subtilis myo-inositol/H + transporter IolT (O34718); Arabidopsis thaliana inositol/H + symporter INT1 (Q8VZR6); Arabidopsis thaliana hexose/H +...”
ARAE_KLEOX / P45598 Arabinose-proton symporter; Arabinose transporter from Klebsiella oxytoca (see paper)
34% identity, 53% coverage
- function: Uptake of L-arabinose across the cytoplasmic membrane with the concomitant transport of protons into the cell (symport system) (PubMed:7665532). D-fucose, a nonmetabolizable analog of L-arabinose, is also a good substrate (PubMed:7665532).
catalytic activity: L-arabinose(in) + H(+)(in) = L-arabinose(out) + H(+)(out) (RHEA:28951)
catalytic activity: D-fucose(in) + H(+)(in) = D-fucose(out) + H(+)(out) (RHEA:35011) - Major facilitator superfamily
Pao, Microbiology and molecular biology reviews : MMBR 1998 - “...468 469 290 491 220 482 419 388 439 451 P09830 P45598 P37021 P21906 P15729 U29579 X86780 P09098 P31578 P54723 U66480 P46333 P42417 P37514 SP SP SP SP SP GB GB...”
- Cloning, functional analysis, and transcriptional regulation of the Bacillus subtilis araE gene involved in L-arabinose utilization
Sá-Nogueira, Journal of bacteriology 1997 - “...E. coli (E.c.), P09830; AraE from K. oxytoca (K.o.), P45598; GalP from E. coli, P37021; XylE from E. coli, P09098; GlcP from Synechocystis sp. (S.sp.), P15729;...”
Q64L87 Xylhp from Debaryomyces fabryi
29% identity, 54% coverage
- Advances in fungal sugar transporters: unlocking the potential of second-generation bioethanol production
Pereira, Applied microbiology and biotechnology 2025 - “...C. intermedia Leandro et al. ( 2006 ); Young et al. ( 2011 ) XylHP Q64L87 Glucose, xylose, galactose, fructose, and mannose D. hansenii Young et al. ( 2011 ) XUT1 A3LY10 Glucose, xylose, D-arabinose, L-arabinose, galactose, fructose, and mannose S. stipitis Young et al. (...”
- Machine learning and comparative genomics approaches for the discovery of xylose transporters in yeast
Fiamenghi, Biotechnology for biofuels and bioproducts 2022 - “...sequence alignment followed by comparison with the InterproScan results for Debaryomyces fabryi Xylhp (Uniprot accession Q64L87). Another interesting feature was GFV tripeptides, which are located on transmembrane portions of the transporters, but their direct relation to xylose transport is unclear. Nonetheless, all predicted transporters had this...”
- “...aligning the xylose transporters and using the sequence of Xylhp from Debaryomyces fabryi (Uniprot accession Q64L87) to predict domains and important sites through Interproscan; then, the non-cytoplasmic domains and probable sugar binding sites were isolated from the alignment and the HMM profile was created. We assumed...”
- Functional survey for heterologous sugar transport proteins, using Saccharomyces cerevisiae as a host
Young, Applied and environmental microbiology 2011 - “...or reference YOUNG ET AL. Y. lipolytica A3LY10 Q64L87 xylHP XUT1 B5RUJ3 DEHA2F19140 S. stipitis B5RSN0 DEHA2A14300 P0AGF4 Q6BW54 DEHA2B14278 xylE Q6BTD8 Q2MEV7...”
MED152_09090 sugar porter family MFS transporter from Polaribacter sp. MED152
27% identity, 88% coverage
- Growth-stage-related shifts in diatom endometabolome composition set the stage for bacterial heterotrophy
Olofsson, ISME communications 2022 - “...Sugar transporter (glucose/galactose) PUL5 MED152_08460 Alginate lyase MED152_06195 DNA-binding response regulator PUL5 MED152_08465 Sugar transporter MED152_09090 Histidine kinase PUL5 MED152_08470 Polysaccharide transporter MED152_03130 SusC/RagA family TonB-linked outer membrane protein PUL5 MED152_08475 Glyceraldehyde-3-P dehydrogenase MED152_13444 SusD/RagB family nutrient binding outer membrane lipoprotein PUL5 MED152_08480 Glucosamine-6-phosphate deaminase PUL5...”
DB43_AL00090 sugar porter family MFS transporter from Parachlamydia acanthamoebae
32% identity, 55% coverage
- A Genomic and Transcriptomic Overview of MATE, ABC, and MFS Transporters in Citrus sinensis Interaction with Xanthomonas citri subsp. citri
Julião, Plants (Basel, Switzerland) 2020 - “...MAFFT version 7.4 [ 81 ], with standard parameters. The outgroup sequences AK812_OLP99436, AK812_OLP95568, and DB43_AL00090, were retrieved from HMMER Ensembl Genomes. The best-of-fit model LG+G+F [ 82 ] was estimated for both ABC and MFS datasets, while WAG+G+F [ 83 ] for the MATE dataset...”
- “...Citrus spp. identified in the citrus reference transcriptome. Numbers above the branches represent bootstrap values. DB43_AL00090 was used as outgroup ( Parachlamydia acanthamoebae , gene ywtG, putative metabolite transport protein YwtG), Figure S3: Maximum likelihood tree of MFS amino acid sequences expressed by Citrus spp. identified...”
INT1_ARATH / Q8VZR6 Inositol transporter 1 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
TC 2.A.1.1.66 / Q8VZR6 The tonoplast H+:Inositol symporter 1, Int1 (mediates efflux from the tonoplast to the cytoplasm (Schneider et al., 2008) (most similar to 2.A.1.1.63 and 2.A.1.1.62) from Arabidopsis thaliana (Mouse-ear cress) (see 4 papers)
int1 / CAJ00303.1 inositol transporter 1 from Arabidopsis thaliana (see paper)
NP_850393 inositol transporter 1 from Arabidopsis thaliana
AT2G43330 INT1 (INOSITOL TRANSPORTER 1); carbohydrate transmembrane transporter/ myo-inositol:hydrogen symporter/ sugar:hydrogen symporter from Arabidopsis thaliana
32% identity, 56% coverage
- function: Vacuolar inositol-proton symporter involved in the release of myo-inositol from vacuoles. Not involved in glucose or fructose transport.
disruption phenotype: Reduced root length at low concentrations of myo- inositol. - substrates: myo-inositol
- Routes to the tonoplast: the sorting of tonoplast transporters in Arabidopsis mesophyll protoplasts.
Wolfenstetter, The Plant cell 2012 - GeneRIF: INT1 is correctly localized to the tonoplast, while sorting of the vacuolar sucrose transporter SUC4 is blocked in cis-Golgi stacks.
- Functional and physiological characterization of Arabidopsis INOSITOL TRANSPORTER1, a novel tonoplast-localized transporter for myo-inositol.
Schneider, The Plant cell 2008 - GeneRIF: molecular, physiological, and functional studies demonstrate that INT1 is a tonoplast-localized H(+)/inositol symporter that mediates the efflux of inositol that is generated during the degradation of inositol-containing compounds in the vacuolar lumen
- ITN1, a novel gene encoding an ankyrin-repeat protein that affects the ABA-mediated production of reactive oxygen species and is involved in salt-stress tolerance in Arabidopsis thaliana.
Sakamoto, The Plant journal : for cell and molecular biology 2008 (PubMed)- GeneRIF: Mutation in INT1 impairs abscisic acid signaling which leads to the reduction of reactive oxygen species accumulation under salt-stress conditions.
- Proton-coupled sugar transport in the prototypical major facilitator superfamily protein XylE
Wisedchaisri, Nature communications 2014 - “...AraE (P0AE24); Bacillus subtilis myo-inositol/H + transporter IolT (O34718); Arabidopsis thaliana inositol/H + symporter INT1 (Q8VZR6); Arabidopsis thaliana hexose/H + symporter STP1 (P23586); Parachlorella kessleri hexose/H + symporter HUP1 (P15686); Homo sapiens facilitated glucose transporter GLUT12 (Q8TD20); Homo sapiens H + /myo-inositol transporter GLUT13 (HMIT) (Q96QE2);...”
- Symplasmic phloem loading and subcellular transport in storage roots are key factors for carbon allocation in cassava
Rüscher, Plant physiology 2024 - “...to the work described in this paper: SUS1 Gramene: AT5G20830 SUS1 Araport: AT5G20830 INT1 Gramene: AT2G43330 INT1 Araport: AT2G43330 phloem AmiGo: PO:0005417 myo-inositol CHEBI: CHEBI:17268 SUS3 Gramene: AT4G02280 SUS3 Araport: AT4G02280 EDTA Gramene: Ethylenediamine tetraacetic acid EDTA Araport: Ethylenediamine tetraacetic acid metabolite CHEBI: CHEBI:25212 TPT Gramene:...”
- Physiological Importance of Molybdate Transporter Family 1 in Feeding the Molybdenum Cofactor Biosynthesis Pathway in Arabidopsis thaliana
Minner-Meinen, Molecules (Basel, Switzerland) 2022 - “...entry vectors. Plasma membrane localised At PIP2a (AT3G53420) [ 62 ] and tonoplast localised INT1 (AT2G43330) [ 63 ] served as negative controls. Cytosolic NSP3 (AT3G16390) [ 79 ] was used as an abundance control [ 28 ]. Fragments of CDS from these controls flanked by...”
- Genome-wide identification, expression, and association analysis of the monosaccharide transporter (MST) gene family in peanut (Arachis hypogaea L.)
Wan, 3 Biotech 2020 - “...Effect pollen and young xylem cells INT1 (AT2G43330) Impacts cell elongation AhMST57 PGLCT (AT5G16150) Affecting chloroplast AtSTP11, was a new member...”
- The Tonoplastic Inositol Transporter INT1 From Arabidopsis thaliana Impacts Cell Elongation in a Sucrose-Dependent Way
Strobl, Frontiers in plant science 2018 - “...Santa Clara, United States) and a GCMS-QP2010S-EI GC/MS-system (Shimadzu, Kyoto, Japan). Accession Numbers INT1 : At2g43330; IMPL1 : At1g31190; MIPS1 : At4g39800; MIOX2 : At2g19800; PI4K : At1g49340; PI4K 1 : At5g64070; PI4K 2 : At5g0935; PIN2 : At5g57090; PIP5K2 : At1g77740; PIP5K9 : At3g09920; PLC2...”
- A Conserved Carbon Starvation Response Underlies Bud Dormancy in Woody and Herbaceous Species
Tarancón, Frontiers in plant science 2017 - “...TRANSPORTER SWEET11 I At1g01720 ATAF1 II At5g23660 SUCROSE EFFLUX TRANSPORTER SWEET12 I At1g69490 NAP I-II-III-IV At2g43330 INOSITOL TRANSPORTER 1 II At5g39610 ORE1 I-II-III At1g22710 SUCROSE TRANSPORTER 1 (SUT1/SUC2) I At5g51070 SAG15 III At1g11260 STP1 I-lll At3g10985 SAG20 III-IV At5g61520 STP3 I At4g02380 SAG21 III At1g77210 STP14...”
- RNA-Seq and Gene Network Analysis Uncover Activation of an ABA-Dependent Signalosome During the Cork Oak Root Response to Drought
Magalhães, Frontiers in plant science 2015 - “...Xyloglucan endotransglycosylase 6 QSDrought_07044 Up AT5G57550 XTH25 Xyloglucan endotransglucosylase/hydrolase 25 Sugar:hydrogen symporter activity QSDrought_00469 Up AT2G43330 ATINT1 ATINT1 INT1 inositol transporter 1 QSDrought_00694 Up AT3G18830 ATPLT5 ATPLT5 ATPMT5 PMT5 polyol/monosaccharide transporter 5 QSDrought_01264 Down AT1G11260 STP1 ATSTP1 STP1 sugar transporter 1 QSDrought_02773 Up AT1G30220 ATINT2 ATINT2...”
- Phylloxera (Daktulosphaira vitifoliae Fitch) alters the carbohydrate metabolism in root galls to allowing the compatible interaction with grapevine (Vitis ssp.) roots
Griesser, Plant science : an international journal of experimental plant biology 2015 - “...GSVIVT01022022001 ERD6-like transporter Vverd6-like8 (at3g05150) 0.77 1.23E05 n.d. n.d. n.d. TC115303 GSVIVT01010741001 Inositol transporter VvINT1 (at2g43330) 0.65 0.0004 1.0 0.7 0.8 TC113429 GSVIVT01021530001 Inositol transporter VvINT2 (at1g30220) 0.71 0.0113 0.9 * 1.1 1.5 ** TC104946 GSVIVT01034886001 Sucrose transporter VvSUC27 (at1g22710) n.s. n.s. 0.7 ** 0.9 1.8...”
- Pre-symptomatic transcriptome changes during cold storage of chilling sensitive and resistant peach cultivars to elucidate chilling injury mechanisms
Pons, BMC genomics 2015 - “...Carbohydrate transport PPN025D11 SLT1 protein AT3G12570 FYD Sugar partioning and homeostasis PPN078G04 Putative membrane transporter AT2G43330 INT1 Sugar partioning and homeostasis Cooper transport PPN025H09 Putative copper-transporting ATPase 3 AT1G63440 HMA5 ion channel PPN023C11 Mechanosensitive ion channel AT5G10490 MSL2 Mg transport PPN001H12 MRS2-5 AT2G03620 MGT3 oligopepetide transport...”
- More
LOC100852699 polyol transporter 5 from Vitis vinifera
29% identity, 59% coverage
BSU35830 putative carbohydrate transporter from Bacillus subtilis subsp. subtilis str. 168
34% identity, 53% coverage
- Secondary structural entropy in RNA switch (Riboswitch) identification
Manzourolajdad, BMC bioinformatics 2015 - “...-55.60 - 0.4600 123.0559998 - 0.3600 899 yxeF BSU39570 0.8090547919 200 nt 3688648 3688847 reverse BSU35830 ywtG -3786 -49.93 - 0.3300 120.9260025 - 0.3550 199 yvyI BSU35790 0.8084035516 200 nt 1668788 1668987 reverse BSU15960 ylqB -2279 -51.60 - 0.4050 122.7809982 - 0.4150 13099 rpmB BSU15820 0.8080439568...”
ATEG_07053 uncharacterized protein from Aspergillus terreus NIH2624
33% identity, 50% coverage
- Transcriptome Profiling-Based Analysis of Carbohydrate-Active Enzymes in Aspergillus terreus Involved in Plant Biomass Degradation
Corrêa, Frontiers in bioengineering and biotechnology 2020 - “...incubation period, namely ATEG_07791, ATEG_03475, ATEG_07105, ATEG_04988, ATEG_01556, ATEG_07124, ATEG_08653, ATEG_07144, ATEG_03527, ATEG_02489, ATEG_07114, ATEG_04070, ATEG_07053, ATEG_04137, ATEG_03190, and ATEG_05008. RT-qPCR Validation of in silico RNA-Seq Transcriptome Data Expression profiles for selected A. terreus CAZyme-encoding and other genes significantly up-regulated on SB and SH in comparison...”
XP_011536149 proton myo-inositol cotransporter isoform X1 from Homo sapiens
26% identity, 87% coverage
- The genetic variants in calcium signaling related genes influence anti-tuberculosis drug induced liver injury: A prospective study.
Lyu, Medicine 2019 - GeneRIF: Our study revealed that both BDKRB2 and TENM2 genetic polymorphisms were interrogated in relation to anti-tuberculosis drug induced liver injury (ATDILI) susceptibility and some laboratory indicators in the Western Chinese Han population, shedding a new light on exploring novel biomarkers and targets for ATDILI.
- Proton myo-inositol cotransporter is a novel γ-secretase associated protein that regulates Aβ production without affecting Notch cleavage.
Teranishi, The FEBS journal 2015 (PubMed)- GeneRIF: SLC2A13 is a novel gamma-secretase associated protein that regulates amyloid beta production without affecting Notch cleavage.
- Identification of genes associated with non-small-cell lung cancer promotion and progression.
Bankovic, Lung cancer (Amsterdam, Netherlands) 2010 (PubMed)- GeneRIF: genetic alterations of TSPAN14, SLC2A13 and PHF20 could play a role in non-small-cell lung cancer promotion
- Evaluation of expression and function of the H+/myo-inositol transporter HMIT.
Di, BMC cell biology 2009 - GeneRIF: HMIT is primarily a neuronal transporter widely expressed in the rat and human brain, with particularly high levels in the hippocampus and cortex, as shown by immunohistochemistry.
- Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
Rose, Molecular medicine (Cambridge, Mass.) - GeneRIF: Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
- The Solute Carrier Family 2 Genes Are Potential Prognostic Biomarkers in Acute Myeloid Leukemia.
Lai, Technology in cancer research & treatment - GeneRIF: The Solute Carrier Family 2 Genes Are Potential Prognostic Biomarkers in Acute Myeloid Leukemia.
TC 2.A.1.1.103 / Q0WWW9 D-xylose-proton symporter-like 3, chloroplastic from Arabidopsis thaliana (see 7 papers)
NP_200733 Major facilitator superfamily protein from Arabidopsis thaliana
AT5G59250 sugar transporter family protein from Arabidopsis thaliana
36% identity, 52% coverage
- substrates: Xylose
- The Plastidic Sugar Transporter pSuT Influences Flowering and Affects Cold Responses.
Patzke, Plant physiology 2019 - GeneRIF: PSuT(At5g59250) mediated sucrose export out of chloroplasts modulates abiotic stress tolerance in Arabidopsis, as demonstrated by the impaired response of mutants to cold temperatures.
- Functional survey for heterologous sugar transport proteins, using Saccharomyces cerevisiae as a host
Young, Applied and environmental microbiology 2011 - “...Q6BTD8 Q2MEV7 GXS1 DEHA0D02167 Q2MDH1 Q6AWX0 At5g17010 GXF1 Q0WWW9 P22144 At5g59250 P31867 XYL2 UniProt accession no. XYL1 Gene/locus tag E. coli D. hansenii C....”
- Optimizing pentose utilization in yeast: the need for novel tools and approaches
Young, Biotechnology for biofuels 2010 - “...TMB3201 - Arabidopsis thaliana Stp3 Q8L7R8 p4H7 [ 64 ] TMB3201 - Arabidopsis thaliana At5g59250 Q0WWW9 p4H7 [ 64 ] TMB3201 - Arabidopsis thaliana At5g59250 Q0WWW9 pRH145 [ 75 ] BY4727 + Arabidopsis thaliana At5g17010 Q6AWX0 pRH145 [ 75 ] BY4727 + Arabidopsis thaliana Seedling cDNA...”
- An atlas of rational genetic engineering strategies for improved xylose metabolism in Saccharomyces cerevisiae
Vargas, PeerJ 2023 - “.../ XKS1 25% and 40% increase in xylose consumption ( Hector et al., 2008 ) AT5G59250 ( Arabidopsisthaliana) AT5G59250 ( Arabidopsis thaliana) Scheffersomyces stipitisXYL1 (K270R) and XYL2 / XKS1 / TAl1 / TKL1 / RPK1 / RPE1 / gre3 Did not present significant results in the...”
- “...Reis et al., 2016 ). In Arabidopsis thaliana , genes encoding sugar transporters AT5G17010 and At5g59250 were expressed in recombinant S. cerevisiae containing the genetic modifications for xylose consumption, and the consumption of this pentose was analyzed in fermentations. Strains expressing the AT5G17010 and AT5G59250 transporters...”
- The novel chloroplast glucose transporter pGlcT2 affects adaptation to extended light periods
Valifard, The Journal of biological chemistry 2023 - “...genes in plant species Alignment of pGlcT2 with other sugar transporters (VGT1: At3g03090 , pSUT: At5g59250 , and pGLCT: At5g16150 ) was done using MEGA11 software ( 74 ) based on ClustalW ( 75 ) alignment of the corresponding amino acid sequences. The alignment was visualized...”
- Valorisation of xylose to renewable fuels and chemicals, an essential step in augmenting the commercial viability of lignocellulosic biorefineries
Narisetty, Sustainable energy & fuels 2021 - “...by 25 and 40% with the introduction of Arabidopsis thaliana xylose transporter genes At5g17010 and At5g59250 , respectively. 192 A large improvement (75%) in xylose transport was achieved with Gxf1 , a MFS transporter identified from Candida intermedia . 193 This traditional xylose transporter displayed improved...”
- Membrane transporters in the bioproduction of organic acids: state of the art and future perspectives for industrial applications
Soares-Silva, FEMS microbiology letters 2020 - “...Xyp29 ( STL12 ), SUT3 (Xyp37) from Scheffersomyces stipitis , GXF1 from Candida intermedia , At5g59250 from Arabidopsis thaliana , An292 and An25 from Neurospora crassa , xtrD from A. nidulans , MgT05196 from Meyerozyma guilliermondii and Xylh from Debaryomyces hansenii . More than 80% of...”
- Engineering of sugar transporters for improvement of xylose utilization during high-temperature alcoholic fermentation in Ogataea polymorpha yeast
Vasylyshyn, Microbial cell factories 2020 - “...Xyp29 (STL12), Sut3 (Xyp37) from Scheffersomyces stipitis , Gxs1 and Gxf1 from Candida intermedia , At5g59250 from Arabidopsis thaliana , An29-2 and An25 from Neurospora crassa , xtrD from Aspergillus nidulans , MgT05196 from Meyerozyma guilliermondii and Xylh from Debaryomyces hansenii restored the ability of S....”
- Novel xylose transporter Cs4130 expands the sugar uptake repertoire in recombinant Saccharomyces cerevisiae strains at high xylose concentrations
Bueno, Biotechnology for biofuels 2020 - “...to other known heterologous xylose transporters, such as Sut1, Xut1, Xut3 ( Scheffersomyces stipitis ), At5g59250 ( Arabidopsis thaliana ) and XylHP ( Debaryomyces hansenii ) [ 21 , 26 , 33 ]. Interestingly, the transport of xylose in Gxf1 seems to be concentration-dependent given that...”
- “...to restore significant xylose growth on expressing strains. Even A. thaliana xylose transporters, At5g17010 and At5g59250, were responsible for 25% and 40% of improvements in xylose consumption rate, respectively, on S. cerevisiae strains [ 57 ]. As highlighted above, the facilitator Gxf1 isolated from C. intermedia...”
- The Plastidic Sugar Transporter pSuT Influences Flowering and Affects Cold Responses
Patzke, Plant physiology 2019 (PubMed)- “...data libraries under accession numbers BT015354.1 (pSUT, At5g59250), BT010375.1 584 Plant Physiol. Vol. 179, 2019 Downloaded from on August 13, 2019...”
- Engineering of Pentose Transport in Saccharomyces cerevisiae for Biotechnological Applications
Nijland, Frontiers in bioengineering and biotechnology 2019 - “...(Hector et al., 2008 ). In a comparative analysis of various heterologously expressed sugar transporters, At5g59250 showed only a slight improvement in the D-xylose uptake kinetics employing a strain harboring the native Hxt landscape, but this result was not statistically significant. In contrast, the aforementioned Ci...”
- More
E4NW64 MFS transporter, sugar porter family from Halogeometricum borinquense (strain ATCC 700274 / DSM 11551 / JCM 10706 / KCTC 4070 / PR3)
35% identity, 55% coverage
X276_26120 sugar porter family MFS transporter from Clostridium beijerinckii NRRL B-598
35% identity, 52% coverage
An15g01500 uncharacterized protein from Aspergillus niger
32% identity, 50% coverage
- In Silico Analysis of Putative Sugar Transporter Genes in Aspergillus niger Using Phylogeny and Comparative Transcriptomics
Peng, Frontiers in microbiology 2018 - “...solid experimental proof of function also had highly specific expression profiles. For example, the gene An15g01500 was significantly up-regulated on D -fructose, sucrose, pectin, and inulin, indicating that it may be a D -fructose transporter. Two potential disaccharide transporters from Clade C, An15g00310 and An09g04810, showed...”
- Extensive intra-kingdom horizontal gene transfer converging on a fungal fructose transporter gene
Coelho, PLoS genetics 2013 - “...the Aspergillus Genome Database (AspGD, http://www.aspergillusgenome.org/ ) [94] using the two A. niger FSY1 homologues (An15g01500 and An06g02270) as query. The visualization tool Sybil was used to navigate the ortholog clusters in their genomic context. For Eurotium herbariorum , which is not included in the present...”
- Analysis of variance components reveals the contribution of sample processing to transcript variation
van, Applied and environmental microbiology 2009 - “...An09g00120 An18g03570 An14g02760 An09g03300 An03g00500 An15g01500 An11g01100 An03g01620 An06g00560 An01g10920 An01g03740 An12g00030 An07g03140 An02g03590 Signal...”
TC 2.A.1.1.40 / Q64L87 The xylose facilitator, Xylhp from Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
29% identity, 52% coverage
Cbei_0109 sugar transporter from Clostridium beijerincki NCIMB 8052
35% identity, 52% coverage
- CRISPR-Cas technology a new era in genomic engineering
Parsaeimehr, Biotechnology reports (Amsterdam, Netherlands) 2022 - “...the solvent production in C. beijerinckii the genes ctfAB, cbei_3833/3834, and xylR, cbei_2385, and xylT, cbei_0109 responsible for the organic acids re-assimilation and pentose utilization, were edited using the introduced CRISPR-Cas system. As a result, the genome engineered Clostridia was able to decompose 83.2g/L of deshelled...”
- Enhanced solvent production by metabolic engineering of a twin-clostridial consortium
Wen, Metabolic engineering 2017 (PubMed)- “...and pentose utilization (xylR, cbei_2385 and xylT, cbei_0109) were engineered in C. beijerinckii to enhance solvent production. The engineered twin-clostridia...”
- “...by inactivating xylR ( cbei_2385 )and overexpressing xylT ( cbei_0109 ) to promote pentose utilization. Fig. 1 Fig. 2 A CRISPRi system was adapted to repress...”
- Reconstruction of xylose utilization pathway and regulons in Firmicutes
Gu, BMC genomics 2010 - “...related protein Clostridium , C. saccharolyticus XylB CAC2612 Xylulokinase Xylulokinase (with CAC1344) Bacilli, Clostridia XylT Cbei_0109 Xylose H + -symporter Sugar transporter Clostridium , Lactobacillales XylR CAC3673 Xylose regulator XylR regulator (with CAC0933 ) Bacilli, Clostridia XynT CAC3451 Xyloside Na + (H + ) - symporter...”
STM14_3735 galactose/proton symporter from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
31% identity, 57% coverage
M1AVD3 Mannitol transporter from Solanum tuberosum
31% identity, 53% coverage
- Automated identification of reference genes based on RNA-seq data
Carmona, Biomedical engineering online 2017 - “...Calcium-dependent protein kinase 4 Solanum tuberosum rp11_olive_008079 239 204 197 343 275 263 19.34 253.5 M1AVD3 Uncharacterized protein Solanum tuberosum rp11_olive_008883 128 119 144 187 108 118 19.51 134 Q9LZI2 UDP-glucuronic acid decarboxylase 2 Arabidopsis thaliana rp11_olive_035033 178 166 224 177 285 199 19.76 204.8 P62201...”
ITR1_YEAST / P30605 Myo-inositol transporter 1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
TC 2.A.1.1.8 / P30605 Myoinositol:H+ symporter from Saccharomyces cerevisiae (Baker's yeast) (see 6 papers)
ITR1 / RF|NP_010785.1 Myo-inositol transporter 1 from Saccharomyces cerevisiae
YDR497C Itr1p from Saccharomyces cerevisiae
NP_010785 myo-inositol transporter ITR1 from Saccharomyces cerevisiae S288C
28% identity, 52% coverage
- function: Major transporter for myo-inositol.
catalytic activity: myo-inositol(out) + H(+)(out) = myo-inositol(in) + H(+)(in) (RHEA:60364) - substrates: H+
- Yeast Double Transporter Gene Deletion Library for Identification of Xenobiotic Carriers in Low or High Throughput
Almeida, mBio 2021 - “...YBR295W, YBR296C, YBR298C, YCL025C, YCR010C, YCR011C, YCR028C, YCR098C, YDL199C, YDR011W, YDR046C, YDR345C, YDR384C, YDR387C, YDR406W, YDR497C, YDR508C, YDR536W, YEL063C, YEL065W, YER056C, YER145C, YER166W, YFL011W, YFL040W, YFL050C, YFL055W, YGL077C, YGL114W, YGL255W, YGR055W, YGR121C, YGR138C, YGR217W, YGR224W, YGR260W, YGR281W, YGR289C, YHL016C, YHL040C, YHL047C, YHR092C, YHR094C, YHR096C, YIL013C, YIL088C,...”
- The role of Candida albicans in root caries biofilms: an RNA-seq analysis
Ev, Journal of applied oral science : revista FOB 2020 - “...codes for a potential active sugar transporter, potential Myo-inositol transporter, similar to S. cerevisiae ITR1 (YDR497C). The DHN6 (FDR=0.046) codes for a dehydrin hypothetical protein. The CaO19.7197 (FDR=0.046) codes for a hypothetical protein similar to S. cerevisiae YLR002C, with unknown function. The CaO19.7838 (FDR=0.046) codes for...”
- “...codes for a potential active sugar transporter, potential Myo-inositol transporter, similar to S. cerevisiae ITR1 (YDR497C). Myo-inositol is an essential substrate for C. albicans , and it can be used as carbon source. For its survival, C. albicans must be able to synthesize the essential metabolite...”
- Transcriptional profiling reveals molecular basis and novel genetic targets for improved resistance to multiple fermentation inhibitors in Saccharomyces cerevisiae
Chen, Biotechnology for biofuels 2016 - “...YHR096C , YPL036W YBL075C, YBR008C, YBR054W , YBR069C, YCR021C , YDR011W, YDR046C, YDR135C, YDR345C , YDR497C, YER103W, YFL054C, YGL255W, YGR138C , YGR281W, YHR092C, YHR096C , YJR095W, YKL175W, YLL028W, YLR237W, YLR259C, YML116W, YOR153W, YOR328W, YPL058C, YPL274W, YPR138C, YPR156C Ion transport (GO: 0006811) YAL053W, YBR054W, YCL025C, YCR021C ,...”
- Direct and Indirect Targeting of PP2A by Conserved Bacterial Type-III Effector Proteins
Jin, PLoS pathogens 2016 - “...2A activity -0.553447 Sphingolipid biosynthesis-related genes YCR034W FEN1 * + Fatty acid elongase activity -1.228157 YDR497C ITR1 + Myo-inositol transmembrane transporter activity -1.200737 YGR143W SKN1 + Glucosidase activity -0.965214 YDR072C IPT1 + Transferase activity, transferring phosphorus-containing groups -0.763681 YEL042W GDA1 + Guanosine-diphosphatase activity -0.541537 YPL057C SUR1...”
- Using Gene Essentiality and Synthetic Lethality Information to Correct Yeast and CHO Cell Genome-Scale Models
Chowdhury, Metabolites 2015 - “...formed by 15 precursor molecules in appropriate biological ratios in Yeast 7.11. The in silico YDR497C YOL103W ( itr1 itr2 ) double deletion strain cannot uptake myo-inositol thereby showing decrease in vegetative growth in corroboration with in vivo studies [ 77 ]. YJL153C ( ino1 )...”
- “...in silico . Figure 10 Lipid metabolism disrupted due deletion of synthetic lethal gene triplet. YDR497C and YOL103W are isozymes coding for the protein catalyzing the myo-inositol transport into the cytosol from media. Reactions catalyzed by SL gene triplet are marked with red crosses. The essentiality...”
- Conservation of nucleosome positions in duplicated and orthologous gene pairs
Nishida, TheScientificWorldJournal 2012 - “...0.977460825 0.994501786 1416866 chr04 YDR480W 0.967727074 0.986953403 1417391 + chr04 YDR488C 0.983114512 0.979187155 1430781 chr04 YDR497C 0.955855412 0.958236577 1445459 chr04 YDR529C 0.966273576 0.971812076 1496540 chr05 YEL072W 0.968131913 0.977435534 13720 + chr05 YEL043W 0.979079858 0.96227706 70478 + chr05 YEL038W 0.981572221 0.988369151 80462 + chr05 YEL021W 0.951315475 0.951565922...”
- “...YOR365C AFUA_4G13340 0.094260129 YHR215W AFUA_6G11330 0.092128581 YKL013C AFUA_6G02370 0.088958318 YOR043W AFUA_4G06130 0.087990985 YPR062W AFUA_1G05050 0.087018417 YDR497C AFUA_2G07910 0.078863767 YDR477W AFUA_2G01700 0.074801159 YLR378C AFUA_5G08130 0.074624328 YBR060C AFUA_5G08110 0.073589072 YGL120C AFUA_5G11620 0.069009268 YIL063C AFUA_2G10810 0.06328373 YOL157C AFUA_7G06380 0.06047767 YGL043W AFUA_3G07670 0.059398891 YMR027W AFUA_5G06710 0.058232831 YHR215W AFUA_8G01910 0.05787337 YDL247W...”
- Systematic genetic array analysis links the Saccharomyces cerevisiae SAGA/SLIK and NuA4 component Tra1 to multiple cellular processes
Hoke, BMC genetics 2008 - “...9 ubiquitin ligase complex, ER, mitochondrion 3 TPS2 YDR074W s 3,5,7,8,10 mitochondrion X 4 ITR1 YDR497C s 4, 5, 7, 9 plasma membrane X 9 NEW1 YPL226W s 4, 5, 9, 8 cytoplasm, mitochondrion 8 AQR2 YBR043C s 4, 7 plasma membrane 1 GTR1 YML121W s...”
- Reconstructing dynamic regulatory maps
Ernst, Molecular systems biology 2007 - “...by semiquantitative PCR using primers designed for the detection of upstream regions of the genes YDR497C, YNL169C, YGR196C, and YHR123W. Primer sequences are as follows: YDR497C: TAGCGCACCAAACTGAAAGA, AAGCGCATATACTTAGTTCTCTCCA; YNL169C: CGACCAAGAAGGATTTGAGC, CCAGCACCTTTTTGGTGTTT; YGR196C: CGCTTTCCAGAAAAAGGGTA, CGTCGTTTGTTTGTTTGGTG; YHR123W: TGGCAAAATACAGAACACAGG, TATGCTCAGTCCAGCCCTTT. As a negative control, primers for the upstream region...”
- More
- Yeast Double Transporter Gene Deletion Library for Identification of Xenobiotic Carriers in Low or High Throughput.
Almeida, mBio 2021 - GeneRIF: Yeast Double Transporter Gene Deletion Library for Identification of Xenobiotic Carriers in Low or High Throughput.
- Major facilitator superfamily
Pao, Microbiology and molecular biology reviews : MMBR 1998 - “...P39004 P40886 P43581 P40885 P39924 P42833 P47185 Z71687 P30605 X98622 P30606 S51081 P07921 P38156 P15685 P18631 X96876 Q10710 P38142 S58778 U32274 P43562 Z72626...”
- “...Trypanosoma brucei P37021 P09830 P09098 P21906 P43581 P13181 P11636 P30605 P07921 P15685 S59368 Q07647 U11843 P15686 Q02563 X78855 Q06222 SP SP SP SP SP SP SP...”
TC 2.A.1.1.45 / Q8L6Z8 Vacuolar (tonoplast) glucose transporter1, Vgt1 (important for seed germination and flowering) from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
RF|NP_186959.2 D-xylose-proton symporter-like 1 from Arabidopsis thaliana
NP_186959 vacuolar glucose transporter 1 from Arabidopsis thaliana
AT3G03090 AtVGT1 (Arabidopsis thaliana vacuolar glucose transporter 1); carbohydrate transmembrane transporter/ fructose transmembrane transporter/ glucose transmembrane transporter/ sugar:hydrogen symporter from Arabidopsis thaliana
32% identity, 53% coverage
- substrates: glucose
- Identification and functional expression of the Arabidopsis thaliana vacuolar glucose transporter 1 and its role in seed germination and flowering.
Aluri, Proceedings of the National Academy of Sciences of the United States of America 2007 - GeneRIF: Vacuolar glucose transporter 1 (AtVGT1) was localized to the vacuolar membrane. Analyses of Atvgt1 mutant lines indicate an important function of this vacuolar glucose transporter during developmental processes like seed germination and flowering
- Vacuolar Sugar Transporter TMT2 Plays Crucial Roles in Germination and Seedling Development in Arabidopsis
Cao, International journal of molecular sciences 2023 - “...vacuoles in a similar way [ 20 ]. Among the three VGTs, only VGT1 ( At3g03090 ) has been functionally characterized as a vacuolar importer, which transports glucose from the cytoplasm into the vacuoles and plays a vital role in seed germination and flowering [ 20...”
- “...4.13. Accession Numbers We acquired all the Arabidopsis gene sequences from the TAIR database: VGT1 (AT3G03090) , TMT1 (AT1G20840) , TMT2 (AT4G35300) , TMT3 (AT3G51490) , SAUR22 (AT5G18050) , SAUR23 (AT5G18060) , SAUR26 (AT3G03850) , SWEET2 (AT3G14770) , ERDL6 (AT1G75220) , DAO2 (AT1G14120) , PIN6 (AT1G77110)...”
- The novel chloroplast glucose transporter pGlcT2 affects adaptation to extended light periods
Valifard, The Journal of biological chemistry 2023 - “...the distribution pGlcT2 genes in plant species Alignment of pGlcT2 with other sugar transporters (VGT1: At3g03090 , pSUT: At5g59250 , and pGLCT: At5g16150 ) was done using MEGA11 software ( 74 ) based on ClustalW ( 75 ) alignment of the corresponding amino acid sequences. The...”
- Membrane nanodomains and transport functions in plant
Martinière, Plant physiology 2021 - “...transporter (TMT) AT4G35300 (TMT2) Suspension cell cultures Yoshida et al., 2013 Vacuolar glucose transporter (VGT) AT3G03090 (VGT1) Suspension cell cultures Yoshida et al., 2013 Conclusion and prospects A number of proteins transporting molecules such as auxin, water, nitrate, and ammonium across the PM were demonstrated both...”
- Genome-wide identification, expression, and association analysis of the monosaccharide transporter (MST) gene family in peanut (Arachis hypogaea L.)
Wan, 3 Biotech 2020 - “...AhMST17 AtSTP1 (AT1G11260) AhMST13 AhMST13 AhMST9 AtVGT1 (AT3G03090) STP12 (AT4G21480) AtINT4 (AT4G16480) Uptake of extracellular sugars by the embryo and in...”
- “...in pollen and young xylem cells AtVGT1 (AT3G03090) Influences flowering and seed germination AtPLT5/AtPMT5 (AT3G18830) Effect pollen and young xylem cells...”
- A novel eIF4E-interacting protein that forms non-canonical translation initiation complexes
Toribio, Nature plants 2019 - “...used a different statistical model comparison, allowed the additional identification of the glucose transporter VGT1 (At3g03090) 44 as a translationally regulated gene in both ceres mutants compared to Col-0 ( Extended Data Fig. 8 ) (TE fold change -0.779 and -0.829 p-adj 0.017 and 0.049 in...”
- Integrated mRNA and miRNA transcriptome reveal a cross-talk between developing response and hormone signaling for the seed kernels of Siberian apricot
Niu, Scientific reports 2016 - “...Additionally, our mRNA transcriptomic analysis revealed that the homologies of ATVGT1 (sugar transporter family protein, At3g03090), ATK (K + transporter, At4g22200), PGP4 (P-glycoprotein 4, At2g47000), ABCG18 (ABC transporter family protein, At3g55110) and SULTR1;2 (sulfate transporter 1;2, At1g78000) were up-regulated specifically in early-middle stage of developing SASK...”
- Genome-Wide Association Analysis of Adaptation Using Environmentally Predicted Traits
van, PLoS genetics 2015 - “...ATH1 - - 986 - - - AT5G03790 ATHB51 - - - - 1356 1406 AT3G03090 AtVGT1 - - 690 568 1350 - AT2G31650 ATX1 997 1146 890 - - - AT2G33540 CPL3 - 946 - - 949 - AT4G20910 CRM2 - 1436 - - 688...”
- Expression patterns of genes involved in sugar metabolism and accumulation during apple fruit development
Li, PloS one 2012 - “...with MdTMT5 ( Figure 2I ). Both MdvGT1 and MdvGT2 had high homology with AtvGT1 (At3g03090) and AtvGT2 (At5g17010), respectively, and were in the same clade, whereas they had low similarity with AtvGT3 (At5g59250) ( Figure 2J ). Expression of genes in source and sink tissues...”
- More
AT5G17010, NP_850835 sugar transporter family protein from Arabidopsis thaliana
Q6AWX0 D-xylose-proton symporter-like 2 from Arabidopsis thaliana
34% identity, 52% coverage
- An atlas of rational genetic engineering strategies for improved xylose metabolism in Saccharomyces cerevisiae
Vargas, PeerJ 2023 - “...XKS1 / hxt1-17 / gal2 Higher affinity for xylose ( Colabardini et al., 2014 ) AT5G17010 ( Arabidopsisthaliana) BY4727 - Scheffersomyces stipitis XYL1 and XYL2 / XKS1 25% and 40% increase in xylose consumption ( Hector et al., 2008 ) AT5G59250 ( Arabidopsisthaliana) AT5G59250 ( Arabidopsis...”
- “...; Dos Reis et al., 2016 ). In Arabidopsis thaliana , genes encoding sugar transporters AT5G17010 and At5g59250 were expressed in recombinant S. cerevisiae containing the genetic modifications for xylose consumption, and the consumption of this pentose was analyzed in fermentations. Strains expressing the AT5G17010 and...”
- Responsiveness of Early Response to Dehydration Six-Like Transporter Genes to Water Deficit in Arabidopsis thaliana Leaves
Slawinski, Frontiers in plant science 2021 - “...other vacuolar SUTs: AtSWEET16 (At3g16690), AtSWEET17 (At4g15920), AtTMT1 (At1g20840), AtTMT2 (At4g35300), AtSUC4 (At1g09960), and AtVGT2 (At5g17010), and of vacuolar invertases At Fruct3 (At1g62660) and Atfruct4 (At1g12240) were performed using the rosette leaves of Col-0 and mutant plants grown in WW, WD, and RW conditions. Quantitative PCR...”
- Valorisation of xylose to renewable fuels and chemicals, an essential step in augmenting the commercial viability of lignocellulosic biorefineries
Narisetty, Sustainable energy & fuels 2021 - “...was enhanced by 25 and 40% with the introduction of Arabidopsis thaliana xylose transporter genes At5g17010 and At5g59250 , respectively. 192 A large improvement (75%) in xylose transport was achieved with Gxf1 , a MFS transporter identified from Candida intermedia . 193 This traditional xylose transporter...”
- Valorisation of pectin-rich agro-industrial residues by yeasts: potential and challenges
Martins, Applied microbiology and biotechnology 2020 - “...for sugar transporters are not many, but the heterologous integration of the xylose transporter gene AT5G17010 from A. thaliana into C. tropicalis resulted in a 3773% increase in xylose uptake compared to the original strain (Jeon et al. 2013 ). Given that synthetic biology methods and...”
- Novel xylose transporter Cs4130 expands the sugar uptake repertoire in recombinant Saccharomyces cerevisiae strains at high xylose concentrations
Bueno, Biotechnology for biofuels 2020 - “...also able to restore significant xylose growth on expressing strains. Even A. thaliana xylose transporters, At5g17010 and At5g59250, were responsible for 25% and 40% of improvements in xylose consumption rate, respectively, on S. cerevisiae strains [ 57 ]. As highlighted above, the facilitator Gxf1 isolated from...”
- Identification of Cargo for Adaptor Protein (AP) Complexes 3 and 4 by Sucrose Gradient Profiling
Pertl-Obermeyer, Molecular & cellular proteomics : MCP 2016 - “...at1g59870 at2g39010 at4g35100 at5g60660 at4g39080 at5g17010 at1g71880 ap-4 mutant at1g52780 at1g59610 at2g37170 at3g52400 at4g08850 at4g13510 at4g23630...”
- Effect of heterologous xylose transporter expression in Candida tropicalis on xylitol production rate
Jeon, Bioprocess and biosystems engineering 2013 (PubMed)- “...In this study, a heterologous xylose transporter gene (At5g17010) from Arabidopsis thaliana was selected because of its high affinity for xylose and was...”
- “...gene Codon-optimization of the heterologous xylose transporter gene At5g17010 of A. thaliana was performed for Table 1 Candida tropicalis strains used in this...”
- Expression patterns of genes involved in sugar metabolism and accumulation during apple fruit development
Li, PloS one 2012 - “...Figure 2I ). Both MdvGT1 and MdvGT2 had high homology with AtvGT1 (At3g03090) and AtvGT2 (At5g17010), respectively, and were in the same clade, whereas they had low similarity with AtvGT3 (At5g59250) ( Figure 2J ). Expression of genes in source and sink tissues To determine tissue-specific...”
- More
- The phosphoproteome in regenerating protoplasts from Physcomitrella patens protonemata shows changes paralleling postembryonic development in higher plants
Wang, Journal of experimental botany 2014 - “...APE2 (ACCLIMATION OF PHOTOSYNTHESIS TO ENVIRONMENT 2); antiporter/triose-phosphate transmembrane transporter Chloroplast QFS#TAS#SSSFS#VK C65 53.5 6.36 Q6AWX0 d -xylose-proton symporter-like 2 Membrane M*ALDPEQQQPISSVS#R C66 25.6 5.24 Q9SP35 Mitochondrial import inner membrane translocase subunit Tim17 Membrane EDPWNS#IIAGAATGGFLSMR C67 84.6 9.29 Q9S9N5 Putative cyclic nucleotide-gated ion channel 7 Membrane...”
- Functional survey for heterologous sugar transport proteins, using Saccharomyces cerevisiae as a host
Young, Applied and environmental microbiology 2011 - “...DEHA2B14278 xylE Q6BTD8 Q2MEV7 GXS1 DEHA0D02167 Q2MDH1 Q6AWX0 At5g17010 GXF1 Q0WWW9 P22144 At5g59250 P31867 XYL2 UniProt accession no. XYL1 Gene/locus tag...”
- Optimizing pentose utilization in yeast: the need for novel tools and approaches
Young, Biotechnology for biofuels 2010 - “...TMB3201 - Arabidopsis thaliana At5g59250 Q0WWW9 pRH145 [ 75 ] BY4727 + Arabidopsis thaliana At5g17010 Q6AWX0 pRH145 [ 75 ] BY4727 + Arabidopsis thaliana Seedling cDNA [ 104 ] - pFL61 [ 64 ] TMB3201 - Candida intermedia Gxf1 Q2MDH1 YEplac195 [ 72 ] TMB3201 +...”
HMT11_CAEEL / Q9XXR3 Proton myo-inositol cotransporter hmit-1.1; H(+)-myo-inositol cotransporter hmit-1.1; H(+)-myo-inositol symporter hmit-1.1 from Caenorhabditis elegans (see paper)
NP_507623 Proton myo-inositol cotransporter hmit-1.1 from Caenorhabditis elegans
24% identity, 87% coverage
b2943 galactose:H+ symporter (galP) from Escherichia coli BW25113
GalP / b2943 galactose:H+ symporter from Escherichia coli K-12 substr. MG1655 (see 6 papers)
GalP / P0AEP1 galactose:H+ symporter from Escherichia coli (strain K12) (see 7 papers)
GALP_ECOLI / P0AEP1 Galactose-proton symporter; Galactose transporter from Escherichia coli (strain K12) (see paper)
TC 2.A.1.1.1 / P0AEP1 Galactose:H+ symporter, GalP. Also transports glucose, xylose, fucose (6-deoxygalactose), 2-deoxygalactose and 2-deoxyglucose) (Henderson and Giddens 1977; from Escherichia coli (strain K12)
b2943 D-galactose transporter from Escherichia coli str. K-12 substr. MG1655
NP_417418 galactose:H(+) symporter from Escherichia coli str. K-12 substr. MG1655
DK885_04375, ETEC_3133 galactose/proton symporter from Escherichia coli ETEC H10407
30% identity, 56% coverage
- mutant phenotype: A characterized E. coli protein, see EcoCyc. Not sure why SEED has it as transporting arabinose. .
- function: Uptake of galactose across the boundary membrane with the concomitant transport of protons into the cell (symport system)
- substrates: D-galactose, Galactose
tcdb comment: Henderson et al. 1977; Hernández-Montalvo et al., 2001). Relative substrate affinities of wild-type and mutant forms of the E. coli sugar transporter GalP have been determined by solid-state NMR (Patching et al., 2008). GalP may exist as a trimer with each subunit having a sugar transporting channel (Zheng et al. 2010) - Automated characterization and analysis of expression compatibility between regulatory sequences and metabolic genes in Escherichia coli
Wen, Synthetic and systems biotechnology 2024 - “...b2388 glk Glucokinase b2913 serA Phosphoglycerate dehydrogenase b2914 rpiA Ribose-5-phosphate isomerase A b2935 tktA Transketolase b2943 galP Galactose/H+ symporter b3041 ribB 3,4-Dihydroxy-2-butanone-4-phosphate synthase b3916 pfkA 6-Phosphofructokinase 1 b3919 tpiA Triose-phosphate isomerase b4025 pgi Glucose-6-phosphate isomerase b3956 ppc Phosphoenolpyruvate carboxylase b4090 rpiB Ribose-5-phosphate isomerase b3386 rpe Ribulose...”
- “...wide range of fluorescence intensities with different regulatory sequences. However, the fluorescence levels of genes b2943 (encoding a galactose:H + symporter) and b3952 (encoding a pyruvate formate lyase activating enzyme) remained relatively low. This may be due to these genes being subject to relatively strict regulation....”
- Systems Biology Approach to Bioremediation of Nitroaromatics: Constraint-Based Analysis of 2,4,6-Trinitrotoluene Biotransformation by Escherichia coli
Iman, Molecules (Basel, Switzerland) 2017 - “...GLCt2pp D-glucose transport in via proton symport (periplasm) glc-D[p] + h[p] -> glc-D[c] + h[c] b2943 NH4tpp Ammonia reversible transport (periplasm) nh4[p] <=> nh4[c] (b0451 or s0001) TPI Triose-phosphate isomerase dhap[c] <=> g3p[c] b3919 GLYCDx Glycerol dehydrogenase glyc[c] + nad[c] -> dha[c] + h[c] + nadh[c]...”
- Combinatorial strategies for improving multiple-stress resistance in industrially relevant Escherichia coli strains
Lennen, Applied and environmental microbiology 2014 - “...Description Fold change b0463 b0121 b2095 b4240 b3415 b2664 b2943 ECD_01942 b2028 b4114 b2845 b2663 acrA speE gatZ treB gntT csiR galP vioA ugd eptA yqeG gabP...”
- Transcription, translation, and the evolution of specialists and generalists
Zhong, Molecular biology and evolution 2009 - “...in Ancestors TD2 and TD10 b-Number b0719 b0879 b1639 b2943 b3287 b3306 b3508 SE, standard error. log2 LU/MG SE Gene Function 0.45 0.51 0.66 0.52 0.36 0.66...”
- Physiological studies of Escherichia coli strain MG1655: growth defects and apparent cross-regulation of gene expression
Soupene, Journal of bacteriology 2003 - “...resulted in higher levels of expression of: galP (b2943), which codes for a low-affinity galactose transporter; the mglBAC operon (b2150 to b2148), which codes...”
- “...12 10 2.1 2.9 6.4 3.6 1.5 1.4 b2151 galS 1.3 3.3 b2943 galP 2.8 3.9 b2150 b2149 b2148 mglB mglA mglC 3.6 2.6 0.8 13 7.3 4.9 b4120 b4119 b4118 melB melA melR 1.0...”
- Escherichia coli gene expression responsive to levels of the response regulator EvgA
Masuda, Journal of bacteriology 2002 - “...b0553 nmpC b2167 b2168 b2169 fruA fruK fruB b2943 galP Mean Outer membrane porin protein; locus of qsr prophage PTS system, fructose-specific transport protein...”
- Kinetic analysis of the inhibition of the drug efflux protein AcrB using surface plasmon resonance.
Mowla, Biochimica et biophysica acta. Biomembranes 2018 (PubMed) - The prototypical H+/galactose symporter GalP assembles into functional trimers.
Zheng, Journal of molecular biology 2010 - GeneRIF: Each monomer in the trimer forms its own channel, but an additional cavity (10 approximately 15 A in diameter) is apparent at the 3-fold axis of the oligomer.
- Unfolding free energy of a two-domain transmembrane sugar transport protein.
Findlay, Proceedings of the National Academy of Sciences of the United States of America 2010 - GeneRIF: Unfolding free energy of a two-domain transmembrane sugar transport protein, GalP.
- Repression of galP, the galactose transporter in Escherichia coli, requires the specific regulator of N-acetylglucosamine metabolism.
El, Molecular microbiology 2009 (PubMed)- GeneRIF: galP is repressed by a combination of NagC, GalR and GalS.
- Relative substrate affinities of wild-type and mutant forms of the Escherichia coli sugar transporter GalP determined by solid-state NMR.
Patching, Molecular membrane biology 2008 (PubMed)- GeneRIF: effects of the galP mutations W56F, W239F, R316W, T336Y and W434F on glucose binding
- Contribution of Stenotrophomonas maltophilia MfsC transporter to protection against diamide and the regulation of its expression by the diamide responsive repressor DitR
Boonyakanog, PloS one 2022 - “...AraE (P0AE24), Bcr (P28246), Blt (P39843), Bmr (P33449), CmlA (Q83V15), EmrD (P31442), EmrD-3 (C3LUT7), GalP (P0AEP1), LacY (P02920), LmrP (Q48658), MdfA (P0AEY8), MdtG (P25744), MhpT (P77589), NorA (P0A0J7), TetA (P02981), XylE (P0AGF4), YicM (J7R7Q1). mfsC mutant is susceptible to diamide To evaluate the physiological function of...”
- Proton-coupled sugar transport in the prototypical major facilitator superfamily protein XylE
Wisedchaisri, Nature communications 2014 - “...XylE (P0AGF4); Lactobacillus brevis D -xylose/H + symporter XylT (O52733); Escherichia coli galactose permease GalP (P0AEP1); Escherichia coli arabinose permease AraE (P0AE24); Bacillus subtilis myo-inositol/H + transporter IolT (O34718); Arabidopsis thaliana inositol/H + symporter INT1 (Q8VZR6); Arabidopsis thaliana hexose/H + symporter STP1 (P23586); Parachlorella kessleri hexose/H...”
- A Novel SXT/R391 Integrative and Conjugative Element Carries Two Copies of the blaNDM-1 Gene in Proteus mirabilis
He, mSphere 2021 - “...encoding 4-oxalomesaconate tautomerase (DK885_16125), bifunctional aldehyde dehydrogenase (DK885_12690), hydrogenase-4 component J (DK885_06720), and galactose-proton symporter (DK885_04375) was noticeable, whereas genes for multidrug resistance protein (MdtL), guanine/hypoxanthine permease (GhxQ), and cold shock protein (CspB) were expressed at lower levels in XH1814. We also compared gene expression levels...”
- The molecular basis for control of ETEC enterotoxin expression in response to environment and host
Haycocks, PLoS pathogens 2015 - “...) ( ygfI ) 3382158 TGTGA TCTACAA CAC G ETEC_3126 cmtB 3390811 TGTGA TTTGCT TCACA ETEC_3133 galP 3408173 TGTGA TGTGGA T A ACA ETEC_3154 nupG 3442697 TGTGA TGATTG TC G CA ETEC_3186 ETEC-specific 3558573 A GTGA TTTGGC TCACA ETEC_3291 ygiS 3580767 A GTGA CTTGCA TCACA (...”
Z4288 galactose-proton symport of transport system from Escherichia coli O157:H7 EDL933
ECs3819 galactose-proton symport of transport system from Escherichia coli O157:H7 str. Sakai
31% identity, 57% coverage
HMT13_CAEEL / Q21455 Proton myo-inositol cotransporter hmit-1.3; H(+)-myo-inositol cotransporter hmit-1.3; H(+)-myo-inositol symporter hmit-1.3 from Caenorhabditis elegans (see paper)
26% identity, 94% coverage
- function: H(+)-myo-inositol cotransporter.
catalytic activity: myo-inositol(out) + H(+)(out) = myo-inositol(in) + H(+)(in) (RHEA:60364)
pGlcT / Q56ZZ7 glucose transporter from Arabidopsis thaliana (see 4 papers)
PLST4_ARATH / Q56ZZ7 Plastidic glucose transporter 4; AtpGlcT from Arabidopsis thaliana (Mouse-ear cress) (see paper)
TC 2.A.1.1.102 / Q56ZZ7 Plastidic glucose transporter 4 (AtpGlcT) from Arabidopsis thaliana (see 5 papers)
NP_850828 plastidic GLC translocator from Arabidopsis thaliana
AT5G16150 PGLCT (PLASTIDIC GLC TRANSLOCATOR); carbohydrate transmembrane transporter/ sugar:hydrogen symporter from Arabidopsis thaliana
34% identity, 53% coverage
- function: May be involved in the efflux of glucose towards the cytosol.
- substrates: glucose
- Do mitochondria use efflux pumps to protect their ribosomes from antibiotics?
Islam, Microbiology (Reading, England) 2023 - “...9E^121** Q9SYQ1, 0.00014 A0A286YF51, 0.0019 [ 73 ] TPO1 Polyamine transporter 1 MFS G1UAY0, 1.9E^141# Q56ZZ7, 0.00017 Q6ZMD2, 9.2E^6 [ 40 ] TPO3 Polyamine transporter 3 MFS Q9C0R8, 6.1E^98# A0A1I9LP99, 7.5E^5 Q7L0J3, 0.0047 [ 40, 73 ] *Information adapted from the Saccharomyces Genome Database (SGD). https://www.yeastgenome.org/....”
- “...MFS T2AWG3, 0.0014 Q8GYF4, 1.4E^24 B3KT41, 0.0022 [ 79 ] NCU09551 Q7S2B0 MFS G1UAY0, 2.3E^6 Q56ZZ7, 2.3E^7 Q8NBP5, 8.4E^9 [ 78 ] NCU10021 Q7S0I5 MFS Q8J2J7, 8.1E^102 Q9FMX3, 2.3E^55 Q96QE2, 2.8E^41 [ 78 ] *Information gathered from NCBI Protein BLAST, algorithm: PSI-BLAST ( https://www.ncbi.nlm.nih.gov/ ) and...”
- Microsome-associated proteome modifications of Arabidopsis seedlings grown on board the International Space Station reveal the possible effect on plants of space stresses other than microgravity
Mazars, Plant signaling & behavior 2014 - “...protein Transporters P23586 AT1G11260 0.370 sugar transporter 1 Q8LGU1 AT3G21250 0.456 multidrug resistance-associated protein 6 Q56ZZ7 AT5G16150 0.523 Plastidic glucose transporter 4 Q53XH7 AT5G62670 0.553 H(+)-ATPase 11 Q94FB9 AT4G39850 0.559 ABC transporter D family member 1 Q9SE45 AT2G38760 0.587 annexin D3 Aquaporins Q41975 AT4G17340 0.219 putative...”
- The novel chloroplast glucose transporter pGlcT2 affects adaptation to extended light periods.
Valifard, The Journal of biological chemistry 2023 - GeneRIF: The novel chloroplast glucose transporter pGlcT2 affects adaptation to extended light periods.
- Role of the plastidic glucose translocator in the export of starch degradation products from the chloroplasts in Arabidopsis thaliana.
Cho, The New phytologist 2011 (PubMed)- GeneRIF: pGlcT, together with MEX1, contributes significantly to the export of starch degradation products from chloroplasts in A. thaliana leaves and and that this starch-mediated pathway for photoassimilate export via pGlcT and MEX1 is essential for the growth and development of A. thaliana. [pGlcT]
- The novel chloroplast glucose transporter pGlcT2 affects adaptation to extended light periods
Valifard, The Journal of biological chemistry 2023 - “...of the MST-type sugar transporter family in Arabidopsis revealed that pGlcT (encoded by the gene At5g16150 ) is one of four closely related carrier isoforms representing an independent MST subgroup ( 3 ). The next homolog to pGlcT is the protein encoded by the gene At1g05030...”
- “...Alignment of pGlcT2 with other sugar transporters (VGT1: At3g03090 , pSUT: At5g59250 , and pGLCT: At5g16150 ) was done using MEGA11 software ( 74 ) based on ClustalW ( 75 ) alignment of the corresponding amino acid sequences. The alignment was visualized using GeneDoc ( 76...”
- Nucleotide Imbalance, Provoked by Downregulation of Aspartate Transcarbamoylase Impairs Cold Acclimation in Arabidopsis
Bellin, Molecules (Basel, Switzerland) 2023 - “...1.97 2.05 1.48 1.49 Mt, P adenine nucleotide AT5G66380 FOLT1 0.76 1.05 0.65 PL folate AT5G16150 pGlcT 0.44 0.87 1.03 1.20 0.34 PL hexose AT1G68570 NPF3.1 2.69 2.35 0.66 0.72 PL nitrite AT4G32400 BT1-like 2.01 1.58 0.70 0.72 PL nucleotide AT1G61800 GPT2 5.90 7.61 0.39 1.65...”
- Genome-Wide Association Study to Identify Possible Candidate Genes of Snap Bean Leaf and Pod Color
Celebioglu, Genes 2023 - “...706,796 11.61 0.36 31.60 10.9 7.76 10 9 Phvul.008G006600 AT5G65560 Phvul.008G006700 AT5G38720 Phvul.008G006800 AT2G19540 Phvul.008G007500 AT5G16150 Phvul.008G007600 AT2G39060 Phvul.008G007700 AT5G16180 Phvul.008G008400 AT1G66840 5-593 1 G/T H.2020 50,939,307 27.26 0.08 75.89 29.3 1.47 10 23 Pv5-593.01G220900 AT5G26600 Pv5-593.01G221300 AT1G56720 Pv5-593.01G221400 Pv5-593.01G221500 AT1G09430 Pv5-593.01G221600 AT3G07100 Pv5-593.01G221800 AT1G56700 Pv5-593.01G221900...”
- An expanded role for the transcription factor WRINKLED1 in the biosynthesis of triacylglycerols during seed development
Kuczynski, Frontiers in plant science 2022 - “...PGI 1 (phosphoglucose isomerase, AT4G24620) (p) +20(+) 2.90.6 0.92 0.94 ** PGLCT (plastidic glucose translocator, AT5G16150) +45() 23.94.7 1.00 0.82 * PGLM 1 (phosphoglyceromutase, AT1G22170) (p) +104(+) 1.91.3 0.67 1.00 ** PGLM 2 (phosphoglyceromutase, AT1G78050) (p) +78(+) 6.74.1 1.00 0.97 ** PK p PK- (Pyruvate kinase...”
- Genome-wide identification, expression, and association analysis of the monosaccharide transporter (MST) gene family in peanut (Arachis hypogaea L.)
Wan, 3 Biotech 2020 - “...Regulate arsenic accumulation AhMST76 AhMST43 AhMST57 PGLCT (AT5G16150) Affecting chloroplast AtPLT6/AtPMT6 (AT4G36670) Effect pollen and young xylem cells INT1...”
- Transcriptional Plasticity of Autophagy-Related Genes Correlates with the Genetic Response to Nitrate Starvation in Arabidopsis Thaliana
Bedu, Cells 2020 - “...0.079 0.022 19.4% 0.005 ** GLU1 At5g04140 6.208 1.835 6.972 2.141 12.3% 0.026 * GLT At5g16150 0.284 0.110 0.372 0.139 31.0% 0.000 *** * p < 0.05, ** p < 0.01, *** p < 0.001, ns = not statistically significant. cells-09-01021-t002_Table 2 Table 2 Averages of...”
- Pan- and core- gene association networks: Integrative approaches to understanding biological regulation
Wirojsirasak, PloS one 2019 - “...a-Glucosidase-like 3 At5g11720 AGL4 a-Glucosidase-like 4 At1g68560 AGL5 a-Glucosidase-like 5 At5g46110 TPT1 Triose phosphate translocator At5g16150 GLT1 Glucose transporter At5g17520 MEX1 Maltose exporter The consensus-based network, proposed herein as core -GAN, is generally considered a reliable network because the constituents are supported by more than one...”
- Dynamics of metabolic responses to periods of combined heat and drought in Arabidopsis thaliana under ambient and elevated atmospheric CO2
Zinta, Journal of experimental botany 2018 - “...at4g10120; ADP glucose pyrophosphorylase, EC 2.7.7.27, at5g19220), and sugar transporters (sucrose-proton symporter 1/plastidic GLC translocator, at5g16150; glucose-6-phosphate translocator, at5g46110). Elevated CO 2 dampened this effect (see Supplementary Fig. S1a ). Glycolysis-related genes were generally down-regulated under stress ( Fig. S1b ). Transcripts of raffinose synthesis genes...”
- More
XNR_0140 sugar porter family MFS transporter from Streptomyces albidoflavus
32% identity, 58% coverage
- Insights into naturally minimised Streptomyces albus J1074 genome
Zaburannyi, BMC genomics 2014 - “...36 ]. Genes are present for efflux proteins for daunorubicin (XNR_2457-58, XNR_4042-43), camphor (XNR_2486-87), bicyclomycin (XNR_0140), tetracycline (XNR_3352) and one putative macrolide glycosyltransferase (XNR_4394). S. albus contains two genes for tryptophanyl-tRNA synthetase: XNR_3910 and XNR_3513, of which the latter is an ortholog of indolmycin-resistant Trp-synthetase from...”
AT2G20780 mannitol transporter, putative from Arabidopsis thaliana
29% identity, 58% coverage
- Transcriptomic and proteomic approach to identify differentially expressed genes and proteins in Arabidopsis thaliana mutants lacking chloroplastic 1 and cytosolic FBPases reveals several levels of metabolic regulation
Soto-Suárez, BMC plant biology 2016 - “...family proteins (At3g05155, At4g04760, At3g19940) were up-regulated in cyfbp rosettes, and only a mannitol transporter (At2g20780) was down-regulated. Finally, a carbohydrate transmembrane transporter (At1g08930) and two UDP-galactose transporters (At4g23010 and At3g59360) were up-regulated in cyfbp roots, whereas two monosaccharide transporters were down-regulated in this organ (At1g34580...”
- Identification of miRNAs and Their Targets in the Liverwort Marchantia polymorpha by Integrating RNA-Seq and Degradome Analyses
Lin, Plant & cell physiology 2016 - “...LW9386 NA AT1G48380 HYPOCOTYL 7 LW28862 NA EFJ23241 NA LW798 NA AT2G27290 NA LW8919 NA AT2G20780 Carbohydrate transmembrane transporter activity LW3390 NA AT1G55350 DEFECTIVE KERNEL 1 LW2282 NA AT4G38160 PIGMENT DEFECTIVE 191 LW3379 NA AT1G75200 Radical SAM domain-containing protein LW769 NA AT5G47390 MYB HYPOCOTYL ELONGATION-RELATED Mpo-miR11698.1...”
- A meta-analysis reveals the commonalities and differences in Arabidopsis thaliana response to different viral pathogens
Rodrigo, PloS one 2012 - “...performed in Col-0. Only seven genes ( At1g14970 , At1g50250 , At1g78170 , At2g16700 , At2g20780 , At3g45860 , and At4g12520 ) had expression levels that were significantly affected by the host ecotype (Mann-Whitney test). However, if a correction for multiple testing (FDR procedure; adjusted P...”
- The Vitis vinifera sugar transporter gene family: phylogenetic overview and macroarray expression profiling
Afoufa-Bastien, BMC plant biology 2010 - “...(AtINT3), At4g16480 (AtINT4), At3g03090 (AtVGT1), At5g17010 (AtVGT2), At5g59250 (AtVGT3), At2g16120 (AtPMT1), At2g16130 (AtPMT2), At2g18480 (AtPMT3), At2g20780 (AtPMT4), At3g18830 (AtPMT5), At4g36670 (AtPMT6); for Vitis ones see Additional file 1 . Vitis ORFs names were simplified, Vv indicating GSVIVT000. Vitis vinifera putative Polyol/Monosaccharide Transporters (VvPMT; subfamily III) Five...”
XP_002313809 polyol transporter 5 from Populus trichocarpa
29% identity, 55% coverage
XP_021757156 plastidic glucose transporter 4-like from Chenopodium quinoa
34% identity, 53% coverage
- Salinity Effects on Guard Cell Proteome in Chenopodium quinoa
Rasouli, International journal of molecular sciences 2021 - “...channel subunit beta Potassium XP_021753247 monosaccharide-sensing protein 2-like Sugar XP_021726328 sugar carrier protein C-like Sugar XP_021757156 plastidic glucose transporter 4-like Sugar XP_021760460 sucrose transport protein-like isoform X1 Sucrose XP_021752898 chloride channel protein CLC-b-like anions XP_021739774 ATPase ASNA1 homolog anions XP_021772050 ADP, ATP carrier protein 1, mitochondrial-like...”
FVEG_02081 hypothetical protein from Fusarium verticillioides 7600
30% identity, 59% coverage
- Involvement of FST1 from Fusarium verticillioides in virulence and transport of inositol
Niu, Molecular plant pathology 2017 (secret) - Transcriptome changes in Fusarium verticillioides caused by mutation in the transporter-like gene FST1
Niu, BMC microbiology 2015 - “...genome with the yeast ITR1p sequence identified eight genes with high sequence similarity (FVEG_01519, FVEG_01638, FVEG_02081, FVEG_03992, FVEG_06504, FVEG_07757, FVEG_11293, and FVEG_12687). The sequence of FST1 was not identified by the search. Among the eight identified genes, expression was significantly down-regulated in fst1 for FVEG_06504 (named...”
NP_708708 MFS family galactose:proton symporter from Shigella flexneri 2a str. 301
31% identity, 53% coverage
CAC1339 Possible sugar-proton symporter from Clostridium acetobutylicum ATCC 824
CA_C1339 sugar porter family MFS transporter from Clostridium acetobutylicum ATCC 824
31% identity, 51% coverage
- Biochemical routes for uptake and conversion of xylose by microorganisms
Zhao, Biotechnology for biofuels 2020 - “...transporter are not detected in the chromosome of C. acetobutylicum , and only several genes (CAC1339, CAC1345, CAC1530, CAC3422 and CAC3451) encoding sugar-proton symporters are identified [ 20 , 21 ]. These above symporter genes are distributed in the different parts of the chromosome, and located...”
- Development of an inducible transposon system for efficient random mutagenesis in Clostridium acetobutylicum
Zhang, FEMS microbiology letters 2016 - “...Minton ( 2015 ) pMTL82254-Pcac1339 Clostridium modular plasmid with catP reporter expressed by promoter of cac1339, pBP1 (Gram + origin), ColE1+ tra (Gram origin), Em r This study pMTL82254-Pcac1344 Clostridium modular plasmid with catP reporter expressed by promoter of cac1344, pBP1 (Gram + origin), ColE1+ tra...”
- “...pBP1 with pCB102 replicon This study pMTL-YG3 Derived from pMTL-YG0 by introducing the promoter of cac1339 to express the transposase Himar1 C9 This study a hsdR , host-specific restriction deficient; mcr , methylcytosine-specific restriction abolished; recA1 , homologous recombination abolished; endA1 , endonucleases abolished; Spe r...”
- Sugar uptake by the solventogenic clostridia
Mitchell, World journal of microbiology & biotechnology 2016 - “...in both C. acetobutylicum and C. beijerinckii. Three symporters in C. acetobutylicum , encoded by cac1339 , cac1345 and cac3451 , have been shown to be induced under conditions in which xylose is being used as a substrate (Grimmler et al. 2010 ; Servinsky et al....”
- “...al. 2015 ). In the case of arabinose, a gene cluster in C. acetobutylicum ( cac1339 cac1349 ) has been shown to be under control of a putative AraR regulator, and some of the genes in this region including cac1339 were found to be induced by...”
- Ribulokinase and transcriptional regulation of arabinose metabolism in Clostridium acetobutylicum
Zhang, Journal of bacteriology 2012 - “...araA (CAC1342 and CAC1346), araD (CAC1341), and araE (CAC1339 and CAC1345) genes in the araR-inactivated mutant were elevated more than 17-fold compared to that...”
- “...poorly explored family (Y. Zhang, personal communication). The CAC1339 to -1349 gene cluster in the C. acetobutylicum genome includes genes for two AraA...”
- Pleiotropic functions of catabolite control protein CcpA in Butanol-producing Clostridium acetobutylicum
Ren, BMC genomics 2012 - “...cluster contains most of the genes necessary for l -arabinose uptake and metabolism, including araE1/araE2 (CAC1339 and CAC1345, encoding l -arabinose-proton symporter), araA1/araA2 (CAC1342 and CAC1346, encoding l -arabinose isomerase), araK (CAC1344, encoding ribulokinase) [ 44 ], araD (CAC1341, encoding l -ribulose-5-phosphate 4-epimerase), epi (CAC1349, encoding...”
- Confirmation and elimination of xylose metabolism bottlenecks in glucose phosphoenolpyruvate-dependent phosphotransferase system-deficient Clostridium acetobutylicum for simultaneous utilization of glucose, xylose, and arabinose
Xiao, Applied and environmental microbiology 2011 - “...isomerase; xylB (cac2612), xylulokinase; araE (cac1339), L-arabinose transporter; araA (cac1342, cac1346), L-arabinose isomerase; araB (cac1344?),...”
- “...Only putative D-xylose and undefined sugar symporters (cac1339, cac3422, and cac1345) were observed. In general, symporters exhibit much lower affinity for...”
- Alleviation of Carbon Catabolite Repression through araR and xylR Inactivation in Clostridium acetobutylicum DSM 792
Delarouzée, Applied and environmental microbiology 2023 (secret) - Arabinose-Induced Catabolite Repression as a Mechanism for Pentose Hierarchy Control in Clostridium acetobutylicum ATCC 824
Servinsky, mSystems 2018 - “...( 14 , 19 ). Rodionov et al. identified AraR (CA_C1340) binding sites upstream of CA_C1339, CA_C1340, the predicted CA_C1341-CA_C1342 operon, CA_C1343, the predicted CA_C1344-CA_C1349 operon, and the predicted CA_C1529-CA_C1530 operon ( 28 ). The binding of AraR to these sites was confirmed by EMSA, and...”
- “...on arabinose than in xylose or glucose cultures ( 9 ). One notable exception is CA_C1339, a proposed xylose importer gene, which has a unique transcription profile with high mRNA levels in cells grown on xylose, moderate levels for those on arabinose, and extremely low levels...”
XP_001387138 sugar transporter, putative from Scheffersomyces stipitis CBS 6054
A3GHU5 Sugar transporter, putative from Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)
27% identity, 57% coverage
- Genetic basis of the highly efficient yeast Kluyveromyces marxianus: complete genome sequence and transcriptome analyses
Lertwattanasakul, Biotechnology for biofuels 2015 - “...Ci_GXF1, GN107179; Ps_SUT1, XP_001387898; Ps_SUT2, XP_001384295; Ps_SUT3, XP_001386019; Ps_HXT2.4, XP_001387757; Ps_XUT1, XP_001385583; Ps_XUT2, XP_001387242; Ps_XUT3, XP_001387138; Ps_XUT4, XP_001386715; Ps_XUT5, XP_001385962; Ps_XUT6, XP_001386589; Ps_XUT7, XP_001387067; Ps_RGT2, XP_001386588; Ps_SLT1, XP_001383774; Kl_KHT1/RAG1, XP_453656; Kl_KHT2, GN107317; Kl_KHT3, XP_454897; Kl_FRT1, XP_454356; Kl_HGT1, XP_451484; Kl_HXT1, XP_455078; Kl_HXT14, XP_454897; Kl_HXT2, XP_453960; Kl_HXT3, XP_453088;...”
- Advances in fungal sugar transporters: unlocking the potential of second-generation bioethanol production
Pereira, Applied microbiology and biotechnology 2025 - “...S. stipitis Young et al. ( 2011 ); Watanabe et al. ( 2016 ) XUT3 A3GHU5 Glucose, xylose, D-arabinose, L-arabinose, galactose, fructose, and mannose S. stipitis Young et al. ( 2011 ); Watanabe et al. ( 2016 ) The specificity of fungal STs is closely related...”
- Functional survey for heterologous sugar transport proteins, using Saccharomyces cerevisiae as a host
Young, Applied and environmental microbiology 2011 - “...XUT6 Q6CFJ6 A3LY79 XUT5 Q6CG30 A3M0B9 XUT4 YALI0B01342 A3GHU5 XUT3 BLAST BLAST BLAST BLAST BLAST NCBI NCBI NCBI; intron-free version synthesized by Blue Heron...”
AFUA_2G07910 myo-inositol transporter from Aspergillus fumigatus Af293
29% identity, 60% coverage
- Conservation of nucleosome positions in duplicated and orthologous gene pairs
Nishida, TheScientificWorldJournal 2012 - “...AFUA_4G13340 0.094260129 YHR215W AFUA_6G11330 0.092128581 YKL013C AFUA_6G02370 0.088958318 YOR043W AFUA_4G06130 0.087990985 YPR062W AFUA_1G05050 0.087018417 YDR497C AFUA_2G07910 0.078863767 YDR477W AFUA_2G01700 0.074801159 YLR378C AFUA_5G08130 0.074624328 YBR060C AFUA_5G08110 0.073589072 YGL120C AFUA_5G11620 0.069009268 YIL063C AFUA_2G10810 0.06328373 YOL157C AFUA_7G06380 0.06047767 YGL043W AFUA_3G07670 0.059398891 YMR027W AFUA_5G06710 0.058232831 YHR215W AFUA_8G01910 0.05787337 YDL247W AFUA_7G05190...”
ITR1_CANAL / A0A1D8PH98 Myo-inositol transporter 1 from Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) (see paper)
ITR1 myo-inositol transporter 2 from Candida albicans (see paper)
26% identity, 53% coverage
- function: Major transporter for myo-inositol.
catalytic activity: myo-inositol(out) + H(+)(out) = myo-inositol(in) + H(+)(in) (RHEA:60364)
disruption phenotype: Decreases myo-inositol import into cell (PubMed:18268031). Virulence is not affected in a mouse model of disseminated infection (PubMed:18268031). Simultaneous disruption of INO1 results in lethality (PubMed:18268031). - CharProtDB CGD description: Inositol transporter required for uptake of exogenous inositol; major facilitator superfamily; 12 probable transmembrane motifs; expressed in rich medium; fluconazole, caspofungin downregulated; possibly essential gene (by UAU1 method)
LOC101247786 probable polyol transporter 6 from Solanum lycopersicum
28% identity, 56% coverage
F7308_1395 sugar porter family MFS transporter from Francisella salina
30% identity, 51% coverage
- Genetic diversity within the genus Francisella as revealed by comparative analyses of the genomes of two North American isolates from environmental sources
Siddaramappa, BMC genomics 2012 - “...213 aa, 37%, 4e-34 F7308_1394 (471 aa) Glucuronate isomerase (UxaC) Sde_1272, 471 aa, 51%, 3e-140 F7308_1395 (463 aa) D-xylose-proton symporter (XylT) CBUD_1731, 463 aa, 43%, 3e-91 F7308_1396 (325 aa) Inositol oxygenase 56727 Miox, 285 aa, 37%, 3e-47 Lactose metabolism 4 Fphi_0309 (655 aa) Beta-galactosidase BMD_1886, 651...”
TC 2.A.1.1.106 / P46333 Probable metabolite transport protein CsbC from Bacillus subtilis (strain 168) (see 3 papers)
32% identity, 53% coverage
- substrates: Metabolites
- Major facilitator superfamily
Pao, Microbiology and molecular biology reviews : MMBR 1998 - “...P09830 P45598 P37021 P21906 P15729 U29579 X86780 P09098 P31578 P54723 U66480 P46333 P42417 P37514 SP SP SP SP SP GB GB SP SP SP GB SP SP SP Ar Sulfolobus...”
HMT12_CAEEL / Q9XXQ9 Proton myo-inositol cotransporter hmit-1.2; H(+)-myo-inositol cotransporter hmit-1.2; H(+)-myo-inositol symporter hmit-1.2 from Caenorhabditis elegans (see paper)
NP_507624 Proton myo-inositol cotransporter hmit-1.2 from Caenorhabditis elegans
24% identity, 91% coverage
TC 2.A.1.1.32 / P15729 Glucose/fructose:H+ symporter, GlcP (see 4 papers)
sll0771 glucose transport protein from Synechocystis sp. PCC 6803
32% identity, 56% coverage
- substrates: fructose, glucose
- The genome sequence of Synechocystis sp. PCC 6803 substrain GT-T and its implications for the evolution of PCC 6803 substrains
Koskinen, FEBS open bio 2023 - “...slr1635 Transposase 2044508 ATCAAC Insertion Ile225Asn226 sll1533 pilT2 Pilus retraction protein 2398167 C frameshift G28 sll0771 glcP Glucose transporter 2465926 G T Gln194Lys sll0020 clcP Clp protease ATP binding subunit 2786264 G A Ala61Thr slr0914 Hypothetical protein 3276804 A Intergenic between ORFs sll1342slr1423 The long deletion...”
- “...replicates and the error bars denote SEM. The second frameshift mutation is located in the sll0771 gene that encodes a glucose transporter [ 34 ]. To test whether our GTT strain is able to use externally added glucose, we grew the GTT substrain in photoheterotrophic conditions...”
- CP12 fine-tunes the Calvin-Benson cycle and carbohydrate metabolism in cyanobacteria
Lucius, Frontiers in plant science 2022 - “...might be responsible for the reduced glucose consumption of mutant cp12 , the glucose transporter (Sll0771) and glucose-kinase (Sll0593) encoding genes were sequenced revealing that these genes had identical sequences in mutant as in WT (data not shown). Like mutant cp12 , the strains with mutated...”
- In vivo Inhibition of the 3-Dehydroquinate Synthase by 7-Deoxysedoheptulose Depends on Promiscuous Uptake by Sugar Transporters in Cyanobacteria
Rapp, Frontiers in microbiology 2021 - “...sp. PCC 6803 GT Synechocystis sp. PCC 6803 GT-7dSh R Synechocystis sp. PCC 6803 GT sll0771 :: spec R Synechococcus sp. PCC 7002 Synechococcus sp. PCC 6312 Pleurocapsa minor SAG 4.99 Stanieria cyanosphaera SAG 33.87 Phormidium molle SAG 26.99 Leptolyngbya boryana PCC 6306 Oscillatoria acuminata PCC...”
- “...strain was isolated and then used for bioactivity assays and sequencing (single genes: gtr / sll0771 in Synechocystis sp., frtRABC in A. variabilis , and whole genome sequencing in S. elongatus ). Cloning, Expression, Purification, and Activity of the DHQS From A. variabilis The 3-dehydroquinate synthase...”
- Draft genome sequence of Actinotignum schaalii DSM 15541T: Genetic insights into the lifestyle, cell fitness and virulence
Yassin, PloS one 2017 - “...identities with the glucose transporter GlcP (SCO5578) from Streptomyces coelicolor A3 [ 2 ] and (sll0771) from Synechocystis sp. PCC 6803, respectively. The gene ( G444DRAFT_01316 ), which is annotated as minor myo -inositol:H+ symporter (IolF), clustered with the rhamnose utilization genes rhaDBAMR ( S7 Fig...”
- Metabolic Engineering and Comparative Performance Studies of Synechocystis sp. PCC 6803 Strains for Effective Utilization of Xylose
Ranade, Frontiers in microbiology 2015 - “...possessing non-native transporters was due to activities of both endogenous and heterologous transporters. GlcP ( sll0771 ) is the only known MFS-type glucose transporter identified in Synechocystis ( Lee et al., 2015 ), and this transporter shows an affinity for fructose as well ( Zhang et...”
- Functional proteomic discovery of Slr0110 as a central regulator of carbohydrate metabolism in Synechocystis species PCC6803
Gao, Molecular & cellular proteomics : MCP 2014 - “...using a similar procedure. To create a 6x His-tagged sll0771 knockin construct, a 552-bp DNA fragment at the 3 terminal and before the stop codon of sll0771...”
- “...the mutant, including the only glucose transporter (GlcP, Sll0771) encoded by the Synechocystis genome (Fig. 5A and supplemental Fig. S6) (40, 41). To further...”
- Plasma membrane aquaporin AqpZ protein is essential for glucose metabolism during photomixotrophic growth of Synechocystis sp. PCC 6803
Akai, The Journal of biological chemistry 2011 - “...Mutants--In this study, several mutant strains (glcP (sll0771), sll1961, and aqpZ/glcP) were generated by homologous recombination using plasmids described...”
- Global transcriptional response of the alkali-tolerant cyanobacterium Synechocystis sp. strain PCC 6803 to a pH 10 environment
Summerfield, Applied and environmental microbiology 2008 - “...1.6 1.7 1.9 2.7 1.2 Transport and binding proteins sll0689 sll0771 slr0753 slr0875 slr2057 nhaS3 glcP Transport mscL apqZ 2.1 1.7 1.3 1.4 1.9 1.4 1.5 1.3 1.5...”
- More
- Major facilitator superfamily
Pao, Microbiology and molecular biology reviews : MMBR 1998 - “...491 220 482 419 388 439 451 P09830 P45598 P37021 P21906 P15729 U29579 X86780 P09098 P31578 P54723 U66480 P46333 P42417 P37514 SP SP SP SP SP GB GB SP SP SP GB...”
- Cloning, functional analysis, and transcriptional regulation of the Bacillus subtilis araE gene involved in L-arabinose utilization
Sá-Nogueira, Journal of bacteriology 1997 - “...from E. coli, P09098; GlcP from Synechocystis sp. (S.sp.), P15729; Glf from Z. mobilis (Z.m.), P21906. VOL. 179, 1997 B. SUBTILIS araE GENE IN L-ARABINOSE...”
NP_193879 sugar transporter protein 12 from Arabidopsis thaliana
AT4G21480 carbohydrate transmembrane transporter/ sugar:hydrogen symporter from Arabidopsis thaliana
27% identity, 57% coverage
- Sugar Transporter STP7 Specificity for l-Arabinose and d-Xylose Contrasts with the Typical Hexose Transporters STP8 and STP12.
Rottmann, Plant physiology 2018 - GeneRIF: STP12 is hexose symporter.STP12 gene expression and subcellular localization.
- Engineering plant immune circuit: walking to the bright future with a novel toolbox
Vuong, Plant biotechnology journal 2023 - “...) Pathogen: Nematode 72 AtWRKY23 AT2G47260 RNAi H.schachtii Grunewald etal .( 2008 ) 73 STP12 AT4G21480 TDNA insertion H.schachtii Hofmann etal .( 2009 ) 74 PME3 AT3G14310 TDNA insertion H.schachtii Hewezi etal .( 2008 ) 75 RPE AT5G61410 TDNA insertion M.incognita Favery etal .( 1998 )...”
- Genome-wide identification, expression, and association analysis of the monosaccharide transporter (MST) gene family in peanut (Arachis hypogaea L.)
Wan, 3 Biotech 2020 - “...(AT1G11260) AhMST13 AhMST13 AhMST9 AtVGT1 (AT3G03090) STP12 (AT4G21480) AtINT4 (AT4G16480) Uptake of extracellular sugars by the embryo and in seedlings...”
- “...AhMST16 AhMST41 AhMST54 AhMST69 AtSTP11 (AT5G23270) STP12 (AT4G21480) AtINT2 (AT1G30220) AtPMT1 (AT2G16120) Stadler et al. (2003), Sherson et al. (2000, 2010)...”
- Plant glucose transporter structure and function
Geiger, Pflugers Archiv : European journal of physiology 2020 - “...tubes Plasma membrane Glucose, galactose, mannose, xylose, arabinose High [ 122 , 132 ] AtSTP12 At4g21480 Multiple tissues except pollen Plasma membrane Glucose, galactose, mannose, xylose High [ 123 ] AtSTP13 At5g26340 Source leaves, vascular tissue of emerging petals, roots, guard cells, cotyledons Plasma membrane Glucose,...”
- Genome-Wide Identification and Expression Profiling of Sugar Transporter Protein (STP) Family Genes in Cabbage (Brassica oleracea var. capitata L.) Reveals their Involvement in Clubroot Disease Responses
Zhang, Genes 2019 - “...Bol009461 Scaffold000233 MF1 1521 506 54.43 9.28 30.06 109.13 0.69 cell membrane tPCK4 U AtSTP12 AT4G21480 1509 502 BoSTP12 Bol028422 C01 LF 1542 513 56.62 8.70 30.38 106.57 0.56 cell membrane Clade II tPCK2 F AtSTP4 AT3G19930 1545 514 BoSTP4a Bol018147 C05 LF 1545 514 57.12...”
- Recent and ancient signature of balancing selection around the S-locus in Arabidopsis halleri and A. lyrata
Roux, Molecular biology and evolution 2013 - “...(2005) At4g21440 42.03 46 26 479 115 ATM4/ATMYB102; DNA binding/transcription factor This study This study At4g21480 59.43 60 38 548 132 Glucose transporter This study This study At4g21550 110.11 56 36 430 97 Transcriptional factor B3 family protein This study This study At4g21620 156.29 48 38...”
- “...supplementary table S1 , Supplementary Material online). Unexpectedly, one of the distant flanking region loci, At4g21480 , which is approximately 60 Kb downstream from the S-locus showed a significant excess of polymorphism for both diversity estimators in A. halleri with four highly diverged haplogroups, each consisting...”
- The pectin lyases in Arabidopsis thaliana: evolution, selection and expression profiles
Cao, PloS one 2012 - “...(AT2G13650), AtSTP2 (AT1G07340) and AtSTP9. In addition, two other sugar transporters, AtSTP14 (AT1G77210) and AtSTP12 (AT4G21480) might be the potential interactors of the pectin lyases, AT1G43080 and AT5G44830, respectively. Thus, whether sugar transportation could serve as a link to pectin degradation process was a suggestive direction...”
- The Vitis vinifera sugar transporter gene family: phylogenetic overview and macroarray expression profiling
Afoufa-Bastien, BMC plant biology 2010 - “...(AtSTP4), At1g34580 (AtSTP5), At3g05960 (AtSTP6), At4g02050 (AtSTP7), At5g26250 (AtSTP8), At1g50310 (AtSTP9), At3g19940 (AtSTP10), At5g23270 (AtSTP11), At4g21480 (AtSTP12), At5g26340 (AtSTP13), At1g77210 (AtSTP14); for Vitis ones see Additional file 1 . Vitis vinifera putative Tonoplast Monosaccharide Transporters (VvTMT; subfamily II) We have also identified three ORFs, which show...”
- Diversity and activity of sugar transporters in nematode-induced root syncytia
Hofmann, Journal of experimental botany 2009 - “...was used to detect transcripts. Primers were selected using Primer Express v2.0 Software (Applied Biosystems): At4g21480 for, tgtgccgttgtatctctcgg; rev, cgctagcctaaattgacctctctc; E =0.88; R 2 =0.990; At5g17520 for, ggtctttatctggatggacagcaac; rev, agccacatcaaatcacggataaata; E =0.83; R 2 =0.994; At1g61800 for, ctctgttcccggtcgctgta; rev: ccccataaacccagtgatgttg; E =0.83; R 2 0.991; At5g27350...”
- “...as described in Hofmann et al. (2008) . Mutant screening The T-DNA insertion mutant for At4g21480 (N518163) was from the Nottingham Arabidopsis Stock Centre (NASC; http://arabidopsis.info ). Genomic DNA and total RNA were isolated from plants grown on MS medium containing 30g l 1 kanamycin. Gene-specific...”
Q9SBA7 Sugar transport protein 8 from Arabidopsis thaliana
NP_197997 Major facilitator superfamily protein from Arabidopsis thaliana
AT5G26250 sugar transporter, putative from Arabidopsis thaliana
29% identity, 58% coverage
- Prioritising candidate genes causing QTL using hierarchical orthologous groups
Warwick, Bioinformatics (Oxford, England) 2018 - “...2.4. The second, ARATH16587 , is not. This OMA identifier maps to the UniProtKB entry Q9SBA7 , which has a recommended protein name of Sugar transport protein 8 ( The UniProt Consortium, 2017b ). Figure6 shows the propagation from ARATH09154 , which leads to the increase...”
- Sugar Transporter STP7 Specificity for l-Arabinose and d-Xylose Contrasts with the Typical Hexose Transporters STP8 and STP12.
Rottmann, Plant physiology 2018 - GeneRIF: At5g26250 (STP8) gene expression and subcellular localization.
- Transcriptome analysis of Pará rubber tree (H. brasiliensis) seedlings under ethylene stimulation
Nakano, BMC plant biology 2021 - “...bx025866 AT5G61520 AtSTP3 1.85 2.64 1.17 1 bx012963 AT5G61520 AtSTP3 2.52 1.96 0.72 0 bx006914 AT5G26250 AtSTP8 1.85 0.26 2.76 1 bx027564 AT5G26340 AtSTP13 5.35 5.31 2.58 2 bx055460 AT1G77210 AtSTP14 3.04 3.23 2.81 H+-Symporter family for polyols and monosaccharides (plasma membrane) 0 bx046600 AT2G18480 AtPLT3...”
- Plant glucose transporter structure and function
Geiger, Pflugers Archiv : European journal of physiology 2020 - “...high cell wall turnover except pollen Plasma membrane Arabinose, xylose High [ 123 ] AtSTP8 At5g26250 Pollen grains, pollen tubes, and ovules Plasma membrane Glucose, galactose, mannose, arabinose High [ 122 , 123 ] AtSTP9 At1g50310 Fully developed pollen grain Plasma membrane Glucose, galactose, arabinose High...”
- Genome-Wide Identification and Expression Profiling of Sugar Transporter Protein (STP) Family Genes in Cabbage (Brassica oleracea var. capitata L.) Reveals their Involvement in Clubroot Disease Responses
Zhang, Genes 2019 - “...Bol034076 Scaffold000040 MF2 1527 508 55.71 8.33 30.72 112.48 0.61 cell membrane tPCK7 Q AtSTP8 AT5G26250 1524 507 BoSTP8 Bol022297 C06 LF 1452 483 53.34 8.94 32.79 112.63 0.64 cell membrane Clade IV tPCK5 O AtSTP7 AT4G02050 1542 513 BoSTP7a Bol030687 C03 MF1 1542 513 55.76...”
- Transcriptomic Analysis of Soil-Grown Arabidopsis thaliana Roots and Shoots in Response to a Drought Stress
Rasheed, Frontiers in plant science 2016 - “...(MFS) transporters [ AT1G08900, AT1G30560, AT1G33440, AT1G72140, AT1G80530, AT2G26690, AT2G34355, AT3G20460, AT3G45680, AT3G47960, AT4G19450, STP8 (AT5G26250), AT5G27350 , and AT5G62680 ], MATE efflux transporters ( AT1G71140, AT5G17700, AT5G19700 , and AT5G38030 ), microRNA genes [ MIR156b ( AT4G30972), MIR161 ( AT1G48267 ), MIR162b ( AT5G2306 5),...”
- Comprehensive analysis of tobacco pollen transcriptome unveils common pathways in polar cell expansion and underlying heterochronic shift during spermatogenesis
Hafidh, BMC plant biology 2012 - “...finger), DUO1 Activated Unknown protein (DAU1), a NAC domain-containing protein 74 (anac074), a sugar transporter (AT5G26250), and a heavy-metal-associated domain-containing protein (AT1G51090). Given the demonstrated role of DUO1, these genes are also likely to be regulators of sperm cell fate specification in tobacco. We verified expression...”
- The Vitis vinifera sugar transporter gene family: phylogenetic overview and macroarray expression profiling
Afoufa-Bastien, BMC plant biology 2010 - “...are: At1g11260 (AtSPT1), At1g07340 (AtSTP2), At5g61520 (AtSTP3), At3g19930 (AtSTP4), At1g34580 (AtSTP5), At3g05960 (AtSTP6), At4g02050 (AtSTP7), At5g26250 (AtSTP8), At1g50310 (AtSTP9), At3g19940 (AtSTP10), At5g23270 (AtSTP11), At4g21480 (AtSTP12), At5g26340 (AtSTP13), At1g77210 (AtSTP14); for Vitis ones see Additional file 1 . Vitis vinifera putative Tonoplast Monosaccharide Transporters (VvTMT; subfamily II)...”
P54723 Putative metabolite transport protein YfiG from Bacillus subtilis (strain 168)
32% identity, 53% coverage
- Major facilitator superfamily
Pao, Microbiology and molecular biology reviews : MMBR 1998 - “...439 451 P09830 P45598 P37021 P21906 P15729 U29579 X86780 P09098 P31578 P54723 U66480 P46333 P42417 P37514 SP SP SP SP SP GB GB SP SP SP GB SP SP SP Ar...”
PPYC1_19055 sugar porter family MFS transporter from Paenibacillus polymyxa
30% identity, 53% coverage
- Transcriptome Profiles Reveal the Growth-Promoting Mechanisms of Paenibacillus polymyxa YC0136 on Tobacco (Nicotiana tabacum L.)
Liu, Frontiers in microbiology 2020 - “...interaction. Four genes involved in ABC transport were down-regulated by 1.542.60 times. Two genes ( PPYC1_19055 and PPYC1_22815 ) involved in MFS transfer were down-regulated by 1.67 times and 4.69 times, respectively. These benefit the growth of strain YC0136 by absorbing nutrients. TABLE 5 Effects of...”
- “...transporter permease PPYC1_02025 1.54 Amino acid ABC transporter substrate-binding protein PPYC1_01710 1.58 ABC transporter permease PPYC1_19055 1.67 araE MFS transporter PPYC1_00995 1.72 PTS sugar transporter subunit IIB PPYC1_13110 2.04 znuB Metal ABC transporter permease PPYC1_13115 2.6 znuC Metal ABC transporter ATP-binding protein PPYC1_00515 3.13 smr QacE...”
TC 2.A.1.1.53 / Q8NTX0 Myo-Inositol uptake porter, IolT1 (Km=0.2mM) from Corynebacterium glutamicum (Brevibacterium flavum) (see paper)
cg0223 metabolite transport protein from Corynebacterium glutamicum ATCC 13032
NCgl0178 sugar porter family MFS transporter from Corynebacterium glutamicum ATCC 13032
33% identity, 55% coverage
- substrates: glucose, myo-inositol
tcdb comment: Can also transport D-glucose (Ikeda et al. 2011) - HrrSA orchestrates a systemic response to heme and determines prioritization of terminal cytochrome oxidase expression
Keppel, Nucleic acids research 2020 - “...EIIGlc of PTS 70 1.6 1.1 0.1 cg2091 ppgG Polyphosphate glucokinase 199 266 0.2 0.8 cg0223 iolT1 Myo-Inositol transporter 1, alternative glucose uptake system 73 2.0 1.0 0.7 Signal transduction cg0986 amtR Master regulator of nitrogen control, repressor, TetR-family 366 1.8 0.3 0.1 Cg2461 benR Transcriptional...”
- Identifying the Growth Modulon of Corynebacterium glutamicum
Haas, Frontiers in microbiology 2019 - “...and ptsI (cg2117), encoding the glucose uptake system as well as the gene encoding iolT1 (cg0223) which has been shown to also enable glucose uptake. Genes ppgk (cg2091) and cg2932 , which encode glucokinases were also in cluster 1. Interestingly, gpmA (cg0482) and pgm (cg2800) were...”
- Impact of CO2/HCO3- Availability on Anaplerotic Flux in Pyruvate Dehydrogenase Complex-Deficient Corynebacterium glutamicum Strains
Krüger, Journal of bacteriology 2019 (secret) - Complex regulation of the phosphoenolpyruvate carboxykinase gene pck and characterization of its GntR-type regulator IolR as a repressor of myo-inositol utilization genes in Corynebacterium glutamicum
Klaffl, Journal of bacteriology 2013 - “...cg0202 cg0203 cg0204 cg0205 cg0206 cg0207 cg0210 cg0223 cg1069 cg1595 cg1935 NCgl0155 NCgl0156 NCgl0157 NCgl0158 NCgl0159 NCgl0160 NCgl0161 NCgl0162 NCgl0163...”
- “...likely cotranscribed as an operon. The iolT1 gene (cg0223) encoding myo-inositol transporter 1 is located further downstream in a divergent orientation. The...”
- Phosphotransferase system-independent glucose utilization in corynebacterium glutamicum by inositol permeases and glucokinases
Lindner, Applied and environmental microbiology 2011 - “...(cg2121) and ppgK (cg2091) In-frame deletions of iolT1 (cg0223) and iolT2 (cg3387) In-frame deletions of iolT1 (cg0223), iolT2 (cg3387), and hpr (cg2121)...”
- “...Derived from pEKEx3, for regulated expression of iolT1 (cg0223) of C. glutamicum Derived from pEKEx3, for regulated expression of iolT2 (cg3387) of C....”
- A Futile Metabolic Cycle of Fatty Acyl-CoA Hydrolysis and Resynthesis in Corynebacterium glutamicum and Its Disruption Leading to Fatty Acid Production
Ikeda, Applied and environmental microbiology 2021 - “...and WTfasRtesA, respectively, were used as host strains to replace the chromosomal iolT1 gene (Cgl0181, NCgl0178), which is expressed under the control of its native myo -inositol-inducible promoter ( 43 ), with the tesA gene. For this gene replacement, plasmid pCPiolT1-tesA was constructed as follows. The...”
- Complex regulation of the phosphoenolpyruvate carboxykinase gene pck and characterization of its GntR-type regulator IolR as a repressor of myo-inositol utilization genes in Corynebacterium glutamicum
Klaffl, Journal of bacteriology 2013 - “...NCgl0159 NCgl0160 NCgl0161 NCgl0162 NCgl0163 NCgl0164 NCgl0167 NCgl0178 NCgl0900 NCgl1353 NCgl1650 iolC cg2560 cg2732 cg3096 cg3107 cg3169 cg3195 cg3216...”
- Characterization of myo-inositol utilization by Corynebacterium glutamicum: the stimulon, identification of transporters, and influence on L-lysine formation
Krings, Journal of bacteriology 2006 - “...NCgl0161 NCgl0162 NCgl0163 NCgl0164 NCgl0167 NCgl0168 NCgl0178 NCgl0697 NCgl0916 NCgl0933 NCgl1368 NCgl1917 NCgl2477 NCgl2865 NCgl2894 NCgl2904 NCgl2951...”
Gasu_53180 MFS transporter, SP family, sugar:H+ symporter from Galdieria sulphuraria
28% identity, 62% coverage
- Cell adaptation of the extremophilic red microalga Galdieria sulphuraria to the availability of carbon sources
Perez, Frontiers in plant science 2022 - “...and the other with a basic-leucine zipper domain (Gasu_38680) as well as a sugar transporter (Gasu_53180) in addition to many hypothetical genes with unknown function. FIGURE 5 Vulcano plot of the RNA-seq results. Differential expression analysis of Galdieria sulphuraria genes when grown in heterotrophy in the...”
- “...APC and AAAP families and for sugar transporters of the MSF family. Only one gene (Gasu_53180) encoding a putative sugar transporter, is upregulated in glucose (+2.83) compared to glycerol ( Supplementary Table 4 ). Being upregulated in glucose condition compared to glycerol, this suggests that the...”
Q41144 Sugar carrier protein C from Ricinus communis
29% identity, 55% coverage
- Omics Profiles of Non-transgenic Scion Grafted on Transgenic RdDM Rootstock.
Kodama, Food safety (Tokyo, Japan) 2022 - “...aminotransferase ACS10 Q9LQ10 5.75 GTE11_ARATH Transcription factor GTE11 Q93ZB7 3.74 STC_RICCO Sugar carrier protein C Q41144 3.15 XYLT_ARATH Beta-1,2-xylosyltransferase Q9LDH0 2.98 * TIF6B_ARATH Protein TIFY 6B Q9LVI4 2.87 EIX2_SOLLC Receptor-like protein EIX2 Q6JN46 2.56 XTH8_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 8 Q8L9A9 2.30 OPT5_ARATH Oligopeptide transporter 5...”
CA_C1345 sugar porter family MFS transporter from Clostridium acetobutylicum ATCC 824
CAC1345 D-xylose-proton symporter from Clostridium acetobutylicum ATCC 824
32% identity, 51% coverage
- Alleviation of Carbon Catabolite Repression through araR and xylR Inactivation in Clostridium acetobutylicum DSM 792
Delarouzée, Applied and environmental microbiology 2023 (secret) - Harnessing lignocellulosic biomass for butanol production through clostridia for sustainable waste management: recent advances and perspectives
Palaniswamy, Frontiers in bioengineering and biotechnology 2023 - “...inactivating araR ( Clocel_1253 ) and xylR ( Clocel_0594 ) along with overexpressing xylT ( CA_C1345 ). The resulting strain could produce 4.96g/L of butanol from alkali-extracted corn cobs ( Wen et al., 2020 ). The bacterium C. tyrobutyricum ATCC 25755 was engineered by overexpressing the...”
- Production of butanol from lignocellulosic biomass: recent advances, challenges, and prospects
Guo, RSC advances 2022 - “...carbon flux from butyrate and acetate toward butyryl-CoA. Xylose metabolism was engineered by overexpressing xylT (CA_C1345) and inactivating xylR (Clocel_0594) and araR (Clocel_1253), and final production of butanol was increased to 4.96 g L 1 directly from alkali-extracted corncobs. 161 4.3 A strategy for engineering physiological...”
- Metabolic Engineering of Clostridium cellulovorans to Improve Butanol Production by Consolidated Bioprocessing
Wen, ACS synthetic biology 2020 (PubMed)- “...engineering was implemented by inactivating xylR (Clocel_0594) and araR (Clocel_1253), as well as overexpressing xylT (CA_C1345), which is expected to supply additional carbon and reducing power for CoA and butanol synthesis pathways. The final engineered strain produced 4.96 g/L of n-butanol from alkali extracted corn cobs...”
- Valorisation of xylose to renewable fuels and chemicals, an essential step in augmenting the commercial viability of lignocellulosic biorefineries
Narisetty, Sustainable energy & fuels 2021 - “...Along with XI, XK ( XylB , CAC2612), a xylose proton symporter ( XylT , CAC1345), and a transcriptional regulator ( XylR , CAC3673) were also sequenced and characterized. The C. acetobutylicum strains are well known to utilize a broad range of monosaccharides, disaccharides, starches, and...”
- Biochemical routes for uptake and conversion of xylose by microorganisms
Zhao, Biotechnology for biofuels 2020 - “...are not detected in the chromosome of C. acetobutylicum , and only several genes (CAC1339, CAC1345, CAC1530, CAC3422 and CAC3451) encoding sugar-proton symporters are identified [ 20 , 21 ]. These above symporter genes are distributed in the different parts of the chromosome, and located relatively...”
- Sugar uptake by the solventogenic clostridia
Mitchell, World journal of microbiology & biotechnology 2016 - “...C. acetobutylicum and C. beijerinckii. Three symporters in C. acetobutylicum , encoded by cac1339 , cac1345 and cac3451 , have been shown to be induced under conditions in which xylose is being used as a substrate (Grimmler et al. 2010 ; Servinsky et al. 2010 )....”
- “...al. 2012 ). It is therefore possible that the putative transporters encoded by cac1339 and cac1345 ( xylT ) are involved in uptake of both pentose sugars, but this has yet to be examined. Furthermore, expression of genes cac1529 and cac1530 encoding, respectively, a putative arabinosidase...”
- Bacterial xylanases: biology to biotechnology
Chakdar, 3 Biotech 2016 - “..., the xylose utilization pathway also includes a xylulokinase (XylB, CAC2612), a xylose proton-symporter (XylT, CAC1345), and a transcriptional regulator (XylR, CAC3673). xyn D and xyn T along with xyl genes are under transcriptional control of XylR. Bacteria are endowed with varying xylanolytic activity with distinct...”
- Ribulokinase and transcriptional regulation of arabinose metabolism in Clostridium acetobutylicum
Zhang, Journal of bacteriology 2012 - “...and CAC1346), araD (CAC1341), and araE (CAC1339 and CAC1345) genes in the araR-inactivated mutant were elevated more than 17-fold compared to that of the...”
- “...for two putative arabinose protonsymporters (CAC1339 and CAC1345), which are considered to be responsible for arabinose uptake. Our previous genetic mutagenesis...”
- Pleiotropic functions of catabolite control protein CcpA in Butanol-producing Clostridium acetobutylicum
Ren, BMC genomics 2012 - “...product Change fold (824ccpA/824WT) Middle exponential phase (M) Stationary phase (S) Microarray qRT-PCR* Microarray qRT-PCR* CAC1345 xylT l -arabinose-proton symporter 71.6 92.522.55 147.39 326.54176.86 CAC2612 xylB Xylulose kinase 26.9 20.44.00 17.9 21.210.02 CAC1348 tkt1 Transketolase 5.6 4.420.23 7.9 6.40.21 CAC1941 abrB1941 Stationary/sporulation gene regulator 5.1 89.177.31...”
- “...most of the genes necessary for l -arabinose uptake and metabolism, including araE1/araE2 (CAC1339 and CAC1345, encoding l -arabinose-proton symporter), araA1/araA2 (CAC1342 and CAC1346, encoding l -arabinose isomerase), araK (CAC1344, encoding ribulokinase) [ 44 ], araD (CAC1341, encoding l -ribulose-5-phosphate 4-epimerase), epi (CAC1349, encoding aldose 1-epimerase)...”
- Confirmation and elimination of xylose metabolism bottlenecks in glucose phosphoenolpyruvate-dependent phosphotransferase system-deficient Clostridium acetobutylicum for simultaneous utilization of glucose, xylose, and arabinose
Xiao, Applied and environmental microbiology 2011 - “...overcome by co-overexpression of the D-xylose proton-symporter (cac1345), D-xylose isomerase (cac2610), and xylulokinase (cac2612). As a result, an engineered...”
- “...promoter Derived from pIMP1-Pthl, with xylT gene (cac1345) expressing cassette added Derived from pIMP1-Pthl, with xylA gene (cac2610) expressing cassette added...”
- Reconstruction of xylose utilization pathway and regulons in Firmicutes
Gu, BMC genomics 2010 - “...acetobutylicum the xylose utilization pathway also includes a xylulokinase (XylB, CAC2612), a xylose proton-symporter (XylT, CAC1345), and a transcriptional regulator (XylR, CAC3673). The predicted functions of these genes in C. acetobutylicum were experimentally confirmed through a combination of genetic and biochemical techniques. We conclusively showed that...”
- “...of Bacilli/Clostridia have been annotated as xylose proton-symporter in the public databases ( e.g . CAC1345 of C. acetobutylicum ). In this study XylT was tentatively identified in more species such as C. beijerinckii . This functional assignment is supported by the conserved co-localization on the...”
SE0247 bicyclomycin resistance protein TcaB from Staphylococcus epidermidis ATCC 12228
30% identity, 50% coverage
GLCP_STAES / A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
SERP_RS11465 sugar porter family MFS transporter from Staphylococcus epidermidis RP62A
30% identity, 50% coverage
ITR1_SCHPO / Q10286 Myo-inositol transporter 1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see 2 papers)
itr1 / GI|1420856 myo-inositol transporter Itr1 from Schizosaccharomyces pombe (see 2 papers)
30% identity, 51% coverage
- function: Transporter for myo-inositol.
catalytic activity: myo-inositol(out) + H(+)(out) = myo-inositol(in) + H(+)(in) (RHEA:60364) - CharProtDB Source (per GeneDB): GeneDB_Spombe
STM4418 sugar (and other) transporter from Salmonella typhimurium LT2
28% identity, 53% coverage
- High binding affinity of repressor IolR avoids costs of untimely induction of myo-inositol utilization by Salmonella Typhimurium
Hellinckx, Scientific reports 2017 - “...dacB ::Kan R Allelic-exchange mutant This study 14028 iolR ::Kan R 44184436 Deletion of iolT1 (STM4418) to iolH (STM4436) in 14028 iolR ::Kan R This study MvP101 14028 with sseD :: aphT , Kan R ; allelic-exchange mutant 37 MvP101 iolR In-frame iolR (STM4417) deletion mutant...”
- Identification of novel factors involved in modulating motility of Salmonella enterica serotype typhimurium
Bogomolnaya, PloS one 2014 - “...1.580.34 STM2897 invE 1.560.30 1.41 0.51 STM3954 yigG 1.360.22 1.19 0.33 STM4212 1.14 0.24 1.470.45 STM4418 1.260.21 1.40 0.68 PSLT013 pefI 0.98 0.19 1.180.11 PSLT098 traQ 1.04 0.22 1.330.23 * - Diameter of swimming and swarming rings were measured and compared to wild type. Results are...”
- myo-Inositol transport by Salmonella enterica serovar Typhimurium
Kröger, Microbiology (Reading, England) 2010 (PubMed)- “...MI transporters of this pathogen. In-frame deletion of iolT1 (STM4418) led to a severe growth defect, and deletion of iolT1 (STM4419) to a slight growth defect...”
- “...of them (Kroger & Fuchs, 2009). Four genes, STM4418, STM4419, STM4428 and STM4434, encode putative, as yet uncharacterized, permeases. Their role in MI...”
- Genomic comparison of Salmonella enterica serovars and Salmonella bongori by use of an S. enterica serovar typhimurium DNA microarray
Chan, Journal of bacteriology 2003 - “...present in serovar Typhimurium. The region from STM4418 to STM4436 includes sugar transporters, putative endonucleases, and putative cytoplasmic proteins that...”
NP_179210 polyol/monosaccharide transporter 2 from Arabidopsis thaliana
AT2G16130 mannitol transporter, putative from Arabidopsis thaliana
28% identity, 59% coverage
- Arabidopsis thaliana POLYOL/MONOSACCHARIDE TRANSPORTERS 1 and 2: fructose and xylitol/H+ symporters in pollen and young xylem cells.
Klepek, Journal of experimental botany 2010 - GeneRIF: AtPMT1 and AtPMT2 are xylitol and fructose transporters in pollen and young xylem.
- Single-cell RNA-seq reveals a link of ovule abortion and sugar transport in Camellia oleifera
Zhao, Frontiers in plant science 2024 - “...transport both glucose and fructose ( Norholm etal., 2006 ; Liu etal., 2021b ). AtPMT2 (AT2G16130, a homologue of CoPLT2) protein is a glucose, fructose, and xylitol/H + symporter localized to the plasma membrane in pollen and young xylem cells ( Klepek etal., 2010 ). AtSUC2...”
- Arabidopsis thaliana POLYOL/MONOSACCHARIDE TRANSPORTERS 1 and 2: fructose and xylitol/H+ symporters in pollen and young xylem cells
Klepek, Journal of experimental botany 2010 - “...membrane-localized H + -symporter with broad substrate specificity. The characterization of AtPMT1 (At2g16120) and AtPMT2 (At2g16130), two other, almost identical, members of this transporter subfamily, are presented here. Expression of the AtPMT1 and AtPMT2 cDNAs in baker's yeast ( Saccharomyces cerevisiae ) revealed that these proteins...”
- “...al. , 2005 ). Two of these genes, AtPMT1 ( At2g16120 ) and AtPMT2 ( At2g16130 ), are located on chromosome 2 with their start ATGs being separated by 6881 nucleotides. Both genes are interrupted by 2 introns, and in both genes these introns are inserted...”
- The Vitis vinifera sugar transporter gene family: phylogenetic overview and macroarray expression profiling
Afoufa-Bastien, BMC plant biology 2010 - “...(AtINT1), At1g30220 (AtINT2), At2g35740 (AtINT3), At4g16480 (AtINT4), At3g03090 (AtVGT1), At5g17010 (AtVGT2), At5g59250 (AtVGT3), At2g16120 (AtPMT1), At2g16130 (AtPMT2), At2g18480 (AtPMT3), At2g20780 (AtPMT4), At3g18830 (AtPMT5), At4g36670 (AtPMT6); for Vitis ones see Additional file 1 . Vitis ORFs names were simplified, Vv indicating GSVIVT000. Vitis vinifera putative Polyol/Monosaccharide Transporters...”
- A label-free differential quantitative mass spectrometry method for the characterization and identification of protein changes during citrus fruit development
Katz, Proteome science 2010 - “...44184 AT1G61800 2 0.10 28.2 12.3 -1 -- -- 0.8 1.2 0 mannitol transporter 32978 AT2G16130 -- -- 439 18.8 -1 -- -- 5.8 3.2 0 LPT(lipid transfer protein) 45077 AT1G27950 2 0.01 5258.00 22.44 -1 -- -- -- -- -- LTP3 58907 AT5G59320 -- --...”
GOX0649 Sugar-proton symporter from Gluconobacter oxydans 621H
31% identity, 57% coverage
plt2 / CAD58710.1 polyol transporter from Plantago major (see paper)
28% identity, 57% coverage
TC 2.A.1.1.75 / Q9XIH7 The fructose/xylose:H+ symporter, PMT1 (polyol monosaccharide transporter-1). Also transports other substrates at lower rates. PMT2 is largely of the same sequence and function. Both are present in pollen and young xylem cells (Klepek et al., 2005). A similar ortholog has been identifed in pollen grains of Petunia hybrida from Arabidopsis thaliana (see 2 papers)
NP_179209 polyol/monosaccharide transporter 1 from Arabidopsis thaliana
AT2G16120 mannitol transporter, putative from Arabidopsis thaliana
27% identity, 59% coverage
- substrates: H+, Xylose, fructose
- A pair of phospho-base methyltransferases important for phosphatidylcholine biosynthesis in Arabidopsis.
Liu, The Plant journal : for cell and molecular biology 2018 (PubMed)- GeneRIF: a phospho-base methyltransferases important for phosphatidylcholine biosynthesis
- Arabidopsis thaliana POLYOL/MONOSACCHARIDE TRANSPORTERS 1 and 2: fructose and xylitol/H+ symporters in pollen and young xylem cells.
Klepek, Journal of experimental botany 2010 - GeneRIF: AtPMT1 and AtPMT2 are xylitol and fructose transporters in pollen and young xylem.
- Genome-wide identification, expression, and association analysis of the monosaccharide transporter (MST) gene family in peanut (Arachis hypogaea L.)
Wan, 3 Biotech 2020 - “...AhMST69 AtSTP11 (AT5G23270) STP12 (AT4G21480) AtINT2 (AT1G30220) AtPMT1 (AT2G16120) Stadler et al. (2003), Sherson et al. (2000, 2010) Aluri and Buttner (2007)...”
- Meta-analysis of the expression profiles of the Arabidopsis ESCRT machinery
Richardson, Plant signaling & behavior 2011 - “...sequence-specific DNA-binding transcription factor activity AT2G16120 Polyol/monosaccharide transporter 1 AT1G57906 Unknown protein AT5G52050 MATE efflux family...”
- Arabidopsis thaliana POLYOL/MONOSACCHARIDE TRANSPORTERS 1 and 2: fructose and xylitol/H+ symporters in pollen and young xylem cells
Klepek, Journal of experimental botany 2010 - “...be a plasma membrane-localized H + -symporter with broad substrate specificity. The characterization of AtPMT1 (At2g16120) and AtPMT2 (At2g16130), two other, almost identical, members of this transporter subfamily, are presented here. Expression of the AtPMT1 and AtPMT2 cDNAs in baker's yeast ( Saccharomyces cerevisiae ) revealed...”
- “...transporter AtPMT5 (At3g18830; Klepek et al. , 2005 ). Two of these genes, AtPMT1 ( At2g16120 ) and AtPMT2 ( At2g16130 ), are located on chromosome 2 with their start ATGs being separated by 6881 nucleotides. Both genes are interrupted by 2 introns, and in both...”
- The Vitis vinifera sugar transporter gene family: phylogenetic overview and macroarray expression profiling
Afoufa-Bastien, BMC plant biology 2010 - “...(AtTMT3), At2g43330 (AtINT1), At1g30220 (AtINT2), At2g35740 (AtINT3), At4g16480 (AtINT4), At3g03090 (AtVGT1), At5g17010 (AtVGT2), At5g59250 (AtVGT3), At2g16120 (AtPMT1), At2g16130 (AtPMT2), At2g18480 (AtPMT3), At2g20780 (AtPMT4), At3g18830 (AtPMT5), At4g36670 (AtPMT6); for Vitis ones see Additional file 1 . Vitis ORFs names were simplified, Vv indicating GSVIVT000. Vitis vinifera putative...”
CH1034_220103 sugar porter family MFS transporter from Klebsiella pneumoniae
30% identity, 51% coverage
KLMA_10546 high-affinity glucose transporter from Kluyveromyces marxianus DMKU3-1042
28% identity, 51% coverage
- Expansion and Diversification of MFS Transporters in Kluyveromyces marxianus
Varela, Frontiers in microbiology 2018 - “...Click here for additional data file. FIGURE S3 Recombination event leading to the formation of KLMA_10546. (A) A scheme depicting the recombination event between KMXK_A02950 and KMXK_A02930 is shown. The 5 end of KMXK_A02950 (gray) and the 3 end of KMXK_A02930 (purple) recombined to form KLMA_10546...”
- “...indicated with a red vertical line in position 230. Mismatches between the KMXK_A02950/KMXK_A02930 sequences and KLMA_10546 are shown in bold. Click here for additional data file. FIGURE S4 Construction of an HGT null mutant in K. marxianus NBRC1777. The CRISPR- Cas9 system was used to induce...”
STP1_ARATH / P23586 Sugar transport protein 1; Glucose transporter; Hexose transporter 1 from Arabidopsis thaliana (Mouse-ear cress) (see 8 papers)
TC 2.A.1.1.60 / P23586 The major hexose transporter, Htr1 (mediates the active uptake of hexoses by sugar:H+ symport. Can transport glucose, 3-O-methylglucose, fructose, xylose, mannose, galactose, fucose, 2-deoxyglucose and arabinose. Confers sensitivity to galactose in seedlings. Km=20 uM for glucose) from Arabidopsis thaliana (Mouse-ear cress) (see 14 papers)
STP1 / RF|NP_172592.1 sugar transport protein 1 from Arabidopsis thaliana (see paper)
NP_172592 sugar transporter 1 from Arabidopsis thaliana
AT1G11260 STP1 (SUGAR TRANSPORTER 1); carbohydrate transmembrane transporter/ sugar:hydrogen symporter from Arabidopsis thaliana
28% identity, 56% coverage
- function: Major hexose transporter. Mediates an active uptake of hexoses, by sugar/hydrogen symport. Can transport glucose, 3-O- methylglucose, fructose, xylose, mannose, galactose, fucose, 2- deoxyglucose and arabinose. Confers sensitivity to galactose in seedlings.
- substrates: Hexoses
- Sugar Transporter Protein 1 (STP1) contributes to regulation of the genes involved in shoot branching via carbon partitioning in Arabidopsis.
Otori, Bioscience, biotechnology, and biochemistry 2019 (PubMed)- GeneRIF: Sugar Transporter Protein 1 (STP1) contributes to regulation of the genes involved in shoot branching via carbon partitioning in Arabidopsis
- Sugar regulation of SUGAR TRANSPORTER PROTEIN 1 (STP1) expression in Arabidopsis thaliana.
Cordoba, Journal of experimental botany 2015 - GeneRIF: STP1 transcript levels decrease more rapidly after the addition of low concentrations of sugars than the levels of other repressed genes. This regulation is exerted at the transcriptional level and is initiated by phosphorylatable sugars.
- Do mitochondria use efflux pumps to protect their ribosomes from antibiotics?
Islam, Microbiology (Reading, England) 2023 - “...4.1E^183# Q42093, 7.4E^205 O15439, 3.6E^213 [ 73 ] HXT2 High-affinity glucose transporter MFS|| KGR01337.1, 0** P23586, 1 .9E^54 Q96QE2, 6.5E^41 [ 40, 73 ] JEN1 Carboxylic acid transporter protein homologue MFS KGU09375.1, 9E^121** Q9SYQ1, 0.00014 A0A286YF51, 0.0019 [ 73 ] TPO1 Polyamine transporter 1 MFS G1UAY0,...”
- “...7.8E^6 A0A1P8ATY7, 6.7E^12 Q8WW24, 1.4E^14 [ 79, 112 ] HXT13, NCU01633 Q1K4S3 MFS Q8J2J7, 2.1E^85 P23586, 1.2E^52 P11168, 2.6E^48 [ 79 ] NCU04809 Q756M6 MFS T2AWG3, 0.0014 Q8GYF4, 1.4E^24 B3KT41, 0.0022 [ 79 ] NCU09551 Q7S2B0 MFS G1UAY0, 2.3E^6 Q56ZZ7, 2.3E^7 Q8NBP5, 8.4E^9 [ 78 ]...”
- Plasma membrane aquaporins mediates vesicle stability in broccoli
Martínez-Ballesta, PloS one 2018 - “...585 64379,59 Peptide transporter PTR2 2,22 1 P83970 951 104618,27 Plasma membrane ATPase 2,42 3 P23586 522 57572,98 Sugar transport protein 1 2,30 Q9SZN1 487 54270,67 V-type proton ATPase subunit B2 2,87 1 O82226 747 85386,45 Cyclic nucleotide-gated ion channel 6 1,87 9 Cell growth and...”
- Microsome-associated proteome modifications of Arabidopsis seedlings grown on board the International Space Station reveal the possible effect on plants of space stresses other than microgravity
Mazars, Plant signaling & behavior 2014 - “...0.549 phosphatidylserine decarboxylase 3 Q9SZP6 AT4G38690 0.554 1-phosphatidylinositol phosphodiesterase-related protein Q8LDH5 0.585 endomembrane-associated protein Transporters P23586 AT1G11260 0.370 sugar transporter 1 Q8LGU1 AT3G21250 0.456 multidrug resistance-associated protein 6 Q56ZZ7 AT5G16150 0.523 Plastidic glucose transporter 4 Q53XH7 AT5G62670 0.553 H(+)-ATPase 11 Q94FB9 AT4G39850 0.559 ABC transporter D...”
- Proton-coupled sugar transport in the prototypical major facilitator superfamily protein XylE
Wisedchaisri, Nature communications 2014 - “...IolT (O34718); Arabidopsis thaliana inositol/H + symporter INT1 (Q8VZR6); Arabidopsis thaliana hexose/H + symporter STP1 (P23586); Parachlorella kessleri hexose/H + symporter HUP1 (P15686); Homo sapiens facilitated glucose transporter GLUT12 (Q8TD20); Homo sapiens H + /myo-inositol transporter GLUT13 (HMIT) (Q96QE2); Homo sapiens facilitated glucose transporter GLUT2 (P11168);...”
- Major facilitator superfamily
Pao, Microbiology and molecular biology reviews : MMBR 1998 - “...541 Accession no. Databaseb S38435 U43629 S25015 U38651 L08196 P23586 S25009 PIR GB PIR GB GB SP PIR U23453 Z69787 Z68296 Z68215 U41532 Z70683 U28737 Z66522...”
- Starch metabolism in guard cells: At the intersection of environmental stimuli and stomatal movement
Dang, Plant physiology 2024 - “...AT4G30190 GBF2 Gramene: AT4G01120 GBF2 Araport: AT4G01120 PHOT1 Gramene: AT3G45780 PHOT1 Araport: AT3G45780 STP1 Gramene: AT1G11260 STP1 Araport: AT1G11260 STP4 Gramene: At3g19930 STP4 Araport: At3g19930 AMY3 Gramene: AT1G69830 AMY3 Araport: AT1G69830 HXK1 Gramene: AT4G29130 HXK1 Araport: AT4G29130 BIK1 Gramene: AT2G39660 BIK1 Araport: AT2G39660 SUS3 Gramene: AT4G02280...”
- AlteredArabidopsis thalianasugar metabolism affects exudation, immune responses, and plant-microbe interactions
Siffert, 2024 - Metabolome and Transcriptome Association Analysis Reveals Mechanism of Synthesis of Nutrient Composition in Quinoa (Chenopodium quinoa Willd.) Seeds
Yang, Foods (Basel, Switzerland) 2024 - “...in the carbon output of Arabidopsis thaliana [ 67 ]. The gene LOC110687202 (homologous gene AT1G11260) encodes a high-affinity sugar transporter in Arabidopsis thaliana, which is highly down-regulated and can transport a variety of hexose [ 68 ]. The sugar transporter encoded in quinoa is up-regulated,...”
- Genetic Determinants of Fiber-Associated Traits in Flax Identified by Omics Data Integration
Kanapin, International journal of molecular sciences 2022 - “...domain-containing protein 47 AT3G04070, anac047, NAC047 [ 69 ] transcription factor Lus10042516 sugar transporter 1 AT1G11260, STP1 [ 97 ] H+/monosaccharide cotransporter Chr9:18121668 Lus10029638 Lus10029639 GDSL-like lipase/acylhydrolase superfamily protein AT1G54790 [ 98 , 99 , 100 ] growth, biotic stress response, in cotton the GDSL (GhGDSL)...”
- Comparative transcriptomics reveals commonalities and differences in the genetic underpinnings of a floral dimorphism
Potente, 2022 - Comparative transcriptomics reveals commonalities and differences in the genetic underpinnings of a floral dimorphism
Potente, Scientific reports 2022 - “...and comprised, among others, pveT_jg31090, homologous to A. thaliana Sugar Transporter 1 ( STP1 ; AT1G11260). Figure 4 Differential expression analysis in Primula . ( a ) Bar-plot showing the enriched GO terms among down-regulated DEGs in the P. veris style, ordered bottom-up by increasing adjusted...”
- Membrane nanodomains and transport functions in plant
Martinière, Plant physiology 2021 - “...(NAP) AT1G67940 (NAP3) Suspension cell cultures Yoshida et al., 2013 Sugar Sugar transporter protein (STP) AT1G11260 (STP1); AT3G19930 (STP4); AT5G26340 (STP13) Whole plant/suspension cell cultures/leaves Minami et al., 2009 ; Keinath et al., 2010 ; Demir et al., 2013 Sugar (continued) Sucrose transporter (SUT) AT1G22710 (SUT1)...”
- Leaf nodule endosymbiotic Burkholderia confer targeted allelopathy to their Psychotria hosts
Georgiou, Scientific reports 2021 - “...(AT1G55120), cwinv4 (AT2G36190), cwinv5 (AT3G13784), cwinv6 (AT5G11920), cinv1-4 (AT1G35580), cinv1-8 ( AT1G35580), cinv2 (AT4G09510), stp1-1 (AT1G11260), stp13-1 (AT5G26340) and the double mutants stp1 stp13 and stp1 stp4 were kindly provided by Diana Santelia (ETH Zurich, Switzerland); prc1 (AT5G64740) , cev1 (AT5G05170) and rsw1 (AT4G32410) were obtained...”
- More
KHT2 / CAA87389.1 permease from Kluyveromyces lactis (see paper)
P53387 Hexose transporter 2 from Kluyveromyces lactis
28% identity, 56% coverage
DV527_RS02780 sugar porter family MFS transporter from Staphylococcus saprophyticus
29% identity, 53% coverage
FVEG_11293 hypothetical protein from Fusarium verticillioides 7600
28% identity, 56% coverage
- Involvement of FST1 from Fusarium verticillioides in virulence and transport of inositol
Niu, Molecular plant pathology 2017 (secret) - Transcriptome changes in Fusarium verticillioides caused by mutation in the transporter-like gene FST1
Niu, BMC microbiology 2015 - “...ITR1p sequence identified eight genes with high sequence similarity (FVEG_01519, FVEG_01638, FVEG_02081, FVEG_03992, FVEG_06504, FVEG_07757, FVEG_11293, and FVEG_12687). The sequence of FST1 was not identified by the search. Among the eight identified genes, expression was significantly down-regulated in fst1 for FVEG_06504 (named ITR1 ) (19-fold) and...”
DV527_RS12535 sugar porter family MFS transporter from Staphylococcus saprophyticus
32% identity, 53% coverage
CH_124121 arabinose-proton symporter from Magnaporthe grisea 70-15 (see paper)
31% identity, 50% coverage
P93075 BvcDNA-205 protein from Beta vulgaris subsp. vulgaris
27% identity, 57% coverage
- Genome-Wide Identification of the Cyclic Nucleotide-Gated Ion Channel Gene Family and Expression Profiles Under Low-Temperature Stress in Luffa cylindrica L.
Liu, International journal of molecular sciences 2024 - “...2500 instrument (Illumina, San Diego, CA, USA). High-quality reads were aligned to the luffa cultivar P93075 (PRJNA596077) reference genome [ 43 , 57 ]. For RT-qPCR analysis, total RNA was extracted from each sample, then cDNA was synthesized using previously described methods [ 28 , 58...”
- “...family members were identified on the basis of the reference genome of L. cylindrica cultivar P93075 and downloaded from the NCBI database (accessed on 27 June 2024) [ 43 ]. In addition, 20 Arabidopsis ( Arabidopsis thaliana ) and 17 bitter gourd ( Momordica charantia )...”
- CuGenDBv2: an updated database for cucurbit genomics.
Yu, Nucleic acids research 2023 - “...two genome assemblies from the cultivated sponge gourd species L. cylindrica including that of cultivar P93075, and one from another cultivated species L. acutangula (AG-4) are available ( 2527 ). For Momordica , two genome assemblies from the cultivated bitter gourd species M. charantia (Dali-11 and...”
- “...( 30 ) Sponge gourd Luffa cylindrica v1 31 661 ( 25 ) Luffa cylindrica P93075 v1 27 147 ( 27 ) Luffa acutangula AG-4 v1 42 211 ( 26 ) Wax gourd Benincasa hispida B227 v1 27 467 ( 32 ) Chayote Sechium edule v1...”
- QTL mapping reveals candidate genes for main agronomic traits in Luffa based on a high-resolution genetic map
Liu, Frontiers in plant science 2022 - “...population of 110 lines derived from a cross between S1174 ( Luffa acutangula ) and P93075 ( Luffa cylindrica ). The map spanned a total of 2246.74 cM with an average distance of 0.48 cM between adjacent markers. Thereafter, a large-scale field-based quantitative trait loci (QTLs)...”
- “...for some nonsynonymous single nucleotide polymorphisms (SNPs) in exons, and the expression level in thick-stem P93075 was distinctively higher than that in thin-stem S1174. According to the natural variation analysis of a population of 183 inbred lines, two main haplotypes were found for LacCRWN3 : the...”
- Identification of suitable reference genes for quantitative reverse transcription PCR in Luffa (Luffa cylindrica)
Zhao, Physiology and molecular biology of plants : an international journal of functional plant biology 2022 - “...and methods Plant materials and tissue collection P93075, an advanced Luffa inbred line bred through multiple generations of self-pollination and selection,...”
- A high-quality sponge gourd (Luffa cylindrica) genome.
Wu, Horticulture research 2020 - “...family Cucurbitaceae. In this study, a draft genome sequence of the sponge gourd inbred line P93075 was analyzed. Using Illumina, PacBio, and 10 Genomics sequencing techniques as well as new assembly techniques such as FALCON and chromatin interaction mapping (Hi-C), a chromosome-scale genome of approximately 656.19Mb,...”
- “...assembly, and quality evaluation To assess the genome size of the sponge gourd inbred line P93075 (Fig. 1 , Supplementary Fig. 1 ), 144.34Gb of paired-end reads (with an insert size of 350bp) were selected to generate 17-mer frequency data for k -mer analysis. The k...”
- Transcriptomic and metabolite analyses of Cabernet Sauvignon grape berry development
Deluc, BMC genomics 2007 - “...15 4.7 1619691_at CF211807 TC62520 Q4U339 Hexose transporter (VvHT6) Transport 14 3.69 1613408_at CB347178 TC66667 P93075 Sucrose transporter (BvST1) Transport 11 2.92 1608991_at CA816013 TC60060 Q8GTR0 Sugar transporter Transport 10 2.86 1610298_at CB972367 TC53493 Q8LES0 Golgi nucleotide sugar transporter (GONST) 4 Transport 2 2.71 1615697_at AF021810...”
LOC18031593 sugar transport protein 8 from Citrus x clementina
30% identity, 54% coverage
ITR2_SCHPO / P87110 Myo-inositol transporter 2 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
itr2 / RF|NP_593320.1 MFS myo-inositol transporter from Schizosaccharomyces pombe (see 2 papers)
27% identity, 59% coverage
- function: Transporter for myo-inositol.
catalytic activity: myo-inositol(out) + H(+)(out) = myo-inositol(in) + H(+)(in) (RHEA:60364) - CharProtDB Source (per GeneDB): GeneDB_Spombe
IOLT_BACSU / O34718 Major myo-inositol transporter IolT from Bacillus subtilis (strain 168) (see paper)
TC 2.A.1.1.26 / O34718 Major myoinositol:H+ symporter, IolT from Bacillus subtilis (see 3 papers)
31% identity, 53% coverage
- function: Major myo-inositol uptake transporter.
- substrates: myo-inositol
- Proton-coupled sugar transport in the prototypical major facilitator superfamily protein XylE
Wisedchaisri, Nature communications 2014 - “...permease GalP (P0AEP1); Escherichia coli arabinose permease AraE (P0AE24); Bacillus subtilis myo-inositol/H + transporter IolT (O34718); Arabidopsis thaliana inositol/H + symporter INT1 (Q8VZR6); Arabidopsis thaliana hexose/H + symporter STP1 (P23586); Parachlorella kessleri hexose/H + symporter HUP1 (P15686); Homo sapiens facilitated glucose transporter GLUT12 (Q8TD20); Homo sapiens...”
B4FQN6 Putative polyol transporter 1 from Zea mays
GRMZM2G153920 sorbitol transporter from Zea mays
28% identity, 59% coverage
- Growth Stimulatory Effects and Genome-Wide Transcriptional Changes Produced by Protein Hydrolysates in Maize Seedlings.
Santi, Frontiers in plant science 2017 - “...GRMZM2G024808_T01 B6U7W3 Nitrate and chloride transporter 2.02 GRMZM2G072955_T01 M8CTF4 Chloride channel protein 2.06 2.02 GRMZM2G153920_T01 B4FQN6 Sorbitol transporter 2.07 GRMZM2G137421_T01 B6TSV4 Peptide transporter PTR2 2.09 2.12 GRMZM2G457523_T01 Q2QLJ1 Sodium/hydrogen exchanger family protein, expressed 2.10 GRMZM5G872392_T01 B6T9U6 Bidirectional sugar transporter SWEET 2.15 AC186166.3_FGT008 A0A096PGB1 Uncharacterized protein 2.16...”
- Quantitative Proteomic Analyses Identify ABA-Related Proteins and Signal Pathways in Maize Leaves under Drought Conditions
Zhao, Frontiers in plant science 2016 - “...0.900 0.862 0.854 1.617 0.000 0.872 0.018 0.000 Up-regulated by drought in an ABA-dependent way B4FQN6 Sorbitol transporter 0.682 0.647 0.657 1.332 1.324 1.346 0.662 0.005 1.334 0.005 0.000 Down-regulated by drought in an ABA-dependent way B4FRG9 Uncharacterized protein 0.620 0.585 0.595 0.952 0.944 0.966 0.600...”
- Brevis plant1, a putative inositol polyphosphate 5-phosphatase, is required for internode elongation in maize
Avila, Journal of experimental botany 2016 - “...2.81 Transcription factor GRMZM2G169149 WRKY62-superfamily of transcription factors having WRKY 0.00 0.00 10.87 3.91 Transport GRMZM2G153920 Sorbitol transporter; uncharacterized 0.00 0.00 1.15 0.98 Zm_mod04;-0.49 Transposon GRMZM2G021020 Transposable element 22.24 22.90 0.00 0.00 GRMZM2G008283 Transposable element 15.17 33.16 0.0 0.0 GRMZM2G020508 Transposable element 4.44 4.11 12.96 13.87...”
- “...responsible for the majority of -galactose activity against xyloglucan. Misexpressed genes encoding membrane-associated transporters include GRMZM2G153920 and GRMZM2G180659. The sorbitol transporter-like protein GRMZM2G153920 is up-regulated in bv1 relative to wild-type internodes. Sorbitol transporter-like proteins can transport pentoses as well as polyols and different hexoses ( Klepek...”
- Correlation of aquaporins and transmembrane solute transporters revealed by genome-wide analysis in developing maize leaf
Yue, Comparative and functional genomics 2012 - “...an ion-coupled uptake transporter [ 52 ]. Our results showed that ATPLT5 (polyol transporter 5, GRMZM2G153920, EntrezGene:100281055) exhibited the same expression patterns as ZmNIP2;1 and may be involved in sugar and substrate-specific transmembrane transporter activity (GO:0022891). From our results, we also observed significant relationships between the...”
FVEG_07757 hypothetical protein from Fusarium verticillioides 7600
31% identity, 52% coverage
- Involvement of FST1 from Fusarium verticillioides in virulence and transport of inositol
Niu, Molecular plant pathology 2017 (secret) - Transcriptome changes in Fusarium verticillioides caused by mutation in the transporter-like gene FST1
Niu, BMC microbiology 2015 - “...yeast ITR1p sequence identified eight genes with high sequence similarity (FVEG_01519, FVEG_01638, FVEG_02081, FVEG_03992, FVEG_06504, FVEG_07757, FVEG_11293, and FVEG_12687). The sequence of FST1 was not identified by the search. Among the eight identified genes, expression was significantly down-regulated in fst1 for FVEG_06504 (named ITR1 ) (19-fold)...”
Q84QH3 Putative sorbitol transporter from Prunus cerasus
28% identity, 55% coverage
- Transcriptomic and metabolite analyses of Cabernet Sauvignon grape berry development.
Deluc, BMC genomics 2007 - “...21 2.22 1616083_at CB009608 TC51694 Q9ZR63 Hexose transporter (VvHT1) Transport 2 12.37 1610527_at CA815926 TC52979 Q84QH3 Sorbitol transporter Transport 2 5.49 1615257_at CB972713 TC65400 Q4U339 Hexose transporter (VvHT6) Transport 15 4.7 1619691_at CF211807 TC62520 Q4U339 Hexose transporter (VvHT6) Transport 14 3.69 1613408_at CB347178 TC66667 P93075 Sucrose...”
Npun_R5323 sugar transporter from Nostoc punctiforme
30% identity, 54% coverage
TC 2.A.1.1.120 / E1WAV3 Major myo-inositol transporter, IolT1, of 456 aas from Salmonella typhimurium (strain SL1344)
27% identity, 50% coverage
CNAG_03910 D-xylose-proton symporter from Cryptococcus neoformans var. grubii H99
31% identity, 38% coverage
- Coordinate genomic association of transcription factors controlled by an imported quorum sensing peptide in Cryptococcus neoformans
Summers, PLoS genetics 2020 - “...CNAG_07736 glucan endo-1,3-alpha-glucosidase agn1 -1.097461985 -0.709228197 -0.999094169 -2.268387208 CNAG_04091 hypothetical protein -1.210716649 -0.900720007 -0.843009361 -1.942559812 CNAG_03910 myo-inositol transporter, putative -1.516107887 -0.865736116 -0.814114154 -2.415593154 CNAG_02488 methionyl-tRNA formyltransferase -0.6654336 0.8947173 -0.5981322 -1.84612 Together, these data indicate that Qsp1 regulates the binding of Cqs2, Nrg1, and Liv3 together to...”
- Role of the inositol pyrophosphate multikinase Kcs1 in Cryptococcus inositol metabolism
Liao, Fungal genetics and biology : FG & B 2018 - “...ITR3B 3.80998 1.60194 CNAG_05381 ITR3C 30.5358 25.8554 CNAG_05662 ITR4 12.4597 13.8718 CNAG_04024 ITR5 1.07981 1.62615 CNAG_03910 ITR6 1.07981 1.62615 Inositol biosynthesis CNAG_01539 INO1 4.21058 5.1748 CNAG_01823 INM1 1.12981 1.21511 CNAG_03262 INM2 1.44061 1.21405 Inositol metabolism CNAG_05384 PIS1 1.24315 1.13229 CNAG_03821 PI3K1 6.22329 1.12548 CNAG_04335 PI3K2 3.13056...”
- Galectin-3 impacts Cryptococcus neoformans infection through direct antifungal effects
Almeida, Nature communications 2017 - “...logFC p -value RPKM control RPKM Gal-3 Gene ID Annotation XM_012192153.1 6.03 0.0000 0.8 55.2 CNAG_03910 D-xylose-proton symporter XM_012194171.1 5.91 0.0000 0.0 2.4 CNAG_06812 Phospholipase D, variant XM_012198528.1 5.45 0.0000 11.7 513.7 CNAG_05662 Sugar transporter XM_012191199.1 4.87 0.0000 4.8 142.9 CNAG_00183 Alternative cyclin Pcl12, variant XM_012191495.1...”
- The transcriptional response of Cryptococcus neoformans to ingestion by Acanthamoeba castellanii and macrophages provides insights into the evolutionary adaptation to the mammalian host
Derengowski, Eukaryotic cell 2013 - “...CNAG_07869 CNAG_05662 CNAG_01384 CNAG_01936 CNAG_03772 CNAG_03910 CNAG_03060 CNAG_01925 CNAG_05685 CNAG_05929 CNAG_02288 CNAG_07367 CNAG_04795 CNAG_07387...”
- Role of an expanded inositol transporter repertoire in Cryptococcus neoformans sexual reproduction and virulence
Xue, mBio 2010 - “...CNAG_05381 14 H99 ITR4 -H CNAG_05662 14 H99 ITR5 -H CNAG_04024 2 H99 ITR6 -H CNAG_03910 2 JEC21 ITR1 -J CNA00880 1 JEC21 ITR2 -J CND00020 4 JEC21 ITR2A -J CNG02980 7 JEC21 ITR3 -J CNH00450 8 JEC21 ITR3A -J CND00070 4 JEC21 ITR3B1 -J CNH03060...”
TC 2.A.1.1.123 / AIU41385.1 Sorbitol (D-Glucitol):H+ co-transporter, SOT1 (Km for sorbitol of 0.64 mM) of 509 aas and 12 TMSs (Gao et al. 2003). SOT1 of P. cerasus is expressed throughout fruit development, but especially when growth and sorbitol accumulation rates are highest. In leaves, PcSOT1 expression is highest in young, expanding tissues, but substantially less in mature leaves from Prunus salicina
29% identity, 53% coverage
Sb06g033060 No description from Sorghum bicolor
31% identity, 53% coverage
- Recent advancements in the breeding of sorghum crop: current status and future strategies for marker-assisted breeding
Baloch, Frontiers in genetics 2023 - “...qGW1 Expressed protein GW Sobic.001G038900 Han et al. (2015) Unknown Similar to H0801D08.10 protein GS Sb06g033060 Zhang et al. (2015) Unknown Similar to putative fibre protein Fb34 GS Sb10g018720 Zhang et al. (2015) Grain quality KS3 Ent-kaurene synthase SN Sb06 g028210 Zhao et al. (2016) MSD1/SbTCP16...”
- Sorghum breeding in the genomic era: opportunities and challenges
Hao, TAG. Theoretical and applied genetics. Theoretische und angewandte Genetik 2021 - “...Grain size Similar to putative fibre protein Fb34 Zhang et al. ( 2015b ) Unknown Sb06g033060 Grain size Similar to H0801D08.10 protein Zhang et al. ( 2015b ) KS3 Sb06 g028210 Seed number Ent-kaurene synthase Zhao et al. ( 2016 ) MSD1/SbTCP16 Sobic.007G135700 Grain number per...”
- “...354 accessions with 265,487 SNPs (Zhang et al. 2015b ). Two candidate genes, Sb10g018720 and Sb06g033060 , encoding a fibre protein Fb34 and a member of the major facilitator superfamily, respectively, are related to grain size control. Both single SNP allelic variants of these two candidate...”
- Comparative Genetics of Seed Size Traits in Divergent Cereal Lineages Represented by Sorghum (Panicoidae) and Rice (Oryzoidae)
Zhang, G3 (Bethesda, Md.) 2015 - “...on the basis of sequence alignment. Of the eight genes evaluated, four [ Sb04g015420 , Sb06g033060 , Sb07g023950 , and Sb10g018720 from JGI annotation release Sbi1.4 ( Paterson et al. 2009 )] encode six variants that are strongly associated with seed size ( P 10 4...”
- “...( Table S7 ). Two common variants [minor allele frequency (MAF) 5%] were observed in Sb06g033060 (at nucleotide S6_61108872 in Sbi1.4) and Sb10g018720 (at nucleotide S10_40095764), both of which contain nucleotide changes that can alter the amino acid sequence relative to the sorghum reference genome (...”
Ot14g01870 Major facilitator superfamily domain, general substrate transporter from Ostreococcus tauri
28% identity, 77% coverage
CNM02570 receptor from Cryptococcus neoformans var. neoformans JEC21
30% identity, 53% coverage
- Comparative hybridization reveals extensive genome variation in the AIDS-associated pathogen Cryptococcus neoformans
Hu, Genome biology 2008 - “...and CNM02600, were conserved in all of the strains (H99, Bt63, 125.91, and CBS7779). However, CNM02570, which encodes a putative receptor protein near to the telomere, was present in H99, Bt63, CBS7779, and WM626, but not in 125.91. Kavanaugh and coworkers [ 61 ] found that...”
Rv3331 PROBABLE SUGAR-TRANSPORT INTEGRAL MEMBRANE PROTEIN SUGI from Mycobacterium tuberculosis H37Rv
32% identity, 54% coverage
- Comparison of the transcriptome, lipidome, and c-di-GMP production between BCGΔBCG1419c and BCG, with Mincle- and Myd88-dependent induction of proinflammatory cytokines in murine macrophages
Flores-Valdez, Scientific reports 2024 - “...BCG_1624 Rv1571 Conserved hypothetical protein with 2-5RNA ligase family protein domain 0.663 0.035162251 sugI BCG_3401 Rv3331 Probable sugar-transport integral membrane protein sugI 0.6629 0.018548577 BCG_3854 BCG_3854 Rv3792 Probable conserved transmembrane protein Arabinofuranosyltransferase AftA 0.6629 0.007871683 BCG_3676c BCG_3676c Rv3612c Conserved hypothetical protein 0.6601 0.003454172 dedA BCG_2664 Rv2637...”
- The appearance ofsugImixed loci in three individuals during treatment for MDR-TB, supports the involvement ofsugIinMycobacterium tuberculosisd-cycloserine resistancein vivo
Anthony, 2023 - Mechanisms of Linezolid Resistance in Mycobacteria
Gan, Pharmaceuticals (Basel, Switzerland) 2023 - “...et al. (2017) found single-nucleotide variants in genes encoding efflux pump/transporters (Rv0545c, Rv0930, Rv2477 and Rv3331) and a transcriptional regulator Rv0890c in MTB isolates from patients who failed linezolid-based treatment [ 56 ]. Furthermore, the addition of efflux pump inhibitors, thioridazine or reserpine, reduced the MIC...”
- “...al., 2017 [ 56 ] Laboratory-derived mutants United States M. tuberculosis Rv0545c, Rv0930, Rv2477 and Rv3331, Rv0890c Various single-nucleotide variants >3 ND: Not described. ^ The authors did not describe the DNA mutation. * These two mutations were developed in a second-step mutant and were found...”
- Mutation in luxR Family Transcriptional Regulator Rv0890c Is Not a Marker of Linezolid Resistance
Zimenkov, Antimicrobial agents and chemotherapy 2018 - Structural and functional determination of homologs of the Mycobacterium tuberculosis N-acetylglucosamine-6-phosphate deacetylase (NagA)
Ahangar, The Journal of biological chemistry 2018 - “...encoding a putative aminotransferase (Rv3329); dacB1 (Rv3330), an enzyme involved in PG maturation; and SugI (Rv3331), a putative sugar-importer ( 17 , 26 ) ( Fig. 2 ). Despite its importance in Mtb , detailed studies of NagA from mycobacteria have not yet been reported. This...”
- “...probable aminotransferase ), Rv3330 ( dacB1 , probable penicillin-binding protein d -alanyl- d -alanine carboxypeptidase), Rv3331 ( sugI , probable sugar-transport integral membrane protein ), and Rv3332 ( nagA , GlcNAc-6-phosphate deacetylase ). Results Production of MMNagA and MSNagA To produce recombinant NagA protein, the nagA...”
- Identification of novel mutations associated with cycloserine resistance in Mycobacterium tuberculosis
Chen, The Journal of antimicrobial chemotherapy 2017 - “...rv0221, rv1403c, rv1683, rv1726, gabD2 (rv1731), rv2749, sugI (rv3331), hisC2 (rv3772), the 50 intergenic region of rv3345c and rv1435c, and the 30 region of...”
- “...of D-cycloserine (20, 40, 80 and 160 mg/L). rv3331 rv3690 rv3772 Primer Sequence (50 -30 ) alr_F2 alr_R2!300bp Rv0759c-For Rv0759c-Rev Rv1403c-For Rv1403c-Rev...”
- Identification of novel mutations associated with cycloserine resistance inMycobacterium tuberculosis
Zhang, 2017 - Linezolid Dose That Maximizes Sterilizing Effect While Minimizing Toxicity and Resistance Emergence for Tuberculosis
Srivastava, Antimicrobial agents and chemotherapy 2017 - “...the supplemental material. Notable mutations included several in efflux pump/transporter genes (Rv0545c, Rv0930, Rv2477, and Rv3331) and the luxR family transcriptional regulator (Rv0890c). FIG 3 Linezolid resistance and Mycobacterium tuberculosis transcriptome. (A) The relationship between linezolid AUC 024 /MIC ratio and sequencing reads in protein synthesis...”
- “...mutations, compared to wild type, occurred in genes encoding efflux pump/transporters (Rv0545c, Rv0930, Rv2477, and Rv3331), as well as in the luxR family transcriptional regulator Rv0890c. Monte Carlo experiments in 10,000 adult tuberculosis patients faithfully recapitulated intended pharmacokinetic parameter estimates, as shown in Table 2 ....”
- More
plt1 / CAD58709.1 polyol transporter from Plantago major (see paper)
30% identity, 52% coverage
Mb3364 PROBABLE SUGAR-TRANSPORT INTEGRAL MEMBRANE PROTEIN SUGI from Mycobacterium bovis AF2122/97
32% identity, 54% coverage
PLT5_ARATH / Q8VZ80 Polyol transporter 5; Protein POLYOL TRANSPORTER 5; AtPLT5; Sugar-proton symporter PLT5 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
TC 2.A.1.1.34 / Q8VZ80 The broad specificity sugar/sugar alcohol (myo-inositol, glycerol, ribose, sorbitol, mannitol, xylitol, erythritol, etc) H+ symporter, AtPLT5 (transports a wide range of hexoses, pentoses, tetroses, sugar alcohols and a sugar acid, but not disaccharides) (Reinders et al., 2005) (expressed in roots, leaves and floral organs) from Arabidopsis thaliana (Mouse-ear cress) (see 5 papers)
PLT5 / RF|NP_188513.1 polyol transporter 5 from Arabidopsis thaliana (see paper)
NP_188513 polyol/monosaccharide transporter 5 from Arabidopsis thaliana
AT3G18830 ATPLT5 (POLYOL TRANSPORTER 5); D-ribose transmembrane transporter/ D-xylose transmembrane transporter/ carbohydrate transmembrane transporter/ galactose transmembrane transporter/ glucose transmembrane transporter/ glycerol transmembrane transporter/ mannitol transmembrane transporter/ monosaccharide transmembrane transporter/ myo-inositol transmembrane transporter/ sorbitol transmembrane transporter/ sugar:hydrogen symporter from Arabidopsis thaliana
27% identity, 57% coverage
- function: Plasma membrane broad-spectrum sugar-proton symporter. Mediates the uptake of linear polyols such as sorbitol, xylitol, erythritol or glycerol. Can transport the cyclic polyol myo-inositol and different hexoses, pentoses (including ribose), tetroses and sugar alcohols.
- substrates: Erythritol, H+, Ribose, Sorbitol, Xylitol, glycerol, mannitol, myo-inositol
- Analysis of transport activity of Arabidopsis sugar alcohol permease homolog AtPLT5.
Reinders, The Journal of biological chemistry 2005 (PubMed)- GeneRIF: Analysis of transport properties and expression in Arabidopsis indicate that AtPLT5 functions to transport a wide range of sugars into specific sink tissues in the plant [PLT5]
- Arabidopsis POLYOL TRANSPORTER5, a new member of the monosaccharide transporter-like superfamily, mediates H+-Symport of numerous substrates, including myo-inositol, glycerol, and ribose.
Klepek, The Plant cell 2005 - GeneRIF: AtPLT5 is a broad-spectrum H-symporter for linear polyols, such as sorbitol, xylitol, erythritol, or glycerol. It also catalyzes the transport of the cyclic polyol myo-inositol and of different hexoses and pentoses, including ribose[AtPLT5]
- Transcriptome analysis to identify candidate genes associated with the yellow-leaf phenotype of a Cymbidium mutant generated by γ-irradiation
Kim, PloS one 2020 - “...Copper transport protein CCH 2.84536 0.009691 TRINITY_DN82149_c4_g1 Q94LW6 SUT35 Sulfate transporter 3;5 1.33172 0.018302 TRINITY_DN86390_c5_g1 Q8VZ80 PLT5 Polyol transporter 1.74481 0.010401 TRINITY_DN81484_c2_g1 Q93ZF5 PHO11 Phosphate transporter PHO1 homolog 1 11.8706 1.8 10 17 TRINITY_DN82844_c0_g1 Q9C9Z1 ZTP50 Zinc transporter 50 1.51218 8.95 10 5 TRINITY_DN85192_c3_g1 Q9M1P7 BOR2...”
- Automated identification of reference genes based on RNA-seq data
Carmona, Biomedical engineering online 2017 - “...Q94A41 Alpha-amylase 3, chloroplastic Arabidopsis thaliana rp11_olive_006061 327 272 238 343 285 253 13.16 286.3 Q8VZ80 Polyol transporter 5 Arabidopsis thaliana rp11_olive_006091 283 221 211 208 177 190 15.65 215 A0A022R151 Uncharacterized protein Erythranthe guttata rp11_olive_010107 228 213 184 250 295 199 15.98 228.2 O23254 Serine...”
- Silencing of a mannitol transport gene in Phelipanche aegyptiaca by the tobacco rattle virus system reduces the parasite germination on the host root
Bari, Plant signaling & behavior 2022 - “...for cloning in pTRV2 Best Arabidopsis Hit >OrAe2FB1_3281: Length (2049 nt) Mannitol transporter (PaMNT1) 275bp AT3G18830 >OrAe2FB1_29: Length (2791 nt) Methionine synthase (PaMET1) 231bp AT3G03780 >OrAe2FB1_910: Length (1892 nt) Sucrose transporter (PaSUT1) 268bp AT1G22710 >OrAe42GB1_49526: Length (2821 nt) Ubiquitin protein ligase (PaUBQ3) 213bp AT5G05560 >OrAe3GB1_10228: Length...”
- Molecular mechanisms of resistance to Myzus persicae conferred by the peach Rm2 gene: A multi-omics view
Le, Frontiers in plant science 2022 - “...shock 70 kDa protein 4 Polyols Prupe_2G288800 AT5G51970 81 yes 1.6 1.40E-02 Sorbitol dehydrogenase Prupe_8G101500 AT3G18830 65 No 2.3 3.30E-05 PLT5; Polyol transporter 5 Glyoxylate metabolism Prupe_4G258800 AT2G13360 86 Yes 2.2 5.60E-06 AGT1; Glyoxylate aminotransferase 1 Prupe_4G082600 AT3G14420 88 No 2.9 3.40E-20 GOX1; Glycolate oxidase Prupe_3G048100...”
- Genomic Regions Associated With Seed Meal Quality Traits in Brassica napus Germplasm
Bhinder, Frontiers in plant science 2022 - “...ISPF SNC_027765.2_8996403 8996403 49451 AT1G63970 A09 3.00 MEP Pathway Phytic acid PMT5 SNC_027757.2_27740015 27740015 39548 AT3G18830 A01 3.30 Myo-inositol transport PLDALPHA1 SNC_027761.2_26966958 26966958 28955 AT3G15730 A05 3.23 Regulator SAC8 SNC_027762.2_34136832 34136832 15543 AT3G51830 A06 3.35 Phosphoinositides regulator PRAF1 SNC_027763.2_16570114 16570114 17113 AT1G76950 A07 3.12 Phosphatidylinositol binding...”
- Membrane nanodomains and transport functions in plant
Martinière, Plant physiology 2021 - “...Leaves/suspension cell cultures Demir et al., 2013 ; Yoshida et al., 2013 Polyol/monosaccharide transporter (PLT) AT3G18830 (PLT5) Leaves Demir et al., 2013 Tonoplast monosaccharide transporter (TMT) AT4G35300 (TMT2) Suspension cell cultures Yoshida et al., 2013 Vacuolar glucose transporter (VGT) AT3G03090 (VGT1) Suspension cell cultures Yoshida et...”
- Comparative Dynamic Transcriptome Reveals the Delayed Secondary-Cell-Wall Thickening Results in Altered Lint Percentage and Fiber Elongation in a Chromosomal Segment Substitution Line of Cotton (Gossypium hirsutum L.)
Gao, Frontiers in plant science 2021 - “...al., 2008 ). GH_D01G0100 encoded a polyol/cyclitol/monosaccharide-H + -symporter and was homologous to ATPMT5 ( AT3G18830 ), which is involved in plant cell wall modifications (Klepek et al., 2009 ). In addition, four of six differently expressed candidate genes, namely GH_D01G0052, GH_D01G0095, GH_D01G0128 , and GH_D01G0154...”
- Shotgun proteomics of peach fruit reveals major metabolic pathways associated to ripening
Nilo-Poyanco, BMC genomics 2021 - “...Nuclear pore glycoprotein p62 AT2G45000 Sugar Transport Prupe.8G101200 0.998 2 Up_O2 POLYOL TRANSPORTER 5 PePOL5 AT3G18830 Specialized Metabolsim Prupe.5G106300 0.772 1 Up_O2 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase / MECDP-synthase AT1G63970 Prupe.8G032700 0.607 1 Up_O2 Sterol 3-beta-glucosyltransferase AT1G43620 Prupe.3G097700 0.5 1 Up_O2 cinnamoyl-CoA reductase (CCR) AT1G15950 Vacuolar Sorting Prupe.7G171800...”
- Genome-wide identification, expression, and association analysis of the monosaccharide transporter (MST) gene family in peanut (Arachis hypogaea L.)
Wan, 3 Biotech 2020 - “...Influences flowering and seed germination AtPLT5/AtPMT5 (AT3G18830) Effect pollen and young xylem cells AtINT4 (AT4G16480) Regulate arsenic accumulation...”
- Large-Scale Phosphoproteomic Study of Arabidopsis Membrane Proteins Reveals Early Signaling Events in Response to Cold
Kamal, International journal of molecular sciences 2020 - “...* AT1G08930 ERD6 Major facilitator superfamily protein ER,PM Solute transport SLS[+80]IRER S 17 A * AT3G18830 PLT5 polyol/monosaccharide transporter 5 PM Solute transport TVPNPEVEIGS[+80]NKQWKEGDTQSS S 527 D * AT1G20840 TMT1 tonoplast monosaccharide transporter1 V,PM Solute transport LYGTHENQSYLARPVPEQNS[+80]SLGLR S 277 E,A * AT1G20840 TMT1 tonoplast monosaccharide transporter1...”
- More
CNAG_05387 galactose transporter from Cryptococcus neoformans var. grubii H99
32% identity, 53% coverage
- Antifungal activity of eumelanin-inspired indoylenepheyleneethynylene against <i>Cryptococcus neoformans</i>
Conn, Frontiers in microbiology 2023 - “...Gene ID Gene name Log2foldChange p -adjusted Gene description CNAG_01683 STL1 2.362044974 0* Sugar transporter CNAG_05387 1.891607373 0* MFS glucose transporter mfs1 CNAG_01577 2.794167594 0* NADP-specific glutamate dehydrogenase CNAG_06150 2.515378205 0* Heat shock protein 902 CNAG_04630 YAP2 1.495267376 0* Hypothetical protein CNAG_01750 1.7658259 0* Heat shock...”
- A PAS Protein Directs Metabolic Reprogramming during Cryptococcal Adaptation to Hypoxia
Zhao, mBio 2021 - “...of Pas2 in regulating hypoxia-induced metabolic reprogramming. For instance, the genes involved in glycolysis ( CNAG_05387 and CNAG_06290 ), fermentation ( CNAG_01955 , CNAG_04659 , and CNAG_07745 ), gluconeogenesis ( CNAG_04217 ), the PPP ( CNAG_04025 and CNAG_06923 ), and the TCA cycle ( CNAG_06374 )...”
- Galectin-3 impacts Cryptococcus neoformans infection through direct antifungal effects
Almeida, Nature communications 2017 - “...Atg18 XM_012191442.1 3.12 0.0000 2.4 21.4 CNAG_00598 Nicotinamide mononucleotide permease XM_012198344.1 2.87 0.0000 281.5 2069.0 CNAG_05387 Galactose transporter XM_012191781.1 2.84 0.0000 3.5 25.2 CNAG_03666 Acyl-CoA dehydrogenase XM_012193765.1 2.82 0.0001 0.5 3.3 CNAG_00865 Maltose O -acetyltransferase partial XM_012192132.1 2.80 0.0000 8.7 61.1 CNAG_03876 Ras family protein XM_012194860.1...”
- The glucose sensor-like protein Hxs1 is a high-affinity glucose transporter and required for virulence in Cryptococcus neoformans
Liu, PloS one 2013 - “...HXT1 . Meanwhile, HXT2 (CNAG_06290) was induced only by the high glucose concentration, while HXT3 (CNAG_05387) was induced only by low glucose condition ( Fig. 3 ). The changes of transcription level of other tested HXT homologs, HXT4 (CNAG_06521), HXT6 (CNAG_06963) and HXT7 (CNAG_03432), were not...”
XP_719472 Hgt7p from Candida albicans SC5314
27% identity, 56% coverage
- Genetic basis of the highly efficient yeast Kluyveromyces marxianus: complete genome sequence and transcriptome analyses
Lertwattanasakul, Biotechnology for biofuels 2015 - “...Kl_HXT14, XP_454897; Kl_HXT2, XP_453960; Kl_HXT3, XP_453088; Sc_HXT4/LGT1, NP_011960; Kl_STL1, XP_456249; Kl_RAG4, XP_455315; Kl_LAC12, XP_452193; Ca_HXT6, XP_719472. Genes for the initial catabolism of xylose, PPP, the conversion of PEP to ethanol, the mitochondrial conversion of acetaldehyde to acetyl-CoA and TCA cycle were relatively upregulated (Figure 2 A,B)....”
BCG_3401 putative sugar-transport integral membrane protein sugI from Mycobacterium bovis BCG str. Pasteur 1173P2
32% identity, 54% coverage
XP_021726328 sugar carrier protein C-like from Chenopodium quinoa
30% identity, 55% coverage
- Salinity Effects on Guard Cell Proteome in Chenopodium quinoa
Rasouli, International journal of molecular sciences 2021 - “...chloroplastic-like Potassium XP_021762166 probable voltage-gated potassium channel subunit beta Potassium XP_021753247 monosaccharide-sensing protein 2-like Sugar XP_021726328 sugar carrier protein C-like Sugar XP_021757156 plastidic glucose transporter 4-like Sugar XP_021760460 sucrose transport protein-like isoform X1 Sucrose XP_021752898 chloride channel protein CLC-b-like anions XP_021739774 ATPase ASNA1 homolog anions XP_021772050...”
CTRG_04615 high-affinity glucose transporter from Candida tropicalis MYA-3404
28% identity, 54% coverage
KLMA_80101 uncharacterized protein from Kluyveromyces marxianus DMKU3-1042
29% identity, 53% coverage
AT4G36670 mannitol transporter, putative from Arabidopsis thaliana
29% identity, 55% coverage
- The EXO70 inhibitor Endosidin2 alters plasma membrane protein composition in Arabidopsis roots
Li, Frontiers in plant science 2023 - “...NO AT3G08610 NADH dehydrogenase ubiquinone 1 alpha subcomplex subunit 0.30 catabolic process (GO:0009056) 1 NO AT4G36670 POLYOL/MONOSACCHARIDE TRANSPORTER 6 ATPMT6 0.31 response to temperature stimulus (GO:0009266) 12 NO AT3G45650 Protein NRT1/PTR FAMILY 2.7 NPF2.7 0.35 GO:0015698 12 NO AT5G25820 Exostosin family protein 0.35 root morphogenesis (GO:0010015)...”
- Non-volatile signals and redox mechanisms are required for the responses of Arabidopsis roots to Pseudomonas oryzihabitans
Cantabella, Journal of experimental botany 2022 - “...growth: AT4G13420 (HAK5, potassium channel transporter 5); AT1G54970 (RHS7, root hair specific 7, ethylene regulated); AT4G36670 (PMT6, POLYOL/monosaccharide transporter 6); AT5G17860 (CCX4, cation/calcium exchanger); AT1G08430 (ALMT1, aluminium activated malate transporter); AT5G66650 (CMCU, chloroplast-localized mitochondrial calcium uniporter 3); AT2G47160 (BOR1, boron transporter 1); AT5G22410 (RHS18, root hair...”
- Transcriptome Dynamics of Epidermal Reprogramming during Direct Shoot Regeneration in Torenia fournieri
Morinaka, Plant & cell physiology 2021 - “...all three different callus-inducing culture systems of Arabidopsis AGI Primary gene symbol Torenia transcript Significance AT4G36670 POLYOL/MONOSACCHARIDE TRANSPORTER 6 (PMT6) TfB096621 + AT4G36670 POLYOL/MONOSACCHARIDE TRANSPORTER 6 (PMT6) TfB101385 + AT3G07390 AUXIN-INDUCED IN ROOT CULTURES 12 (AIR12) TfA043399 + AT1G21750 PDI-LIKE 1-1 (PDIL1-1) TfA023511 + AT2G15760 TfB102428...”
- “...(GAPC1) TfA002952 + AT1G68560 ALPHA-XYLOSIDASE 1 (XYL1) TfA011629 + AT3G54960 PDI-LIKE 1-3 (PDIL1-3) TfB087184 + AT4G36670 POLYOL/MONOSACCHARIDE TRANSPORTER 6 (PMT6) TfB089190 ns AT3G07390 AUXIN-INDUCED IN ROOT CULTURES 12 (AIR12) TfB097832 + AT3G44750 HISTONE DEACETYLASE 3 (HDA3) TfA014513 + AT4G36670 POLYOL/MONOSACCHARIDE TRANSPORTER 6 (PMT6) TfB077745 ns AT3G44750...”
- Molecular Targets and Biological Functions of cAMP Signaling in Arabidopsis
Xu, Biomolecules 2021 - “...the glucose sensor HXK1 and mediates glucose and ethylene responses [ 189 ]; and PMT6/PLT6 (AT4G36670) was suggested to mediate long distance transport of glucose import [ 190 ]. In addition, we identified TPS7 (AT1G06410) being a hub gene of chocolate1 module ( Figure 7 C),...”
- “...NPF5.12 (AT1G72140), NPF7.2/NRT1.8 (AT4G21680), NRT2.6 (AT3G45060), NPF2.7/NAXT1(AT3G45650), CLC-b (AT3G27170) Sugar SWEET16 (AT3G16690), HKL1 (AT1G50460), PMT6/PLT6 (AT4G36670) Lipid MIOX2 (AT2G19800), ITPK3 (AT4G08170), SFH14 (AT5G56160) Light BG1 (AT5G12050), ERD7 (AT2G17840), KNAT4 (AT5G11060), DFL2 (AT4G03400), PKS1 (AT2G02950), PKS2 (AT1G14280), BRN2 (AT1G03457), TEM1 (AT1G25560), BBX30 (AT4G15248) CO 2 /HCO 3...”
- Genome-wide identification, expression, and association analysis of the monosaccharide transporter (MST) gene family in peanut (Arachis hypogaea L.)
Wan, 3 Biotech 2020 - “...AhMST43 AhMST57 PGLCT (AT5G16150) Affecting chloroplast AtPLT6/AtPMT6 (AT4G36670) Effect pollen and young xylem cells INT1 (AT2G43330) Impacts cell elongation...”
- Genome-Wide Transcriptome Analysis Reveals Conserved and Distinct Molecular Mechanisms of Al Resistance in Buckwheat (Fagopyrum esculentum Moench) Leaves
Chen, International journal of molecular sciences 2017 - “...comp26932_c0_seq1 2.705 AT4G30420 Usually multiple acids move in and out transporter 34 Unknown comp69634_c0_seq1 1.345 AT4G36670 Polyol/monosaccharide transporter 6 Glucose; hexose comp29397_c0_seq1 1.032 AT5G64410 Oligopeptide transporter 4 Oligopeptide comp25749_c0_seq1 3.018 AT1G67940 AtSTAR1 UDP-glucose comp26709_c0_seq1 2.987 comp30641_c0_seq1 2.916 AT2G37330 Aluminum sensitive 3 UDP-glucose comp30389_c0_seq1 2.852 comp8633_c0_seq1 1.022...”
- Transcriptomic analysis of Arabidopsis overexpressing flowering locus T driven by a meristem-specific promoter that induces early flowering
Duplat-Bermúdez, Gene 2016 - “...tissues in AtFTOE plants. Other two upregulated genes were polyol transporter 5 (At3g18830) and 6 (At4g36670) ( Table 2 ) which have the function of transporting polyols and hexoses, mainly glucose and pentoses (ribose). Analysis of transport properties and expression in Arabidopsis indicate that polyol transporters,...”
- “...mitochondria. 1.83 POLYOL TRANSPORTER 5 At3g18830 Membrane, plasma membrane Glucose import 1.63 POLYOL TRANSPORTER 6 At4g36670 Membrane, plasma membrane Glucose import, hexose transmembrane transport 2.07 Table 3 Genes involved in sugar transport repressed in AtFTOE plants. Gene Locus ID Localization Description FC SUC 2 At1g22710 Plasma...”
- Integrated transcriptomics and metabolomics decipher differences in the resistance of pedunculate oak to the herbivore Tortrix viridana L
Kersten, BMC genomics 2013 - “...- Arachis hypogaea 0.1 1.0 -4.2 Gnl|UG|Qro#S57139400 transport. sugars moderately similar ( 241 ) to AT4G36670 mannitol transporter, putative weakly similar ( 109 ) to HEX6_RICCO Hexose carrier protein HEX6 - Ricinus communis 0.1 2.4 -4.2 Gnl|UG|Qro#S57094988 secondary metabolism. isoprenoids. carotenoids. carotenoid cleavage dioxygenase very weakly...”
- More
FGSG_03168 hypothetical protein from Fusarium graminearum PH-1
31% identity, 51% coverage
HGT7 potential hexose transporter from Candida albicans (see 2 papers)
26% identity, 56% coverage
- CharProtDB CGD description: Putative glucose transporter, major facilitator superfamily; glucose-, fluconazole-, Snf3p-induced, expressed at high glucose; upregulated in biofilm; C. albicans glucose transporter family comprises 20 members; 12 TM regions predicted
B6TDG1 Proton myo-inositol cotransporter from Zea mays
28% identity, 55% coverage
- Growth Stimulatory Effects and Genome-Wide Transcriptional Changes Produced by Protein Hydrolysates in Maize Seedlings.
Santi, Frontiers in plant science 2017 - “...2.70 GRMZM2G118507_T01 K7VD86 Uncharacterized protein 2.65 GRMZM2G024196_T01 Q7XKF4 Probable metal-nicotianamine transporter YSL13 2.53 3.89 GRMZM2G064437_T01 B6TDG1 Proton myo-inositol cotransporter 2.53 GRMZM2G059465_T01 K7TWC7 Calcium-transporting ATPase 2.49 GRMZM2G129843_T01 B6U7Q9 Lipid binding protein 2.41 GRMZM2G362848_T01 V9SBV7 Nucleobase cation symporter 1 2.32 GRMZM2G029951_T01 A0A096Q8Z7 Uncharacterized protein 2.29 GRMZM2G123884_T01 Q7XVB3 Probable...”
CNBG_9639 uncharacterized protein from Cryptococcus deuterogattii R265
30% identity, 53% coverage
NCU01494 MFS sugar transporter from Neurospora crassa OR74A
27% identity, 51% coverage
- The regulatory and transcriptional landscape associated with carbon utilization in a filamentous fungus
Wu, Proceedings of the National Academy of Sciences of the United States of America 2020 - “...glucose transporter, hgt-1 NCU10021 ( 35 ) and additional uncharacterized transporters (NCU00809, NCU06522, NCU09287, NCU04537, NCU01494, NCU06384, and NCU05897). An uncharacterized sugar transporter bound by CRE-1, sut-28 (NCU05897; annotated as a fucose permease; SI Appendix , Fig. S1 ), is a predicted ortholog of the A....”
- Transcriptional comparison of the filamentous fungus Neurospora crassa growing on three major monosaccharides D-glucose, D-xylose and L-arabinose
Li, Biotechnology for biofuels 2014 - “...23.15 NCU00801 MFS lactose permease 6.10 25.15 24.96 NCU00988 MFS quinate transporter 0.18 47.98 0.86 NCU01494 MFS sugar transporter 1.34 6.47 2.07 NCU01813 High affinity glucose transporter 23.68 38.96 16.02 NCU01868 MFS maltose permease malp 0.41 2.42 0.54 NCU02582 Rco3 9.65 42.90 12.30 NCU04310 Sugar transporter...”
GRMZM2G064437 proton myo-inositol cotransporter from Zea mays
28% identity, 55% coverage
- Genome-Wide Association Study of Maize Aboveground Dry Matter Accumulation at Seedling Stage
Lu, Frontiers in genetics 2020 - “...trait. For V3, GRMZM2G340279 , GRMZM2G347808 , GRMZM2G018782 , GRMZM2G099678 , GRMZM2G153127 , Zm00001d042998 , GRMZM2G064437 , and GRMZM2G030284 were associated with leaf dry matter. The candidate genes of sheath dry matter were GRMZM2G147917 , GRMZM2G164088 , GRMZM2G138770 , GRMZM2G032163 , GRMZM2G077004 , GRMZM2G092616 , GRMZM5G884544...”
- Analysis of weighted co-regulatory networks in maize provides insights into new genes and regulatory mechanisms related to inositol phosphate metabolism
Zhang, BMC genomics 2016 - “...related to carbohydrate metabolism. Representative genes include a UDP-galactose transporter (GRMZM2G089630, node CD2), carbohydrate/inositol-transporters (GRMZM2G063824, GRMZM2G064437, nodes CA1 and CC1), and a glycerol-3-phosphate transporter (GRMZM2G078757, node CC4). The correlation between IP6 levels and the expression of carbohydrate transporters (correlation coefficient ranged from 0.51 to 0.95, p...”
B0W47_14370 sugar porter family MFS transporter from Komagataeibacter nataicola
33% identity, 56% coverage
- Complete genome sequence of the cellulose-producing strain Komagataeibacter nataicola RZS01
Zhang, Scientific reports 2017 - “...widely used substrate for industrial production, glucose could be taken up by a sugar symporter (B0W47_14370). Owing to the lack of the gene encoding phosphofructokinase (EC 2.7.1.11), RZS01 has an incomplete Embden-Meyerhof-Parnas pathway, as has been reported in Acetobacter pasteurianus 386B 6 , Gluconacetobacter diazotrophicus Pal5...”
- Reconstruction of a Genome-scale Metabolic Network of Komagataeibacter nataicola RZS01 for Cellulose Production
Zhang, Scientific reports 2017 - “...most widely available carbon source, glucose was easily taken up by sugar permeases, encoded by B0W47_14370 . The Embden-Meyerhof-Parnas pathway is incomplete in strain RZS01 because of a lack of the gene encoding phosphofructokinase (EC 2.7.1.11). Nevertheless, the genes encoding enzymes of the PPP were present,...”
XP_042998602 uncharacterized protein from Ustilaginoidea virens
29% identity, 48% coverage
LOC110687202 sugar transport protein 1-like from Chenopodium quinoa
29% identity, 55% coverage
XP_042993458 uncharacterized protein from Ustilaginoidea virens
28% identity, 57% coverage
CNBG_5746 galactose transporter from Cryptococcus deuterogattii R265
30% identity, 55% coverage
- Identification and Characterization of an Intergenic "Safe Haven" Region in Human Fungal Pathogen Cryptococcus gattii
Li, Journal of fungi (Basel, Switzerland) 2022 - “...and CNBG_5898 on chromosome 4; and Candidate 3the 4073 bp intergenic region between CNBG_5745 and CNBG_5746 on chromosome 4. 3.2. Insertion of Foreign DNA into the Candidate 1 or the Candidate 2 Site Has No Significant Impact on the Expression of the Neighboring Genes Our selection...”
- “...CNBG_5897 and CNBG_5898 in the two selected transformants for candidate 2, and of CNBG_5745 and CNBG_5746 in the two selected transformants for candidate 3. The transcript level of CNBG_3433 and CNBG_3434 in the selected transformants for candidate 1 site showed no apparent difference compared to those...”
A2QG25 Contig An03c0050, genomic contig from Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
An03g01620 uncharacterized protein from Aspergillus niger
29% identity, 55% coverage
- Integration of enzyme constraints in a genome-scale metabolic model of Aspergillus niger improves phenotype predictions
Zhou, Microbial cell factories 2021 - “...eciJB1325 showed good performance for predicting these up-regulated proteins. Among these up-regulated proteins, A2QMS4, A2Q8B5, A2QG25, A2QVE5, and A2QB6 are involved in the xylose metabolism pathway, and A2QB7, A2R6Z2, A2Q8B5, and A2QG25 are enzymes related to arabinose-related enzyme synthesis and metabolism (Fig. 11 A). It could...”
- Probing Carbon Utilization of Cordyceps militaris by Sugar Transportome and Protein Structural Analysis
Sirithep, Cells 2020 - “...particular carbon source (i.e., xylose). In A. niger , two pentose transporters, i.e., An11g09600 and An03g01620, were highly expressed in the xylose and arabinose cultures, which were explained by the control of specific transcription factor (TF) as demonstrated by using a set of TF mutants [...”
- Updating genome annotation for the microbial cell factory Aspergillus niger using gene co-expression networks
Schäpe, Nucleic acids research 2019 - “...an l-arabitol dehydrogenase (An01g10920), aldose 1-epimerase (An02g09090), glycoside hydrolase (An12g01850), xylitol dehydrogenase (An12g00030), sugar transporter (An03g01620) and short-chain dehydrogenase (An04g03530). We therefore conclude that sub-networks generated in our study can be used to define A. niger co-expression relationships and infer gene function across strain backgrounds. Taken...”
- In Silico Analysis of Putative Sugar Transporter Genes in Aspergillus niger Using Phylogeny and Comparative Transcriptomics
Peng, Frontiers in microbiology 2018 - “...medium, respectively ( de Vries et al., 2017 ). Two putative pentose transporters, An11g09600 and An03g01620, were highly expressed on D -xylose and L -arabinose. Furthermore, two transporters encoding gene specifically induced by L -rhamnose (An07g00230 and An01g14620) and one induced by a D -galactose (An07g01310)...”
- “...confirm those of a previous study ( de Souza et al., 2013 ), in which An03g01620 and An08g01720 were also affected by AraR, while An06g00560 ( xltA ) was under control of XlnR. While some of the transporters appear to be under control of the same...”
- Inducer-independent production of pectinases in Aspergillus niger by overexpression of the D-galacturonic acid-responsive transcription factor gaaR
Alazi, Applied microbiology and biotechnology 2018 - “...#N/A #N/A NRRL3_00958 An14g04280 MFS-type sugar/inositol transporter GatA 3.472 524.952* 125.820* #N/A #N/A #N/A NRRL3_08663 An03g01620 MFS-type sugar/inositol transporter 0.274 5.622* 0.577 #N/A #N/A #N/A NRRL3_04281 An07g00780 MFS-type transporter 3.110 4.596 13.958* #N/A #N/A #N/A NRRL3_05650 An02g07710 D-galacturonate reductase GaaA 19.917 1515.440* 135.009* #N/A #N/A #N/A...”
- The pathway intermediate 2-keto-3-deoxy-L-galactonate mediates the induction of genes involved in D-galacturonic acid utilization in Aspergillus niger
Alazi, FEBS letters 2017 - “...gaaB 11309.00 13990.90 1.24 1.91E01 NRRL3_08281 An03g06740 Exopolygalacturonase Pgx28B pgx28B 200.31 2306.06 11.51 2.82E02 NRRL3_08663 An03g01620 MFStype sugar/inositol transporter 106.09 227.29 2.14 1.71E01 NRRL3_10050 An11g01120 l Glyceraldehyde reductase GaaD gaaD 8104.43 7499.78 0.93 5.79E01 NRRL3_10865 An08g01710 Alpha N arabinofuranosidase 201.62 440.98 2.19 1.92E01 NRRL3_01237 An19g00270 Pectin...”
- Expression-based clustering of CAZyme-encoding genes of Aspergillus niger
Gruben, BMC genomics 2017 - “...gaaR deletion mutant strains resulting in a cluster containing abfA, abfB, abfC, lacA, lacB and An03g01620 [ 15 ]. However, in this study, the abfB , abnA and lacA genes were separated from abfA , which indicates that abfA has a distinct expression profile from the...”
- Comparative transcriptome analysis reveals different strategies for degradation of steam-exploded sugarcane bagasse by Aspergillus niger and Trichoderma reesei
Borin, BMC genomics 2017 - “...the genes in these groups of orthologues. For instance, the pair of predicted orthologues genes An03g01620 in A. niger and 33630 in T. reesei , both are annotated as sugar transporters, the former as a putative high affinity glucose transporter (AspGD) and the latter as a...”
- The transcriptional activator GaaR of Aspergillus niger is required for release and utilization of d-galacturonic acid from pectin
Alazi, FEBS letters 2016 - “..., pgxC , paeA , pelA, and abfC ), sugar transporterencoding genes ( gatA , An03g01620, and An07g00780) and the GA catabolic pathway genes ( gaaAD ). These genes were suggested as the GAregulon and contain a common GAresponsive element (GARE) in their promoter regions. The...”
- “...GaaR (Table 1 and Fig. 2 ). The only exception is a putative GA transporter (An03g01620) that is expressed more than threefold less in gaaR for which the P value did not pass our significance level (0.05). In general, these observations show that the genes in...”
- More
F9ULF8 Myo-inositol (And similar sugars) transporter,major facilitator superfamily (MFS) from Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
26% identity, 57% coverage
CNAG_04931 hypothetical protein from Cryptococcus neoformans var. grubii H99
29% identity, 53% coverage
XP_002495678 uncharacterized protein from Zygosaccharomyces rouxii
30% identity, 51% coverage
MST8_ORYSJ / Q94EC4 Sugar transport protein MST8; Monosaccharide transporter 8; OsMST8; Sugar:proton symporter MST8 from Oryza sativa subsp. japonica (Rice) (see 2 papers)
30% identity, 54% coverage
- function: Mediates active uptake of hexoses by sugar:proton symport (By similarity). May play an important role in transporting monosaccharides during anther development (Probable).
AFE_2312, AFE_RS10630 sugar porter family MFS transporter from Acidithiobacillus ferrooxidans ATCC 23270
29% identity, 53% coverage
- Characterize the Growth and Metabolism of <i>Acidithiobacillus ferrooxidans</i> under Electroautotrophic and Chemoautotrophic Conditions
Wang, Microorganisms 2024 - “...protein 1.66 novel0005 - MULTISPECIES: ferredoxin family protein 1.57 AFE_RS09710 AFE_RS09710 ABC-2 transporter permease 1.49 AFE_RS10630 AFE_RS10630 sugar porter family MFS transporter 1.28 AFE_RS13730 AFE_RS13730 peptide ABC transporter substrate-binding protein 1.19...”
- Enhancement Mechanism of Stibnite Dissolution Mediated by Acidithiobacillus ferrooxidans under Extremely Acidic Condition
Wang, International journal of molecular sciences 2022 - “...AFE_1652 (encoding oxidoreductase alpha subunit), AFE_1651 (encoding 3-hydroxyisobutyrate dehydrogenase family protein), AFE_1589 (encoding DNA-damage-inducible protein), AFE_2312 (encoding Major facilitator superfamily (MFS) transporter), AFE_1636 (encoding hypothetical protein). These up-regulated genes are mainly annotated as the function of metabolic process, cellular process, binding, catalytic activity, transporter activity, molecular...”
- “...transfer in the biotransformation of Sb (III) in the presence of trace iron. In addition, AFE_2312 is very similar to xylose and galactose proton symporters, which is proposed to be related to the MFS transporter superfamily contributing to the carbohydrate transporter of the outer membrane [...”
FST1_GIBM7 / W7MAT5 Myo-inositol transporter FST1 from Gibberella moniliformis (strain M3125 / FGSC 7600) (Maize ear and stalk rot fungus) (Fusarium verticillioides) (see 3 papers)
TC 2.A.1.1.126 / A8DCT2 Myo inositol uptake porter of 574 aas and 12 TMSs, Fst1 from Gibberella moniliformis
FVEG_08441 MFS transporter, SP family, major inositol transporter from Fusarium verticillioides 7600
32% identity, 51% coverage
- function: Transporter for myo-inositol (PubMed:27195938). Also appears to transport the polyketide mycotoxin fumonisin B1 (FB1) (PubMed:20854112, PubMed:27195938). Does not appear to transport hexose sugars (PubMed:18705852, PubMed:20854112).
catalytic activity: myo-inositol(out) + H(+)(out) = myo-inositol(in) + H(+)(in) (RHEA:60364)
disruption phenotype: Abolishes synthesis of the polyketide mycotoxin fumonisin B1 (FB1), severely decreases macroconidia production, results in hydrogen peroxide sensitivity, and decreases virulence in maize kernels. - substrates: myo-inositol
tcdb comment: Also takes up the polyketide mycotoxin produced by Fusarium verticillioides during the colonization of maize kernels, Fumonisin B1 (FB1). The activity was demonstrated with the orthologue in Weissella verticillioides (Niu et al. 2016) - Involvement of FST1 from Fusarium verticillioides in virulence and transport of inositol
Niu, Molecular plant pathology 2017 (secret) - Transcription factor ART1 mediates starch hydrolysis and mycotoxin production in Fusarium graminearum and F. verticillioides
Oh, Molecular plant pathology 2016 - “...kinase; FVEG_00957) and Fst1 (a putative hexose transporter; FVEG_08441) have been demonstrated to be involved in carbon utilization and to be required for...”
- Transcriptome changes in Fusarium verticillioides caused by mutation in the transporter-like gene FST1
Niu, BMC microbiology 2015 - “...on carbon utilization have led to the identification of two genes, HXK1 (FVEG_00957) and FST1 (FVEG_08441). HXK1, a putative hexose kinase was shown to be required for fructose metabolism [ 14 ]. Strains without a functional HXK1 also produced less FB1 and were less virulent on...”
- “...fumonisin production. The second peculiar annotation change in the reference genome was that for FST1 (FVEG_08441). Originally listed as a hypothetical protein, with similarity to hexose transporters, the gene is now listed as a myo-inositol transporter. Inositol is a polyol that functions as an essential constituent...”
- Metabolome and transcriptome of the interaction between Ustilago maydis and Fusarium verticillioides in vitro
Jonkers, Applied and environmental microbiology 2012 - “...Among these are Fst1, Fst2, Fst3, and Fst6 (FVEG_08441, FVEG_13078, FVEG_05690, and FVEG_10089, respectively). Fst1 is a putative sugar transporter, involved in...”
AT2G18480 mannitol transporter, putative from Arabidopsis thaliana
29% identity, 52% coverage
- Root-based inorganic carbon uptake increases the growth of Arabidopsis thaliana and changes transporter expression and nitrogen and sulfur metabolism
Gamarra, Frontiers in plant science 2024 - “...0.49 31.46 Carnitine transporter AT1G73220 Organic cation/carnitine transporter 1 OCT1 -1.11 0.46 51.96 Polyol transporter AT2G18480 Probable polyol transporter 3 PLT3 -1.18 0.44 137.94 Boron transporter AT1G74810 Putative boron transporter 5 BOR5 -1.55 0.34 10.90 Ascorbate transporter AT1G49960 Nucleobase-ascorbate transporter 4 NAT4 -1.65 0.32 229.76 Aminoacid...”
- Genomic methylation patterns in pre-meiotic gynoecia of wild-type and RdDM mutants of Arabidopsis
Ortiz-Vasquez, Frontiers in plant science 2023 - “...Supplementary Table S8 ). Four are hypomethylated in ago4 but hypermethylated in ago9 and rdr6 (At2g18480; At3g02610; At4g15440; and At5g17600; encoding for the probable polyol transporter PLT3, the acyl-acyl carrier protein desaturase AAD2, the cytochrome CYP74B2, and the Arabidopsis toxic yeast protein ATL52, respectively; Supplementary Table...”
- Transcriptome analysis of Pará rubber tree (H. brasiliensis) seedlings under ethylene stimulation
Nakano, BMC plant biology 2021 - “...AT1G77210 AtSTP14 3.04 3.23 2.81 H+-Symporter family for polyols and monosaccharides (plasma membrane) 0 bx046600 AT2G18480 AtPLT3 6.25 6.26 6.34 Putative monosaccharide transporter family (ERD-group=induced by early dehydration) 0 bx021636 AT2G48020 Major facilitator superfamily protein 2.01 2.93 2.45 0 bx037209 AT2G48020 Major facilitator superfamily protein 2.01...”
- Heat-Induced Oxidation of the Nuclei and Cytosol
Babbar, Frontiers in plant science 2020 - “...(AT3G46900), RPF6 (AT1G63130), BGLU28 (AT2G44460), VSP1 (AT5G24780), HP-hypothetical protein (AT2G19970), SBT4.1 (AT5G59120), JAL23 (AT2G39330), PLT3 (AT2G18480), TAS1B (AT1G50055), HSP22 (AT4G10250), HSFA2 (AT2G26150), HSP17.6C (AT1G53540), HSP17.6A (AT5G12030), HSFA7B (AT3G63350), HSP23.6 (AT4G25200), HSP17.6A (AT5G12030), NAD6 (ATMG00270), HSP17.4A (AT3G46230), HSP17.6 (AT5G12020), natRNA (AT3G07365), CALS12 (AT5G03550), HSP21 (AT4G27670), RLP1 (AT1G07390),...”
- Natural genetic variation in Arabidopsis for responsiveness to plant growth-promoting rhizobacteria
Wintermans, Plant molecular biology 2016 - “...the transport of purine and derivatives such as cytokinins across the plasma membrane SFW 5.22 At2G18480 Major facilitator superfamily protein Carbohydrate transmembrane transporter activity; plant structure SFW 5.58 At2G20570 Golden2-like 1 (GLK1) Transcription factor activity; regulates expression of the photosynthetic apparatus (with GLK2) SFW 5.46 At4G09730...”
- “...Rubisco biogenesis-related DEAD box protein RH39 (Nishimura et al. 2010 ), carbohydrate transmembrane transport protein At2G18480, Nitrilase-like protein 1 (NLP1) (Kusano et al. 2008 ), and the photorespiration-related mitochondrial serine hydroxymethyltransferase SHM2 (Engel et al. 2011 ; Voll et al. 2006 ) (Table 1 ). Overall,...”
- Global Transcriptome Analysis Reveals Distinct Aluminum-Tolerance Pathways in the Al-Accumulating Species Hydrangea macrophylla and Marker Identification
Chen, PloS one 2015 - “...3.4 At1g75840 ATROP4 (rho-like GTP-binding protein 4) c220714.graph_c0 4.1 At2g23150 ATNRAMP3(manganese ion transporter) c140176.graph_c0 3.9 At2g18480 PLT3 (probable polyol transporter 3) c211750.graph_c1 5.9 c204065.graph_c0 6.6 c203825.graph_c0 6.2 At3g05400 SUGTL5 (sugar transporter ERD6-like 12) c207258.graph_c2 3.5 c155119.graph_c1 3.3 At3g12750 ZIP (zinc transporter 1) c183609.graph_c0 4.2 c217013.graph_c0 3.8...”
- The Vitis vinifera sugar transporter gene family: phylogenetic overview and macroarray expression profiling
Afoufa-Bastien, BMC plant biology 2010 - “...(AtINT2), At2g35740 (AtINT3), At4g16480 (AtINT4), At3g03090 (AtVGT1), At5g17010 (AtVGT2), At5g59250 (AtVGT3), At2g16120 (AtPMT1), At2g16130 (AtPMT2), At2g18480 (AtPMT3), At2g20780 (AtPMT4), At3g18830 (AtPMT5), At4g36670 (AtPMT6); for Vitis ones see Additional file 1 . Vitis ORFs names were simplified, Vv indicating GSVIVT000. Vitis vinifera putative Polyol/Monosaccharide Transporters (VvPMT; subfamily...”
STP11_ARATH / Q9FMX3 Sugar transport protein 11; Hexose transporter 11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
TC 2.A.1.1.61 / Q9FMX3 High affinity monosaccharide (Km = 25 µM) transporter (takes up glucose, galactose, mannose, xylose and 3-O-methylglucose, but not fructose and ribose), STP11 (expressed in pollen tubes) from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
stp11 / CAC69075.1 STP11 protein from Arabidopsis thaliana (see paper)
NP_197718 sugar transporter 11 from Arabidopsis thaliana
AT5G23270 STP11 (SUGAR TRANSPORTER 11); carbohydrate transmembrane transporter/ sugar:hydrogen symporter from Arabidopsis thaliana
29% identity, 54% coverage
- function: Mediates an active uptake of hexoses, probably by sugar/hydrogen symport. Can transport glucose, galactose, mannose, xylose and 3-O-methylglucose, but not fructose and ribose.
- substrates: Sugars
tcdb comment: This protein is also called Sugar Transport Protein (STP). Expression profiles of homologues in cabbage have been studied (Zhang et al. 2019) - AtSTP11, a pollen tube-specific monosaccharide transporter in Arabidopsis.
Schneidereit, Planta 2005 (PubMed)- GeneRIF: AtSTP11 transporter plays a role in the supply of monosaccharides to growing pollen tubes. [AtSTP11]
- Do mitochondria use efflux pumps to protect their ribosomes from antibiotics?
Islam, Microbiology (Reading, England) 2023 - “...MFS G1UAY0, 2.3E^6 Q56ZZ7, 2.3E^7 Q8NBP5, 8.4E^9 [ 78 ] NCU10021 Q7S0I5 MFS Q8J2J7, 8.1E^102 Q9FMX3, 2.3E^55 Q96QE2, 2.8E^41 [ 78 ] *Information gathered from NCBI Protein BLAST, algorithm: PSI-BLAST ( https://www.ncbi.nlm.nih.gov/ ) and HMMER phmmer, Database: Reference Proteomes ( http://hmmer.org/ ) . The accession code...”
- Genome-wide identification, expression, and association analysis of the monosaccharide transporter (MST) gene family in peanut (Arachis hypogaea L.)
Wan, 3 Biotech 2020 - “...arsenic accumulation AhMST16 AhMST41 AhMST54 AhMST69 AtSTP11 (AT5G23270) STP12 (AT4G21480) AtINT2 (AT1G30220) AtPMT1 (AT2G16120) Stadler et al. (2003), Sherson...”
- Plant glucose transporter structure and function
Geiger, Pflugers Archiv : European journal of physiology 2020 - “...pollen Plasma membrane Glucose, galactose, mannose, High [ 109 , 122 , 124 ] AtSTP11 At5g23270 Fully mature pollen and growing pollen tubes Plasma membrane Glucose, galactose, mannose, xylose, arabinose High [ 122 , 132 ] AtSTP12 At4g21480 Multiple tissues except pollen Plasma membrane Glucose, galactose,...”
- Genome-Wide Identification and Expression Profiling of Sugar Transporter Protein (STP) Family Genes in Cabbage (Brassica oleracea var. capitata L.) Reveals their Involvement in Clubroot Disease Responses
Zhang, Genes 2019 - “...Bol000549 Scaffold000531 MF1 1536 511 56.16 8.60 30.51 97.50 0.48 cell membrane tPCK7 Q AtSTP11 AT5G23270 1545 514 BoSTP11 Bol017091 C06 LF 1569 522 57.17 5.79 33.58 105.50 0.55 cell membrane Clade III tPCK1 A AtSTP2 AT1G07340 1497 498 BoSTP2a Bol023380 C08 MF1 1497 498 55.48...”
- The Arabidopsis KH-Domain RNA-Binding Protein ESR1 Functions in Components of Jasmonate Signalling, Unlinking Growth Restraint and Resistance to Stress
Thatcher, PloS one 2015 - “...1.0E-02 mitochondrial editing factor 20 AT1G20080 SYTB 7.60 1.1E-02 Calcium-dependent lipid-binding (CaLB domain) family protein AT5G23270 STP11 6.74 1.2E-02 sugar transporter 11 AT2G19910 2.15 1.3E-02 RNA-dependent RNA polymerase family protein AT3G47090 2.09 1.5E-02 Leucine-rich repeat protein kinase family protein AT5G38040 2.15 1.8E-02 UDP-Glycosyltransferase superfamily protein AT5G23600...”
- Floral heteromorphy in Primula vulgaris: progress towards isolation and characterization of the S locus
Li, Annals of botany 2011 - “...AT1G77390 2e-25 9e-24 82I1-R 28H15-F 2 2 AT1G21640 AT5G23270 1e-35 3e-37 28H15-R 2 AT1G74720 1e-97 17A21-R 81I19-F 3 3 AT2G04280 AT4G29090 4e-60 4e-30 56H19-R...”
- The Vitis vinifera sugar transporter gene family: phylogenetic overview and macroarray expression profiling
Afoufa-Bastien, BMC plant biology 2010 - “...(AtSTP3), At3g19930 (AtSTP4), At1g34580 (AtSTP5), At3g05960 (AtSTP6), At4g02050 (AtSTP7), At5g26250 (AtSTP8), At1g50310 (AtSTP9), At3g19940 (AtSTP10), At5g23270 (AtSTP11), At4g21480 (AtSTP12), At5g26340 (AtSTP13), At1g77210 (AtSTP14); for Vitis ones see Additional file 1 . Vitis vinifera putative Tonoplast Monosaccharide Transporters (VvTMT; subfamily II) We have also identified three ORFs,...”
- Gene expression in developing fibres of Upland cotton (Gossypium hirsutum L.) was massively altered by domestication
Rapp, BMC biology 2010 - “...4 column 2, row 5 of the transition matrix, the cotton genes are homologous to At5g23270 ( AtFER1 ). As reviewed recently [ 62 ], wide expression of AtFER1 in Arabidopsis supports the regulation of iron concentration and the moderation of ROS levels in response to...”
FVEG_01519 hypothetical protein from Fusarium verticillioides 7600
28% identity, 53% coverage
- Involvement of FST1 from Fusarium verticillioides in virulence and transport of inositol
Niu, Molecular plant pathology 2017 (secret) - Transcriptome changes in Fusarium verticillioides caused by mutation in the transporter-like gene FST1
Niu, BMC microbiology 2015 - “...F. verticillioides genome with the yeast ITR1p sequence identified eight genes with high sequence similarity (FVEG_01519, FVEG_01638, FVEG_02081, FVEG_03992, FVEG_06504, FVEG_07757, FVEG_11293, and FVEG_12687). The sequence of FST1 was not identified by the search. Among the eight identified genes, expression was significantly down-regulated in fst1 for...”
orf9 major facilitator superfamily permease-possibl y sugar transporter from Gramella forsetii KT0803
30% identity, 53% coverage
TRIREDRAFT_106556 galactose permease from Trichoderma reesei QM6a
G0RGR7 Galactose permease from Hypocrea jecorina (strain QM6a)
27% identity, 55% coverage
- Effect of the res2 transcription factor gene deletion on protein secretion and stress response in the hyperproducer strain Trichoderma reesei Rut-C30
Alharake, BMC microbiology 2023 - “...the condition LC/GC in res2 but not regulated in Rut-C30, such as low-affinity glucose transporter TRIREDRAFT_106556 ( hxt13 ), TRIREDRAFT_62747, and TRIREDRAFT_47897 which is involved in the oxidative stress response. One MFS transporter in this cluster is downregulated in the mutant (TRIREDRAFT_58561). On the other hand,...”
- “...hydrolase family 55 LC/GC -2.17 6 TRIREDRAFT_121746 Putative Glycoside hydrolase family 55 GD/GC -2.20 6 TRIREDRAFT_106556 hxt13 hexose transporter GD/GC LD/LC LC/GC 5.08 3.14 6.67 4 TRIREDRAFT_62747 MFS membrane transporter LC/GC 3.16 4 TRIREDRAFT_47897 snq2 ABC transporter involved in oxidative stress response GD/GC LC/GC 2.08 3.17...”
- Advances in fungal sugar transporters: unlocking the potential of second-generation bioethanol production.
Pereira, Applied microbiology and biotechnology 2025 - “...Glucose, xylose, fructose, galactose, and mannose T. reesei Sloothaak et al. ( 2016b ) GLT1 G0RGR7 Glucose T. reesei Havukainen et al. ( 2021b ) STP1 G0RIJ1 Glucose, fructose, galactose, mannose, cellobiose, xylose, and L-arabinose T. reesei Zhang et al. ( 2013 ); Wang et al....”
NP_777028 solute carrier family 2, facilitated glucose transporter member 3 from Bos taurus
26% identity, 57% coverage
CC0814 major facilitator family transporter from Caulobacter crescentus CB15
29% identity, 58% coverage
- Regulation of D-xylose metabolism in Caulobacter crescentus by a LacI-type repressor
Stephens, Journal of bacteriology 2007 - “...on the top line. This region includes xylE (CC0814), which encodes a putative xylose transporter. The gene nomenclature is the nomenclature described previously...”
- “...of other members of this regulon, we examined expression of CC0814, which is located near the xyl operon but is not part of the same transcription unit (Fig....”
- Transcriptional profiling of Caulobacter crescentus during growth on complex and minimal media
Hottes, Journal of bacteriology 2004 - “...fbaA Transport CC0442, TonB-dependent receptora CC0814, major facilitator family transporterc CC0991, TonB-dependent receptora CC0999, TonB-dependent receptor,...”
- “...membrane. Xylose also induced expression of a gene (CC0814) encoding a member of the major facilitator superfamily of inner membrane proteins. The CC0814...”
YE2639 putative transporter protein from Yersinia enterocolitica subsp. enterocolitica 8081
30% identity, 51% coverage
SXYL_00126 sugar porter family MFS transporter from Staphylococcus xylosus
31% identity, 52% coverage
CCNA_00857 D-xylose transporter from Caulobacter crescentus NA1000
29% identity, 58% coverage
- mutant phenotype: Specifically important for D-xylose utilization. Also see PMC2168598 and PMC344409. May also be important for lactose utilization, which is not explained.
GOX0808 Galactose-proton symporter from Gluconobacter oxydans 621H
32% identity, 55% coverage
SNF3 glucose sensor from Candida albicans (see paper)
XP_723173 glucose sensor from Candida albicans SC5314
30% identity, 42% coverage
- CharProtDB CGD description: glucose and galactose sensor; fermentation, filamentation, virulence roles; in 20-member C. albicans glucose transporter family, extended C terminus; high-glucose repressed; induced in macrophage, repressed in biofilm
- Comparative genomics of the white-rot fungi, Phanerochaete carnosa and P. chrysosporium, to elucidate the genetic basis of the distinct wood types they colonize
Suzuki, BMC genomics 2012 - “...of corresponding sequences are: AnHyp1 (XP_682442.1), AnHyp2 (XP_660070.1), AnMstA (CAC80843), Ao_BAE58341.1 (BAE58341.1), CaHgt1 (CAA76406), CaHgt4 (XP_723173), CaHgt11 (XP_719597), CiGxf1 (AJ937350), CiGxs1 (AJ875406), GzHyp1 (EAA74528), HpGcr1 (AAR88143), KlHgt1 (XP_451484), KlRag1 (XP_453656), KlRag4 (CAA75114), Lb_EDR07962 (EDR07962), NcHyp1 (XP_328858), NcHxt3 (CAD21508), NcNCU00801(EAA34565.1), NcNCU08114 (XP_963873.1), NcRco3 (CAE76420), Pp_115604 (EED81359), Ps_ABN65648.2...”
- Catabolite repression of Aox in Pichia pastoris is dependent on hexose transporter PpHxt1 and pexophagy
Zhang, Applied and environmental microbiology 2010 - “...for HpGcr1, CAI44932 for CiGxs1, EU476007 for HpHxs1, XP_723173 for CaHgt4, CAA75114 for KlRag4, NP_010087 for ScSnf3, and NP_010143 for ScRgt2. cerevisiae and...”
- Identification of hexose transporter-like sensor HXS1 and functional hexose transporter HXT1 in the methylotrophic yeast Hansenula polymorpha
Stasyk, Eukaryotic cell 2008 - “...are as follows: AnMSTA, AAL89822; CaHgt4, XP_723173; CaHgt12, XP_888662; CiGxs1, CAI44932; CiGxf1, CAI77652; HpGcr1, AAR88143; HpHxt1, EU476006; HpHxs1,...”
GTR3_SHEEP / P47843 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Ovis aries (Sheep) (see paper)
NP_001009770 solute carrier family 2, facilitated glucose transporter member 3 from Ovis aries
26% identity, 56% coverage
- function: Facilitative glucose transporter. Can also mediate the uptake of various other monosaccharides across the cell membrane. Mediates the uptake of glucose, 2-deoxyglucose, galactose, mannose, xylose and fucose, and probably also dehydroascorbate. Does not mediate fructose transport. Required for mesendoderm differentiation (By similarity).
catalytic activity: D-glucose(out) = D-glucose(in) (RHEA:60376)
catalytic activity: D-galactose(in) = D-galactose(out) (RHEA:34915)
subunit: Interacts with SMIM43; the interaction may promote SLC2A3- mediated glucose transport to meet the energy needs of mesendoderm differentiation. - Impact of Placental SLC2A3 Deficiency during the First-Half of Gestation.
Lynch, International journal of molecular sciences 2022 - GeneRIF: Impact of Placental SLC2A3 Deficiency during the First-Half of Gestation.
- iTRAQ-Based Identification of Proteins Related to Muscle Growth in the Pacific Abalone, Haliotis discus hannai.
Huang, International journal of molecular sciences 2017 - “...A1, actin-2, actin, solute carrier family 2 facilitated glucose transporter member 3 (SLC2A3; Accession Number: P47843) ACTB, GDPD1 Endometrial cancer - kitasatospora griseola strain MF730-N6 RKJC_4, EGFR, GDPD1 Shigellosis actin A1, actin-2, actin profilin (Accession Number: F4XXT7), ACTB, GDPD1 Regulation of actin cytoskeleton actin A1, actin-2,...”
- Production and release of antimicrobial and immune defense proteins by mammary epithelial cells following Streptococcus uberis infection of sheep
Addis, Infection and immunity 2013 - “...Q258K2 P28783 Q1JPB0 P20000 P20700 Q8SPQ0 P27214 O46522 P47843 Integrin beta-2 Myeloperoxidase Annexin A3 Vimentin Filamin A Coronin 1A Myosin 9 Protein S100A9...”
CNBG_2028 MFS transporter SP family solute carrier family 2 (myo-inositol transporter) member 13 from Cryptococcus deuterogattii R265
28% identity, 52% coverage
SS1G_13734 hypothetical protein from Sclerotinia sclerotiorum 1980 UF-70
28% identity, 52% coverage
TC 2.A.1.1.39 / P49374 The high affinity glucose transporter, Hgt1 from Kluyveromyces lactis (Yeast) (Candida sphaerica) (see 2 papers)
XP_451484 hypothetical protein from Kluyveromyces lactis NRRL Y-1140
XP_451484 uncharacterized protein from Kluyveromyces lactis
28% identity, 51% coverage
- substrates: glucose
- Major facilitator superfamily
Pao, Microbiology and molecular biology reviews : MMBR 1998 - “...540 486 457 602 818 569 S59368 P13181 L21753 P49374 P32465 P23585 P32466 P32467 P38695 P39003 P39004 P40886 P43581 P40885 P39924 P42833 P47185 Z71687 P30605...”
- Genetic basis of the highly efficient yeast Kluyveromyces marxianus: complete genome sequence and transcriptome analyses
Lertwattanasakul, Biotechnology for biofuels 2015 - “...Ps_XUT7, XP_001387067; Ps_RGT2, XP_001386588; Ps_SLT1, XP_001383774; Kl_KHT1/RAG1, XP_453656; Kl_KHT2, GN107317; Kl_KHT3, XP_454897; Kl_FRT1, XP_454356; Kl_HGT1, XP_451484; Kl_HXT1, XP_455078; Kl_HXT14, XP_454897; Kl_HXT2, XP_453960; Kl_HXT3, XP_453088; Sc_HXT4/LGT1, NP_011960; Kl_STL1, XP_456249; Kl_RAG4, XP_455315; Kl_LAC12, XP_452193; Ca_HXT6, XP_719472. Genes for the initial catabolism of xylose, PPP, the conversion of PEP...”
- Comparative genomics of the white-rot fungi, Phanerochaete carnosa and P. chrysosporium, to elucidate the genetic basis of the distinct wood types they colonize
Suzuki, BMC genomics 2012 - “...CaHgt1 (CAA76406), CaHgt4 (XP_723173), CaHgt11 (XP_719597), CiGxf1 (AJ937350), CiGxs1 (AJ875406), GzHyp1 (EAA74528), HpGcr1 (AAR88143), KlHgt1 (XP_451484), KlRag1 (XP_453656), KlRag4 (CAA75114), Lb_EDR07962 (EDR07962), NcHyp1 (XP_328858), NcHxt3 (CAD21508), NcNCU00801(EAA34565.1), NcNCU08114 (XP_963873.1), NcRco3 (CAE76420), Pp_115604 (EED81359), Ps_ABN65648.2 (ABN65648.2), PsSut1 (AAD00266), ScHxt1 (M82963), ScHxt7 (NP_010629), ScSnf3 (P10870), SpGht1 (Q9P3U6), Tm-CAZ81962.1...”
- Galactose transport in Kluyveromyces lactis: major role of the glucose permease Hgt1.
Baruffini, FEMS yeast research 2006 (PubMed)- GeneRIF: Study confirmed the existence of a second galactose transporter which turned out to be HGT1, previously identified as encoding the high-affinity glucose carrier.
LLKF_1623 D-xylose-proton symporter from Lactococcus lactis subsp. lactis KF147
32% identity, 52% coverage
Q6CCJ1 YALI0C08943p from Yarrowia lipolytica (strain CLIB 122 / E 150)
29% identity, 56% coverage
STP10_ARATH / Q9LT15 Sugar transport protein 10; AtSTP10; D-glucose-H(+) symport protein STP10; D-glucose-proton symporter STP10; Hexose transporter 10 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
TC 2.A.1.1.124 / Q9LT15 The high affinity sugar:H+ symporter (sugar uptake) porter of 514 aas and 12 TMSs, STP10. It transports glucose, galactose and mannose, and is therefore a hexose transporter (Rottmann et al. 2016). The 2.4 from Arabidopsis thaliana
NP_188628 Major facilitator superfamily protein from Arabidopsis thaliana
AT3G19940 sugar transporter, putative from Arabidopsis thaliana
26% identity, 54% coverage
- function: Hexose-H(+) symporter that catalyzes the high-affinity uptake of glucose, galactose and mannose (PubMed:26893494). Proton-coupled symporter responsible for the uptake of glucose from the apoplast into the cells (Probable).
catalytic activity: D-glucose(out) + H(+)(out) = D-glucose(in) + H(+)(in) (RHEA:69556)
catalytic activity: D-mannose(out) + H(+)(out) = D-mannose(in) + H(+)(in) (RHEA:69560)
catalytic activity: D-galactose(in) + H(+)(in) = D-galactose(out) + H(+)(out) (RHEA:29019)
disruption phenotype: No visible phenotype under normal growth conditions. - substrates: Galactose, Hexoses, Mannose, glucose
tcdb comment: Å structure with glucose bound has been solved, explaining high affinity sugar recognition (Paulsen et al. 2019). The results suggest a proton donor/acceptor pair that links sugar transport to proton translocation. It contains a Lid domain, conserved in all sugar transport proteins, that locks the mobile transmembrane domains through a disulfide bridge, and creates a protected environment which allows efficient coupling of the proton gradient to drive sugar uptake (Paulsen et al. 2019) - Evolutionary balance between foldability and functionality of a glucose transporter
Choi, Nature chemical biology 2022 - “...transporter 1 (O97467), Staphylococcus epidermidis Glucose transporter (A0A0H2VG78) and Arabidopsis thaliana Sugar transport protein 10 (Q9LT15). The PDB accession number for structures for these reference proteins are 4ZWC (P11169), 4GBZ (P0AGF4), 6RW3 (O97467), 4LDS (A0A0H2VG78) and 6H7D (Q9LT15). Since the sequences are divergent and therefore difficult...”
- “...4LDS and 6H7D). Also, The following UniProt IDs were used (P11169, P0AGF4, O97467, A0A0H2VG78 and Q9LT15). Code availability A program, written in LabView, to control the magnetic tweezers apparatus has been deposited in Github ( https://github.com/tyyoonlab/Science_aaw8208 ) and is available at Zenodo (doi:10.5281/zenodo.3528913). Codes for analyzing...”
- Utilization of AlphaFold2 to Predict MFS Protein Conformations after Selective Mutation.
Xiao, International journal of molecular sciences 2022 - “...To date, several structures of MFS proteins (UniProt ID: P0AA76, P0AEY8, P0AGF4, P02920, Q6MLJ0, and Q9LT15) have been found in both the outward- and inward-opening conformations [ 9 , 10 , 11 , 12 , 30 , 31 , 32 , 33 , 34 , 35...”
- “...5AYM) for Q6MLJ0, 0.88 (inward, PDB ID: 7AAR) and 0.75 (outward, PDB ID: 7AAQ) for Q9LT15, and 0.39 (inward, PDB ID: 4ZP0) and 1.95 (outward, PDB ID: 6GV1) for P0AEY8. Most of these predicted structures, including mutants, have approximately 1 or less deviation from the experimentally...”
- Structural comparison of GLUT1 to GLUT3 reveal transport regulation mechanism in sugar porter family
Custódio, Life science alliance 2021 - “...), GLUT4 (UniProt P14672 ), rGLUT5 (UniProt P43427 ), bGLUT5 (UniProt P58353 ), atSTP10 (UniProt Q9LT15 ), XylE (UniProt P0AGF4 ), and GlcPse (UniProt A0A0H2VG78 ). Conserved residues are highlighted with gray-scale. Alpha helices as found in GLUT1 are represented above the sequence as colored tubes....”
- SLC22A14 is a mitochondrial riboflavin transporter required for sperm oxidative phosphorylation and male fertility.
Kuang, Cell reports 2021 - “...etal., 2019 ) revealed that both the human SLC22A14 and the A.thaliana STP10 (UniProt entry Q9LT15) belonged to the Major facilitator, sugar transporter-like protein family (IPR005828), strengthening our confidence that the correct template had been chosen. Finally, quality of the models was assessed using MolProbity (...”
- Crystal structure of the plant symporter STP10 illuminates sugar uptake mechanism in monosaccharide transporter superfamily
Paulsen, Nature communications 2019 - “...plant life. Methods Protein purification The gene encoding the Arabidopsis thaliana protein STP10 (Accession number Q9LT15 [ https://www.uniprot.org/uniprot/Q9LT15 ]) was introduced into an expression construct based on p423_GAL1 40 with a C-terminal purification tag containing a thrombin cleavage site and a deca-histidine tag. The primers used...”
- Molecular mechanism of sugar transport in plants unveiled by structures of glucose/H+ symporter STP10.
Bavnhøj, Nature plants 2021 (PubMed)- GeneRIF: Molecular mechanism of sugar transport in plants unveiled by structures of glucose/H(+) symporter STP10.
- STP10 encodes a high-affinity monosaccharide transporter and is induced under low-glucose conditions in pollen tubes of Arabidopsis.
Rottmann, Journal of experimental botany 2016 - GeneRIF: A high-affinity glucose uptake system is induced in growing pollen tubes under low glucose conditions and that this regulation may occur through the hexokinase pathway. [AtSTP10]
- Phaseolus vulgaris STP13.1 is an H+-coupled monosaccharide transporter, present in source leaves and seed coats, with higher substrate affinity at depolarized potentials
Pegler, Plant direct 2024 - “...is presented as the mean standard error. Figure S1: Amino acid sequence alignment of AtSTP10 (At3g19940), AtSTP13 (At5G26340) BvSTP13 (Bevul.3G139500), MdSTP13a (MD13G1189100), MtSTP13.1 (Medtr5g006070), MtSTP13.2 (Medtr1g104780), PvSTP13.1 (Phvul.002G046800), PvSTP13.2 (Phvul.007G055100) and TaSTP13 (Traes_4DL_CFC191A06). Amino acid residues encased in a red box indicate residues participating in AtSTP10...”
- Calmodulin-Domain Protein Kinase PiCDPK1 Interacts with the 14-3-3-like Protein NtGF14 to Modulate Pollen Tube Growth
Scheible, Plants (Basel, Switzerland) 2024 - “...Epsin family of endocytic proteins Accessory proteins that facilitate vesicle biogenesis [ 41 ] A0A1S4AFS9 AT3G19940 Sugar Transport Protein 10 Sugar Transport Protein Glucose uptake in growing pollen tubes [ 42 ] A0A1S4AKF1 AT1G16010 Magnesium Transporter 2 Transmembrane magnesium transporter Tonoplast-targeted transporter for vacuolar accumulation of...”
- Exploring the genic resources underlying metabolites through mGWAS and mQTL in wheat: From large-scale gene identification and pathway elucidation to crop improvement
Chen, Plant communications 2021 - “...behind the accumulation of the metabolite sucrose ( Chen etal., 2020 ). Their orthologin Arabidopsis AT3G19940 , which is also known as STP10 , encodes a high-affinity hexose transporter ( Rottmann etal., 2016 ). These examples thus collectively demonstrate that the approach enables us to identify...”
- Plant glucose transporter structure and function
Geiger, Pflugers Archiv : European journal of physiology 2020 - “...developed pollen grain Plasma membrane Glucose, galactose, arabinose High [ 122 , 131 ] AtSTP10 At3g19940 Germinating pollen and growing pollen Plasma membrane Glucose, galactose, mannose, High [ 109 , 122 , 124 ] AtSTP11 At5g23270 Fully mature pollen and growing pollen tubes Plasma membrane Glucose,...”
- Metabolite-based genome-wide association study enables dissection of the flavonoid decoration pathway of wheat kernels
Chen, Plant biotechnology journal 2020 - “...respectively. The top hit of these candidates ( TraesCS4B01G371700 and TraesCS4D01G365800 ) in Arabidopsis ( AT3G19940 , also known as SPT10 ) encodes a highaffinity hexose transporter carrying glucose and other monosaccharides (Paulsen et al. , 2019 ; Rottmann et al. , 2016 ). Similarly, for...”
- Genome-Wide Identification and Expression Profiling of Sugar Transporter Protein (STP) Family Genes in Cabbage (Brassica oleracea var. capitata L.) Reveals their Involvement in Clubroot Disease Responses
Zhang, Genes 2019 - “...Bol014014 Scaffold000180 MF2 1551 516 56.15 6.89 33.77 101.67 0.54 cell membrane tPCK2 F AtSTP10 AT3G19940 1545 514 BoSTP10 Bol000549 Scaffold000531 MF1 1536 511 56.16 8.60 30.51 97.50 0.48 cell membrane tPCK7 Q AtSTP11 AT5G23270 1545 514 BoSTP11 Bol017091 C06 LF 1569 522 57.17 5.79 33.58...”
- Transcriptomic and proteomic approach to identify differentially expressed genes and proteins in Arabidopsis thaliana mutants lacking chloroplastic 1 and cytosolic FBPases reveals several levels of metabolic regulation
Soto-Suárez, BMC plant biology 2016 - “...: Table S4). Sugar transporter 2 (At1g07340) and three sugar transporter family proteins (At3g05155, At4g04760, At3g19940) were up-regulated in cyfbp rosettes, and only a mannitol transporter (At2g20780) was down-regulated. Finally, a carbohydrate transmembrane transporter (At1g08930) and two UDP-galactose transporters (At4g23010 and At3g59360) were up-regulated in cyfbp...”
- STP10 encodes a high-affinity monosaccharide transporter and is induced under low-glucose conditions in pollen tubes of Arabidopsis
Rottmann, Journal of experimental botany 2016 - “...microarray data furthermore indicate a rather high expression of the so far uncharacterized STP10 ( At3g19940 ) in pollen tubes. In the present paper, we describe the detailed characterization of the Arabidopsis monosaccharide transporter gene STP10 , which is expressed in pollen tubes and also in...”
- More
TC 2.A.1.1.122 / AGG19156.1 Sorbitol (glucitol):H+ co-transporter, SOT2 (Km for sorbitol of 0.81 mM) of 491 aas and 12 TMSs (Gao et al. 2003). SOT2 of Prunus cerasus is mainly expressed only early in fruit development and not in leaves from Pyrus pyrifolia
29% identity, 52% coverage
Q6BTD8 DEHA2D01474p from Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
29% identity, 52% coverage
TC 2.A.1.1.68 / A3M0N3 The Glucose Transporter/Sensor Rgt2 from Pichia stipitis (see paper)
XP_001386588 glucose transporter/sensor from Scheffersomyces stipitis CBS 6054
29% identity, 54% coverage
- substrates: glucose
- Genetic basis of the highly efficient yeast Kluyveromyces marxianus: complete genome sequence and transcriptome analyses
Lertwattanasakul, Biotechnology for biofuels 2015 - “...Ps_XUT1, XP_001385583; Ps_XUT2, XP_001387242; Ps_XUT3, XP_001387138; Ps_XUT4, XP_001386715; Ps_XUT5, XP_001385962; Ps_XUT6, XP_001386589; Ps_XUT7, XP_001387067; Ps_RGT2, XP_001386588; Ps_SLT1, XP_001383774; Kl_KHT1/RAG1, XP_453656; Kl_KHT2, GN107317; Kl_KHT3, XP_454897; Kl_FRT1, XP_454356; Kl_HGT1, XP_451484; Kl_HXT1, XP_455078; Kl_HXT14, XP_454897; Kl_HXT2, XP_453960; Kl_HXT3, XP_453088; Sc_HXT4/LGT1, NP_011960; Kl_STL1, XP_456249; Kl_RAG4, XP_455315; Kl_LAC12, XP_452193; Ca_HXT6, XP_719472....”
TC 2.A.1.1.50 / Q94AZ2 The glucose/fructose:H+ symporter, STP13 (sugar transport protein 13). Expressed in vascular tissues and induced during programmed cell death from Arabidopsis thaliana (Mouse-ear cress) (see 6 papers)
STP13 / RF|NP_198006.1 sugar transport protein 13 from Arabidopsis thaliana (see paper)
NP_198006 Major facilitator superfamily protein from Arabidopsis thaliana
AT5G26340 MSS1; carbohydrate transmembrane transporter/ hexose:hydrogen symporter/ high-affinity hydrogen:glucose symporter/ sugar:hydrogen symporter from Arabidopsis thaliana
31% identity, 58% coverage
- substrates: H+, fructose, glucose
tcdb comment: Used to combat bacterial infection by competing with them for sugars by phosphorylation of STP13 by the BAK1 receptor kinase (Yamada et al. 2016) - Transcriptional activation of SUGAR TRANSPORT PROTEIN 13 mediates biotic and abiotic stress signaling.
Lee, Plant signaling & behavior 2021 - GeneRIF: Transcriptional activation of SUGAR TRANSPORT PROTEIN 13 mediates biotic and abiotic stress signaling.
- Regulation of sugar transporter activity for antibacterial defense in Arabidopsis.
Yamada, Science (New York, N.Y.) 2016 (PubMed)- GeneRIF: Stimulation of STP13 activity suppresses bacterial effector delivery, thereby reducing bacterial virulence.
- Expression of Arabidopsis sugar transport protein STP13 differentially affects glucose transport activity and basal resistance to Botrytis cinerea.
Lemonnier, Plant molecular biology 2014 (PubMed)- GeneRIF: This study showed that STP13-deficient plants exhibited an enhanced susceptibility to B. cinerea and a reduced rate of glucose uptake.
- Monosaccharide absorption activity of Arabidopsis roots depends on expression profiles of transporter genes under high salinity conditions.
Yamada, The Journal of biological chemistry 2011 - GeneRIF: The results indicate that STP13 can reabsorb the monosaccharides that are released by damaged cells under high salinity conditions.
- Over-expression of STP13, a hexose transporter, improves plant growth and nitrogen use in Arabidopsis thaliana seedlings.
Schofield, Plant, cell & environment 2009 (PubMed)- GeneRIF: Transgenic seedlings over-expressing STP13 had increased rates of glucose uptake, higher endogenous sucrose levels, accumulated more total C and biomass per plant, and and had higher levels of expression of the nitrate transporter NRT2.2.
- Differential Gene Expression Reveals Candidate Genes for Drought Stress Response in Abies alba (Pinaceae)
Behringer, PloS one 2015 - “...Q0DKW8 O . sativa subsp . japonica 5.63 STP13 - Sugar transport protein 13 - Q94AZ2 A . thaliana 5.52 RHA2A - E3 ubiquitin-protein ligase RHA2A a Q9ZT50 A . thaliana 5.36 GOLS1 - Galactinol synthase 1 - Q947G8 Solanum lycopersicum 4.94 LEA14-A a - LEA...”
- A comprehensive resource of drought- and salinity- responsive ESTs for gene discovery and marker development in chickpea (Cicer arietinum L.)
Varshney, BMC genomics 2009 - “...42 ]. The presence of protective compound such as 'sugar transport protein 13' (UniProt ID: Q94AZ2) during water stress conditions [ 43 ] in this cluster suggests a protective reaction to osmotic stress in sensitive genotypes as compared with tolerant genotypes. Similarly, the occurrence of 'glycine-rich...”
- Phaseolus vulgaris STP13.1 is an H+-coupled monosaccharide transporter, present in source leaves and seed coats, with higher substrate affinity at depolarized potentials
Pegler, Plant direct 2024 - “...as the mean standard error. Figure S1: Amino acid sequence alignment of AtSTP10 (At3g19940), AtSTP13 (At5G26340) BvSTP13 (Bevul.3G139500), MdSTP13a (MD13G1189100), MtSTP13.1 (Medtr5g006070), MtSTP13.2 (Medtr1g104780), PvSTP13.1 (Phvul.002G046800), PvSTP13.2 (Phvul.007G055100) and TaSTP13 (Traes_4DL_CFC191A06). Amino acid residues encased in a red box indicate residues participating in AtSTP10 binding of...”
- Comparison of the Effects of UV-C Light in the Form of Flash or Continuous Exposure: A Transcriptomic Analysis on <i>Arabidopsis thaliana</i> L
Jazayeri, International journal of molecular sciences 2024 - “...SURVIVAL 1 1.55 2.97 10 3 AT5G10380 RING1 RING/U-box superfamily protein 1.28 6.18 10 5 AT5G26340 MSS1 Major facilitator superfamily protein 1.20 4.13 10 3 AT5G50260 CEP1 Cysteine endopeptidase 1 1.99 7.10 10 3 ijms-25-13718-t005_Table 5 Table 5 The DEGs assigned to HSPs, HSFs, and their...”
- Identification and expression profiling of proline metabolizing genes in Arabidopsis thaliana and Oryza sativa to reveal their stress-specific transcript alteration
Arabia, Physiology and molecular biology of plants : an international journal of functional plant biology 2021 - “...F-box family protein (At2g27310), STP13 (At5g26340), alpha/betaHydrolases (At2g39420), kinase (At1g74360), Thioredoxin superfamily protein (At1g28480) Chl...”
- Membrane nanodomains and transport functions in plant
Martinière, Plant physiology 2021 - “...cell cultures Yoshida et al., 2013 Sugar Sugar transporter protein (STP) AT1G11260 (STP1); AT3G19930 (STP4); AT5G26340 (STP13) Whole plant/suspension cell cultures/leaves Minami et al., 2009 ; Keinath et al., 2010 ; Demir et al., 2013 Sugar (continued) Sucrose transporter (SUT) AT1G22710 (SUT1) Leaves Demir et al.,...”
- Leaf nodule endosymbiotic Burkholderia confer targeted allelopathy to their Psychotria hosts
Georgiou, Scientific reports 2021 - “...(AT2G36190), cwinv5 (AT3G13784), cwinv6 (AT5G11920), cinv1-4 (AT1G35580), cinv1-8 ( AT1G35580), cinv2 (AT4G09510), stp1-1 (AT1G11260), stp13-1 (AT5G26340) and the double mutants stp1 stp13 and stp1 stp4 were kindly provided by Diana Santelia (ETH Zurich, Switzerland); prc1 (AT5G64740) , cev1 (AT5G05170) and rsw1 (AT4G32410) were obtained from Clara...”
- Transcriptome analysis of Rafflesia cantleyi flower stages reveals insights into the regulation of senescence
Mohd-Elias, Scientific reports 2021 - “...Target of rapamycin (TOR) AT1G50030 Promote UN013404 ABC transporter AT5G06530 Unclear UN004449 Sugar transporter 14 AT5G26340 Unclear UN026074 Nitrate transporter AT1G32450 Unclear UN015723 Polyamine transporter AT1G31830 Unclear Redox regulation UN004263 Catalase (CAT) AT1G20630 Unclear UN012078 Superoxide dismutase (SOD) AT3G56350 Unclear UN037470 L-Ascorbate oxidase (ASO) AT1G76160 Unclear...”
- Transcriptome analysis of Pará rubber tree (H. brasiliensis) seedlings under ethylene stimulation
Nakano, BMC plant biology 2021 - “...bx012963 AT5G61520 AtSTP3 2.52 1.96 0.72 0 bx006914 AT5G26250 AtSTP8 1.85 0.26 2.76 1 bx027564 AT5G26340 AtSTP13 5.35 5.31 2.58 2 bx055460 AT1G77210 AtSTP14 3.04 3.23 2.81 H+-Symporter family for polyols and monosaccharides (plasma membrane) 0 bx046600 AT2G18480 AtPLT3 6.25 6.26 6.34 Putative monosaccharide transporter family...”
- Dynamic Development of White Lupin Rootlets Along a Cluster Root
Le, Frontiers in plant science 2021 - “...(HKT1) Potassium Profile 5 Lalb_Chr09g0332731 AT4G23700 Cation/H + exchanger 17 (CHX17) Sodium Profile 5 Lalb_Chr05g0210921 AT5G26340 Sugar transport protein 13 (STP13) Sugar Profile 6 Lalb_Chr06g0160591 AT5G26340 Sugar transport protein 13 (STP13) Sugar Profile 5 Lalb_Chr20g0123111 AT1G22150 Sulfate transporter 1;3 (Sultr1;3) Sulfate Profile 4 Lalb_Chr01g0018841 AT2G16850 Plasma...”
- More
7aaqA / Q9LT15 Sugar/h+ symporter stp10 in outward occluded conformation (see paper)
26% identity, 54% coverage
- Ligand: beta-d-glucopyranose (7aaqA)
MST7_ORYSJ / Q94EC3 Sugar transport protein MST7; Monosaccharide transporter 7; OsMST7; Sugar:proton symporter MST7 from Oryza sativa subsp. japonica (Rice) (see paper)
28% identity, 56% coverage
- function: Mediates active uptake of hexoses by sugar:proton symport.
GOX1971 Galactose-proton symporter from Gluconobacter oxydans 621H
31% identity, 57% coverage
METBIDRAFT_79721 general substrate transporter from Metschnikowia bicuspidata var. bicuspidata NRRL YB-4993
30% identity, 52% coverage
- Potential Strategies Applied by <i>Metschnikowia bicuspidata</i> to Survive the Immunity of Its Crustacean Hosts
Zhang, Pathogens (Basel, Switzerland) 2025 - “...acid transportation ( METBIDRAFT_70890 and METBIDRAFT_75879 ), transportation by major facilitator-type transporters ( METBIDRAFT_76181 and METBIDRAFT_79721 ), and others ( Table 1 ). Interestingly, the expression of METBIDRAFT_33390 , whose product is a transcriptional regulator homologous with the one mediating cell adherence in C. albicans ,...”
- “...Multidrug resistance protein 1 METBIDRAFT_76577 2.92 0.000122001 Sugar (and other) transporter High-affinity glucose transporter HXT2 METBIDRAFT_79721 2.80 0.000389761 Sugar (and other) transporter Major facilitator-type transporter ecdD METBIDRAFT_79129 2.78 0.000217936 GPR1/FUN34/yaaH family Accumulation of dyads protein 2 METBIDRAFT_33390 2.73 0.000286938 Zinc finger, C2H2 type Transcriptional regulator of...”
HGT6 potential hexose transporter from Candida albicans (see 2 papers)
27% identity, 52% coverage
- CharProtDB CGD description: Putative glucose transporter of major facilitator superfamily; 20 members of C. albicans glucose transporter family; 12 probable membrane-spanning segments; core stress response, fluconazole-induced; expressed in rich medium with 2% glucose
KLMA_50364 low-affinity glucose transporter from Kluyveromyces marxianus DMKU3-1042
25% identity, 56% coverage
SCLAV_4529 sugar porter family MFS transporter from Streptomyces clavuligerus
28% identity, 52% coverage
Q6CFJ6 YALI0B06391p from Yarrowia lipolytica (strain CLIB 122 / E 150)
28% identity, 52% coverage
XP_043000657 uncharacterized protein from Ustilaginoidea virens
29% identity, 56% coverage
ECDD_ASPRU / K0E3U9 Major facilitator-type transporter ecdD from Aspergillus rugulosus (Emericella rugulosa) (see paper)
29% identity, 57% coverage
CNB05060 hexose transport-related protein from Cryptococcus neoformans var. neoformans JEC21
31% identity, 44% coverage
AL01_03445 sugar porter family MFS transporter from Bombella intestini
30% identity, 57% coverage
CPAR2_212860 uncharacterized protein from Candida parapsilosis
30% identity, 44% coverage
- Eukaryotic transporters for hydroxyderivatives of benzoic acid
Cillingová, Scientific reports 2017 - “...level of expression in the control cells grown in synthetic medium containing glucose (SD) was CPAR2_212860 encoding an MFS protein with predicted sugar transporter domain (PF00083/Sugar_tr). Its ortholog in C. albicans is HGT7 (C2_01000W) and codes for a glucose transporter 40 , 41 . We assumed...”
OGAPODRAFT_15973 uncharacterized protein from Ogataea polymorpha
29% identity, 50% coverage
- Full-Length Genome of an Ogataea polymorpha Strain CBS4732 ura3Δ Reveals Large Duplicated Segments in Subtelomeric Regions
Chang, Frontiers in microbiology 2022 - “...-/OGAPODRAFT_16706/HPODL_00890 DUF1479-domain-containing protein OGAPODRAFT_37951 SV2-NCYC495 -/OGAPODRAFT_37951/HPODL_02394 MFS domain-containing protein OGAPODRAFT_93168 SV3-NCYC495 -/OGAPODRAFT_93168/HPODL_04518 MFS domain-containing protein OGAPODRAFT_15973 * SV3-NCYC495 OGAPO_15973/ * /HPODL_04520 MFS sugar transporter OGAPODRAFT_75778 SV3-NCYC495 -/OGAPODRAFT_75778/HPODL_04517 Adenosine deaminase OGAPODRAFT_75779 SV3-NCYC495 -/OGAPODRAFT_75779/HPODL_04516 Zn(2)-C6 fungal-type domain-containing protein The genomic differences between Ogataea polymorpha HU-11/CBS4732 and NCYC495 include...”
XP_007868407 uncharacterized protein from Gloeophyllum trabeum ATCC 11539
26% identity, 56% coverage
TC 2.A.1.1.111 / P23585 High-affinity glucose transporter HXT2 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (see 6 papers)
NP_013724 hexose transporter HXT2 from Saccharomyces cerevisiae S288C
NP_013724, YMR011W High-affinity glucose transporter of the major facilitator superfamily, expression is induced by low levels of glucose and repressed by high levels of glucose from Saccharomyces cerevisiae
26% identity, 58% coverage
- substrates: glucose
tcdb comment: Asp340 and Asn331 in part determine the high glucose affinity (Kasahara et al. 2007; Kasahara and Kasahara 2010) - Advances in fungal sugar transporters: unlocking the potential of second-generation bioethanol production
Pereira, Applied microbiology and biotechnology 2025 - “...S. cerevisiae Reifenberger et al. ( 1995 ); Apel et al. ( 2016 ) HXT2 P23585 Glucose, xylose, fructose, and mannose S. cerevisiae Reifenberger et al. ( 1995 ); Apel et al. ( 2016 ) HXT3 P32466 Glucose, fructose, and mannose S. cerevisiae Reifenberger et al....”
- Adaptive mutations in sugar metabolism restore growth on glucose in a pyruvate decarboxylase negative yeast strain
Zhang, Microbial cell factories 2015 - “...protein sequence of each of the four S. cereviciae proteins Cit1 (UniProt# P00890), Hxt2 (UniProt# P23585), Rpd3 (UniProt# P32561) and Mth1 (UniProt# P35198) was separately used to query the NCBI database with the basic local alignment search tool (BLAST). To eliminate sequences with low identity to...”
- Rapid response of the yeast plasma membrane proteome to salt stress
Szopinska, Molecular & cellular proteomics : MCP 2011 - “...MT P23291 P38250 P39004 P39003 P38695 P32467 P32466 P23585 P32465 P06775 P53154 P10823 P08539 P38631 Q08193 Q03655 P22146 P38196 P40088 Q12333 P32791 P23900...”
- Optimizing pentose utilization in yeast: the need for novel tools and approaches
Young, Biotechnology for biofuels 2010 - “...H2219 +* Saccharomyces cerevisiae HXT1 P32465 pYX212 [ 66 ] H2219 + Saccharomyces cerevisiae HXT2 P23585 pYX212 [ 66 ] H2219 + Saccharomyces cerevisiae HXT4 P32467 pYX212 [ 66 ] H2219 + Saccharomyces cerevisiae HXT7 P39004 pYX212 [ 66 ] H2219 + Saccharomyces cerevisiae HXT1 P32465...”
- Major facilitator superfamily
Pao, Microbiology and molecular biology reviews : MMBR 1998 - “...602 818 569 S59368 P13181 L21753 P49374 P32465 P23585 P32466 P32467 P38695 P39003 P39004 P40886 P43581 P40885 P39924 P42833 P47185 Z71687 P30605 X98622 P30606...”
- Increased xylose affinity of Hxt2 through gene shuffling of hexose transporters in Saccharomyces cerevisiae.
Nijland, Journal of applied microbiology 2018 (PubMed)- GeneRIF: The increased D-xylose affinity could be related to the C terminus, more specifically to a cysteine to proline mutation at position 505 in Hxt2.
- Low RNA Polymerase III activity results in up regulation of HXT2 glucose transporter independently of glucose signaling and despite changing environment.
Adamczyk, PloS one 2017 - GeneRIF: findings suggest that the general activity of RNAP III can indirectly affect the RNAP II transcriptional machinery on the HXT2 promoter when cellular perception transduced via the major signaling pathways, broadly recognized as on/off switch essential to either positive or negative HXT gene regulation, remain entirely intact
- Snf1p-dependent Spt-Ada-Gcn5-acetyltransferase (SAGA) recruitment and chromatin remodeling activities on the HXT2 and HXT4 promoters.
van, The Journal of biological chemistry 2006 (PubMed)- GeneRIF: Snf1p-dependent Spt-Ada-Gcn5-acetyltransferase (SAGA) recruitment and chromatin remodeling activities on the HXT2 and HXT4 promoters.
- Eight amino acid residues in transmembrane segments of yeast glucose transporter Hxt2 are required for high affinity transport.
Kasahara, The Journal of biological chemistry 2006 (PubMed)- GeneRIF: In addition to leucine 201 (TM5), four residues of Hxt2 (leucine 59 and leucine 61 in TM1, asparagine 331 in TM7, and phenylalanine 366 in TM8) were found to be important for high affinity transport
- The de novo design and synthesis of yeast chromosome XIII facilitates investigations on aging
Zhou, Nature communications 2024 - “...long-lived strains. In addition, an auxotrophic marker URA3, was integrated between two loxPsym sites tagging YMR011W and YMR012W on synXIII (270,117~270,525bp) to ensure a powerful positive selection for SCRaMbLEants from the library. To validate our approach, we developed a SCRaMbLE-mediated screening workflow to pinpoint strains with...”
- “...and simultaneously a URA3 marker was integrated into the middle of two loxPsym sites between YMR011W and YMR012W on synXIII at position (270,117~270,525bp). The colony was cultured in the SCHis medium overnight and then diluted to an A 600 of 0.1 in the 5mL fresh SCHis...”
- Yeast Double Transporter Gene Deletion Library for Identification of Xenobiotic Carriers in Low or High Throughput
Almeida, mBio 2021 - “...YKR103W, YKR106W, YLL028W, YLL043W, YLL048C, YLL052C, YLL061W, YLR081W, YLR092W, YLR130C, YLR138W, YLR237W, YML047C, YML116W, YML123C, YMR011W, YMR177W, YMR243C, YMR279C, YMR319C, YNL065W, YNL142W, YNL268W, YNL270C, YNL275W, YNL291C, YNL318C, YNR002C, YNR055C, YNR056C, YNR072W, YOL020W, YOL103W, YOL122C, YOL158C, YOR011W, YOR071C, YOR153W, YOR192C, YOR202W, YOR273C, YOR306C, YOR328W, YOR348C, YPL036W, YPL058C,...”
- Improved Xylose Metabolism by a CYC8 Mutant of Saccharomyces cerevisiae
Nijland, Applied and environmental microbiology 2017 - “...strains carrying CYC8(Y353) and CYC8(Y353C)a CYC8(Y353) Probe YMR011W YDR343C YDR342C YHR092C YHR096C YHR094C YJL214W YDL245C YJR158W YEL069C YFL011W YJL219W...”
- Extensive Copy Number Variation in Fermentation-Related Genes Among Saccharomyces cerevisiae Wine Strains
Steenwyk, G3 (Bethesda, Md.) 2017 - “...all other 10 members ( GAL2 / YLR081W , HXT1 / YHR094C , HXT2 / YMR011W , HXT4 / YHR092C , HXT5 / YHR096C , HXT8 / YJL214W , HXT10 / YFL011W , HXT16 / YJR158W , RGT2 / YDL138W , and SNF3 / YDL194W )...”
- Acetylated Deoxynivalenol Generates Differences of Gene Expression that Discriminate Trichothecene Toxicity
Suzuki, Toxins 2016 - “...SNF3 plasma membrane Plasma membrane low glucose sensor YHR094C HXT1 plasma membrane Low-affinity glucose transporter YMR011W HXT2 plasma membrane High-affinity glucose transporter YHR092C HXT4 plasma membrane High-affinity glucose transporter The gene expression of RGT1 , RGT2 , and SNF3 , which encode a component of a...”
- Phylogenetic and Transcripts Profiling of Glucose Sensing Related Genes in Candida glabrata
Ng, Jundishapur journal of microbiology 2015 - “...YKL038W CAA81873 1170 128.2 MIG1 YGL035C CAA96736 504 55.6 HXT1 YHR094C DAA06789 570 63.3 HXT2 YMR011W DAA09909 541 59.8 HXT3 YDR345C DAA12185 567 62.6 HXT4 YHR092C DAA06788 576 63.9 HXT5 YHR096C DAA06790 592 66.3 HXT6 YDR343C DAA12184 570 62.7 HXT7 YDR342C DAA12183 570 62.7 HXT8 YJL214W...”
- Low toxicity of deoxynivalenol-3-glucoside in microbial cells
Suzuki, Toxins 2015 - “...cAMP signaling Glucose response YBL043W ECM13 3.39 Non-essential protein of unknown function UVA irradiation response YMR011W HXT2 5.66 High-affinity glucose transporter Induced by low levels of glucose Repressed by high levels of glucose 2.3. Real-Time Polymerase Chain Reaction Analysis DNA microarray produces false-positive data that correspond...”
- The Recent De Novo Origin of Protein C-Termini
Andreatta, Genome biology and evolution 2015 - “...par 353 3 6 Frameshift 2 None Strong Potassium ion transmembrane transporter activity; Pheromone-regulated protein YMR011W HXT2 S. par 542 6 15 Frameshift 2 Strong Strong High-affinity glucose transmembrane transporter activity YMR240C CUS1 S. par 437 28 41 Frameshift 2 Strong Strong Unknown function; required for...”
- More
ITR2_CRYNH / J9VLA6 Myo-inositol transporter 2 from Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) (Filobasidiella neoformans var. grubii) (see 2 papers)
CNAG_00864 MFS transporter, SP family, solute carrier family 2 (myo-inositol transporter), member 13 from Cryptococcus neoformans var. grubii H99
28% identity, 52% coverage
- function: Transporter for myo-inositol.
catalytic activity: myo-inositol(out) + H(+)(out) = myo-inositol(in) + H(+)(in) (RHEA:60364) - The Glycerol Phosphatase Gpp2: A Link to Osmotic Stress, Sulfur Assimilation and Virulence in Cryptococcus neoformans
Martho, Frontiers in microbiology 2019 - “...YEPD for 2 h at 30C. Among the transporters, sulfite (CNAG_00529), pantothenate (CNAG_00540), myo-inositol transporters (CNAG_00864 and CNAG_00867), amino acids permeases (CNAG_00597, 00728 and 01118), ion (CNAG_00979), phospholipid (CNAG_01055), and sugar transporters (CNAG_01683, 03772, 04474, and 06963) are examples of the most induced genes found in...”
- Role of the inositol pyrophosphate multikinase Kcs1 in Cryptococcus inositol metabolism
Liao, Fungal genetics and biology : FG & B 2018 - “...metabolism Locus Gene Ino/Glu Ino+Glu/Glu Inositol uptake CNAG_00097 ITR1 2.28302 1.71354 CNAG_04552 ITR1A 1.98406 2.19533 CNAG_00864 ITR2 1.05826 2.22661 CNAG_05377 ITR3 1.55892 1.44987 CNAG_00867 ITR3A 3.68902 1.60298 CNAG_05667 ITR3B 3.80998 1.60194 CNAG_05381 ITR3C 30.5358 25.8554 CNAG_05662 ITR4 12.4597 13.8718 CNAG_04024 ITR5 1.07981 1.62615 CNAG_03910 ITR6 1.07981...”
- Galectin-3 impacts Cryptococcus neoformans infection through direct antifungal effects
Almeida, Nature communications 2017 - “...Cytoplasmic protein XM_012194439.1 3.48 0.0000 12.4 140.0 CNAG_02165 Cytoplasmic protein XM_012193764.1 3.45 0.0000 2.7 30.0 CNAG_00864 MFS transporter, SP family, solute carrier family 2 (myo-inositol transporter), member 13 XM_012194787.1 3.44 0.0000 0.1 1.4 CNAG_02489 Alcohol dehydrogenase, propanol-preferring XM_012194657.1 3.20 0.0000 6.1 56.7 CNAG_02269 Autophagy-like protein 18...”
- Brain inositol is a novel stimulator for promoting Cryptococcus penetration of the blood-brain barrier
Liu, PLoS pathogens 2013 - “...Itr2a 1.26 CNB05060 CNAG_04024 Itr5 1.08 CNH00990 CNAG_05381 Itr3c 1.23 CNH02990 CNAG_05662 Itr4 0.95 CND00020 CNAG_00864 Itr2 0.83 Proteins with unknown function CNL03670 CNAG_05261 Cryptococcus specific protein, unknown (Isp1) 2.42 CNJ03330 CNAG_07840 Cryptococcus specific protein, unknown (Isp2) 2.42 CNK02130 CNAG_01873 Fungal specific protein, unknown 2.27 CNJ03390...”
- Role of an expanded inositol transporter repertoire in Cryptococcus neoformans sexual reproduction and virulence
Xue, mBio 2010 - “...tag Chromosome H99 ITR1 -H CNAG_00097 1 H99 ITR1A -H CNAG_04552 10 H99 ITR2 -H CNAG_00864 5 H99 ITR3 -H CNAG_05377 14 H99 ITR3A -H CNAG_00867 5 H99 ITR3B -H CNAG_05667 14 H99 ITR3C -H CNAG_05381 14 H99 ITR4 -H CNAG_05662 14 H99 ITR5 -H CNAG_04024...”
E6RCH7 High-affinity glucose transporter of the major facilitator superfamily, putative Hxt4p from Cryptococcus gattii serotype B (strain WM276 / ATCC MYA-4071)
29% identity, 55% coverage
- Phenotypic characteristics and transcriptome profile of Cryptococcus gattii biofilm
Tavares, Scientific reports 2019 - “...process Ergosterol biosynthetic process CGB_J0030W 4,798 ADV24539 High-affinity glucose transporter of the major facilitator superfamily E6RCH7 High-affinity glucose transporter of the major facilitator superfamily Transmembrane transport CGB_F0090C 14,363 ADV22816 Monocarboxylic acid transporter E6R7J0 Monocarboxylic acid transporter Transmembrane transport Ion transmembrane transport CGB_M2010W 9,461 ADV25506 dUTP diphosphatase...”
P58352 Solute carrier family 2, facilitated glucose transporter member 3 from Bos taurus
26% identity, 57% coverage
METBIDRAFT_76577 general substrate transporter from Metschnikowia bicuspidata var. bicuspidata NRRL YB-4993
28% identity, 48% coverage
- Potential Strategies Applied by <i>Metschnikowia bicuspidata</i> to Survive the Immunity of Its Crustacean Hosts
Zhang, Pathogens (Basel, Switzerland) 2025 - “...( METBIDRAFT_37387 ), sugar (and other) transportation ( METBIDRAFT_227659 , METBIDRAFT_33398 , METBIDRAFT_12194 , and METBIDRAFT_76577 ), peroxisomal activity ( METBIDRAFT_29250 ), mitochondrial function ( METBIDRAFT_46728 , METBIDRAFT_76426 , and METBIDRAFT_37464 ), amino acid transportation ( METBIDRAFT_70890 and METBIDRAFT_75879 ), transportation by major facilitator-type transporters (...”
- “...50 ], our other findings about the elevated expression of glucose-transportation genes ( METBIDRAFT_33398 and METBIDRAFT_76577 ; Table 1 ) and a glucose-kinase gene ( METBIDRAFT_36346 ; Table S5 ) are reasonable due to the possibly activated HIF-1 via accumulated fumarate. However, it seemed that only...”
LOC102178379 solute carrier family 2, facilitated glucose transporter member 5 from Capra hircus
33% identity, 47% coverage
- Transcriptome analysis reveals liver metabolism programming in kids from nutritional restricted goats during mid-gestation
Yang, PeerJ 2021 - “..., COL16A1 , HRCT1 , LOC108636568 , RUNDC3A , LOC102173859 , LBR , LIPN , LOC102178379 , LRP2 , RUNDC3A , SNAP25 and ACSL4 ) mainly enriched in protein digestion and absorption, bile secretion, steroid biosynthesis, carbohydrate digestion and absorption, thyroid hormone synthesis, ABC transporters, insulin...”
LOC4352335 polyol transporter 5 from Oryza sativa Japonica Group
28% identity, 54% coverage
ITR1_CRYNH / J9VHZ4 Myo-inositol transporter 1 from Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) (Filobasidiella neoformans var. grubii) (see 2 papers)
CNAG_00097 MFS transporter, SP family, solute carrier family 2 (myo-inositol transporter), member 13 from Cryptococcus neoformans var. grubii H99
29% identity, 52% coverage
- function: May function as a transporter or as a sensor for myo- inositol.
catalytic activity: myo-inositol(out) + H(+)(out) = myo-inositol(in) + H(+)(in) (RHEA:60364)
disruption phenotype: Increases RNA level of ITR3, ITR3B, and ITR3C (PubMed:20689743). Reduces mating hyphae production; conjugation appears normal (PubMed:20689743). Simultaneous disruption of INO1 leads to an exacerbated mating and sporulation defect, and attenuates virulence in a murine inhalation model of systemic infection (PubMed:20689743). - Role of the inositol pyrophosphate multikinase Kcs1 in Cryptococcus inositol metabolism
Liao, Fungal genetics and biology : FG & B 2018 - “...1 Expression profile of genes involved in inositol metabolism Locus Gene Ino/Glu Ino+Glu/Glu Inositol uptake CNAG_00097 ITR1 2.28302 1.71354 CNAG_04552 ITR1A 1.98406 2.19533 CNAG_00864 ITR2 1.05826 2.22661 CNAG_05377 ITR3 1.55892 1.44987 CNAG_00867 ITR3A 3.68902 1.60298 CNAG_05667 ITR3B 3.80998 1.60194 CNAG_05381 ITR3C 30.5358 25.8554 CNAG_05662 ITR4 12.4597...”
- Brain inositol is a novel stimulator for promoting Cryptococcus penetration of the blood-brain barrier
Liu, PLoS pathogens 2013 - “...CNAG_06642 Phosphatidylinositol 3-kinase 2.22 CNM02200 CNAG_06220 Allergen 2.24 Inositol transporters CND00070 CNAG_00867 Itr3a 1.99 CNA00880 CNAG_00097 Itr1 1.66 CNH03060 CNAG_05667 Itr3b1 1.44 CNG02980 CNAG_03357 Itr2a 1.26 CNB05060 CNAG_04024 Itr5 1.08 CNH00990 CNAG_05381 Itr3c 1.23 CNH02990 CNAG_05662 Itr4 0.95 CND00020 CNAG_00864 Itr2 0.83 Proteins with unknown function...”
- Role of an expanded inositol transporter repertoire in Cryptococcus neoformans sexual reproduction and virulence
Xue, mBio 2010 - “...myo -inositol transporters in Cryptococcus species Strain Gene name Locus tag Chromosome H99 ITR1 -H CNAG_00097 1 H99 ITR1A -H CNAG_04552 10 H99 ITR2 -H CNAG_00864 5 H99 ITR3 -H CNAG_05377 14 H99 ITR3A -H CNAG_00867 5 H99 ITR3B -H CNAG_05667 14 H99 ITR3C -H CNAG_05381...”
AO090003000782 No description from Aspergillus oryzae RIB40
28% identity, 56% coverage
TC 2.A.1.1.79 / Q1XF07 Polyol (xylitol):H+ symporter, PLT4 from Lotus japonicus
27% identity, 56% coverage
TC 2.A.1.1.33 / Q8NJ22 Fructose:H+ symporter, Frt1 from Kluyveromyces lactis (Yeast) (see 2 papers)
XP_454356 hypothetical protein from Kluyveromyces lactis NRRL Y-1140
29% identity, 51% coverage
- substrates: H+, fructose
- Genetic basis of the highly efficient yeast Kluyveromyces marxianus: complete genome sequence and transcriptome analyses
Lertwattanasakul, Biotechnology for biofuels 2015 - “...Ps_XUT6, XP_001386589; Ps_XUT7, XP_001387067; Ps_RGT2, XP_001386588; Ps_SLT1, XP_001383774; Kl_KHT1/RAG1, XP_453656; Kl_KHT2, GN107317; Kl_KHT3, XP_454897; Kl_FRT1, XP_454356; Kl_HGT1, XP_451484; Kl_HXT1, XP_455078; Kl_HXT14, XP_454897; Kl_HXT2, XP_453960; Kl_HXT3, XP_453088; Sc_HXT4/LGT1, NP_011960; Kl_STL1, XP_456249; Kl_RAG4, XP_455315; Kl_LAC12, XP_452193; Ca_HXT6, XP_719472. Genes for the initial catabolism of xylose, PPP, the conversion...”
XP_002489348 Putative transporter, member of the sugar porter family from Komagataella phaffii GS115
27% identity, 57% coverage
PDIP_03090 MFS monosaccharide transporter, putative from Penicillium digitatum
28% identity, 57% coverage
An16g01600 uncharacterized protein from Aspergillus niger
30% identity, 52% coverage
CND00020 myo-inositol transporter from Cryptococcus neoformans var. neoformans JEC21
27% identity, 52% coverage
An11g01100 uncharacterized protein from Aspergillus niger
29% identity, 52% coverage
AFUA_4G14670 MFS quinate transporter, putative from Aspergillus fumigatus Af293
27% identity, 62% coverage
FTN_0687 galactose-proton symporter, major facilitator superfamily (MFS) transport protein from Francisella tularensis subsp. novicida U112
26% identity, 54% coverage
- Structural and functional analysis of the Francisella lysine decarboxylase as a key actor in oxidative stress resistance
Felix, Scientific reports 2021 - “...A 0.926959218 6.24086E07 FTN_1697 Galactose mutarotase 0.901042767 0.008192095 FTN_1148 Glycoprotease family protein 0.816650922 0.005012835 galP1 FTN_0687 Major facilitator superfamily galactose-proton symporter 0.746905316 5.94864E05 FTN_1459 Short chain dehydrogenase 0.723695755 0.001285646 FTN_1254 Hypothetical protein 0.716291799 0.00237079 FTN_1266 ABC transporter membrane protein 0.66256701 0.001562237 FTN_0923 Hypothetical protein 0.654493997 0.002785307...”
- Molecular complexity orchestrates modulation of phagosome biogenesis and escape to the cytosol of macrophages by Francisella tularensis
Asare, Environmental microbiology 2010 - “...tnfn1_pw060323p06q164 FTN_0624 serine permease 2 2 * tnfn1_pw060418p01q161 FTN_0636 glpT glycerol-3-phosphate transporter 7 7 tnfn1_pw060419p04q142 FTN_0687 galP1 galactose-proton symporter, major facilitator superfamily (MFS) transport protein 2 3 * tnfn1_pw060510p04q158 FTN_0687 galP1 galactose-proton symporter, major facilitator superfamily (MFS) transport protein 2 2 * tnfn1_pw060328p06q132 FTN_0728 predicted Co/Zn/Cd...”
- Exploitation of host cell biology and evasion of immunity by francisella tularensis
Asare, Frontiers in microbiology 2010 - “...nicotinamide ribonucleoside (NR) uptake permease (PnuC) family protein FTN_0624 Serine permease FTN_0636 glpT Glycerol-3-phosphate transporter FTN_0687 galP1 Galactose-proton symporter, major facilitator superfamily (MFS) transport protein FTN_0728 Predicted Co/Zn/Cd cation transporter FTN_0739 potG ATP-binding cassette putrescine uptake system, ATP-binding protein FTN_0799 emrE Putative membrane transporter of cations...”
- Molecular bases of proliferation of Francisella tularensis in arthropod vectors
Asare, Environmental microbiology 2010 - “...tnfn1_pw060323p06q164 FTN_0624 serine permease 2 2 * tnfn1_pw060418p01q161 FTN_0636 glpT glycerol-3-phosphate transporter 7 7 tnfn1_pw060419p04q142 FTN_0687 galP1 galactose-proton symporter, major facilitator superfamily (MFS) transport protein 2 3 * tnfn1_pw060510p04q158 FTN_0687 galP1 galactose-proton symporter, major facilitator superfamily (MFS) transport protein 2 2 * tnfn1_pw060328p06q132 FTN_0728 predicted Co/Zn/Cd...”
An11g09600 uncharacterized protein from Aspergillus niger
26% identity, 56% coverage
- Probing Carbon Utilization of Cordyceps militaris by Sugar Transportome and Protein Structural Analysis
Sirithep, Cells 2020 - “...of a particular carbon source (i.e., xylose). In A. niger , two pentose transporters, i.e., An11g09600 and An03g01620, were highly expressed in the xylose and arabinose cultures, which were explained by the control of specific transcription factor (TF) as demonstrated by using a set of TF...”
- In Silico Analysis of Putative Sugar Transporter Genes in Aspergillus niger Using Phylogeny and Comparative Transcriptomics
Peng, Frontiers in microbiology 2018 - “...and maltose medium, respectively ( de Vries et al., 2017 ). Two putative pentose transporters, An11g09600 and An03g01620, were highly expressed on D -xylose and L -arabinose. Furthermore, two transporters encoding gene specifically induced by L -rhamnose (An07g00230 and An01g14620) and one induced by a D...”
CNBG_5450 sugar transporter from Cryptococcus deuterogattii R265
31% identity, 44% coverage
GTR3_MOUSE / P32037 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Mus musculus (Mouse) (see 3 papers)
NP_035531 solute carrier family 2, facilitated glucose transporter member 3 isoform b from Mus musculus
29% identity, 51% coverage
- function: Facilitative glucose transporter (PubMed:35810171). Can also mediate the uptake of various other monosaccharides across the cell membrane (By similarity). Mediates the uptake of glucose, 2- deoxyglucose, galactose, mannose, xylose and fucose, and probably also dehydroascorbate (By similarity). Does not mediate fructose transport (By similarity). Required for mesendoderm differentiation (PubMed:35810171).
catalytic activity: D-glucose(out) = D-glucose(in) (RHEA:60376)
catalytic activity: D-galactose(in) = D-galactose(out) (RHEA:34915)
subunit: Interacts with SMIM43; the interaction may promote SLC2A3- mediated glucose transport to meet the energy needs of mesendoderm differentiation. - LPCAT1 Facilitates Keratinocyte Hyperproliferation and Skin Inflammation in Psoriasis by Regulating GLUT3.
Huang, The Journal of investigative dermatology 2024 (PubMed)- GeneRIF: LPCAT1 Facilitates Keratinocyte Hyperproliferation and Skin Inflammation in Psoriasis by Regulating GLUT3.
- GLUT3 promotes macrophage signaling and function via RAS-mediated endocytosis in atopic dermatitis and wound healing.
Yu, The Journal of clinical investigation 2023 - GeneRIF: GLUT3 promotes macrophage signaling and function via RAS-mediated endocytosis in atopic dermatitis and wound healing.
- Recurrent moderate hypoglycemia accelerates the progression of Alzheimer's disease through impairment of the TRPC6/GLUT3 pathway.
He, JCI insight 2022 - GeneRIF: Recurrent moderate hypoglycemia accelerates the progression of Alzheimer's disease through impairment of the TRPC6/GLUT3 pathway.
- The glucose transporter GLUT3 controls T helper 17 cell responses through glycolytic-epigenetic reprogramming.
Hochrein, Cell metabolism 2022 - GeneRIF: The glucose transporter GLUT3 controls T helper 17 cell responses through glycolytic-epigenetic reprogramming.
- CD205+ polymorphonuclear myeloid-derived suppressor cells suppress antitumor immunity by overexpressing GLUT3.
Fu, Cancer science 2021 - GeneRIF: CD205(+) polymorphonuclear myeloid-derived suppressor cells suppress antitumor immunity by overexpressing GLUT3.
- Adult glut3 homozygous null mice survive to demonstrate neural excitability and altered neurobehavioral responses reminiscent of neurodevelopmental disorders.
Shin, Experimental neurology 2021 - GeneRIF: Adult glut3 homozygous null mice survive to demonstrate neural excitability and altered neurobehavioral responses reminiscent of neurodevelopmental disorders.
- High NOV/CCN3 expression during high-fat diet pregnancy in mice affects GLUT3 expression and the mTOR pathway.
Wang, American journal of physiology. Endocrinology and metabolism 2021 (PubMed)- GeneRIF: High NOV/CCN3 expression during high-fat diet pregnancy in mice affects GLUT3 expression and the mTOR pathway.
- Developing Brain Glucose Transporters, Serotonin, Serotonin Transporter, and Oxytocin Receptor Expression in Response to Early-Life Hypocaloric and Hypercaloric Dietary, and Air Pollutant Exposures.
Ye, Developmental neuroscience 2021 - GeneRIF: Developing Brain Glucose Transporters, Serotonin, Serotonin Transporter, and Oxytocin Receptor Expression in Response to Early-Life Hypocaloric and Hypercaloric Dietary, and Air Pollutant Exposures.
- More
- Proteomic analysis reveals activation of platelet- and fibrosis-related pathways in hearts of ApoE-/- mice exposed to diesel exhaust particles.
Jung, Scientific reports 2023 - “...TGFB1 Transforming growth factor beta-1 proprotein 1.88 0.034 O08742 GP5 Platelet glycoprotein V 1.87 0.035 P32037 SLC2A3 Solute carrier family 2, facilitated glucose transporter member 3 1.77 0.008 Q07235 SERPINE2 Glia-derived nexin 1.75 0.018 P12399 CTLA2A Protein CTLA-2-alpha 1.75 0.018 Q8BTM8 FLNA Filamin-A 1.67 0.030 P41317...”
- Unraveling the Proteomic Landscape of Intestinal Epithelial Cell-Derived Exosomes in Mice.
Ding, Frontiers in physiology 2022 - “...0.735 0.083 Not 12 Q5DTL9 Slc4a10 Sodium-driven chloride bicarbonate exchanger 39.14 0.734 0.025 Down 13 P32037 Slc2a3 Solute carrier family 2, facilitated glucose transporter member 3 25.83 0.734 0.227 Not 14 Q8VEM8 Slc25a3 Phosphate carrier protein, mitochondrial 250.32 0.732 0.000 Down 15 Q9Z2J0 Slc23a1 Solute carrier...”
- miR-29a/b1 Regulates the Luteinizing Hormone Secretion and Affects Mouse Ovulation
Guo, Frontiers in endocrinology 2021 - “...P01216 Cga Glycoprotein hormones alpha chain OS=Mus musculus GN=Cga PE=2 SV=1 14 kDa 0.00035 1.35 P32037 Slc2a3 Solute carrier family 2, facilitated glucose transporter member 3 OS=Mus musculus GN=Slc2a3 PE=1 SV=1 53 kDa < 0.0001 1.35 Q8VCT4 Ces1d Carboxylesterase 1D OS=Mus musculus GN=Ces1d PE=1 SV=1 62...”
- Proteomics Landscape of Host-Pathogen Interaction in Acinetobacter baumannii Infected Mouse Lung
Li, Frontiers in genetics 2021 - “...P27870 Vav1 Vav 1 oncogene 1.22 1.66 P50404 Sftpd Surfactant associated protein D 1.35 1.56 P32037 Slc2a3 Solute carrier family 2 (facilitated glucose transporter), member 3 1.36 1.53 Q8BND5 Qsox1 Quiescin Q6 sulfhydryl oxidase 1 1.29 1.42 Q3U2S8 Hvcn1 Hydrogen voltage-gated channel 1 1.60 1.35 P28033...”
- The Impacts of Surgery and Intracerebral Electrodes in C57BL/6J Mouse Kainate Model of Epileptogenesis: Seizure Threshold, Proteomics, and Cytokine Profiles
Tse, Frontiers in neurology 2021 - “...3.6494 0.00901 17.52368 19.70244 18.78533 19.755233 Proteins downregulated in both surgery groups (vehicle and KA) P32037 Solute carrier family 2-(Glucose transporter type 3, brain) (GLUT-3) Slc2a3 Glut3 24.736 0.00002 4.6986 0.00191 22.52552 22.390868 22.63737 22.245415 Q62283 Tetraspanin-7 (Tspan-7/CD antigen CD231) Tspan7 Mxs1 21.247 4.31E-05 4.3654 0.00347...”
- Environmental Enrichment Upregulates Striatal Synaptic Vesicle-Associated Proteins and Improves Motor Function
Song, Frontiers in neurology 2018 - “...carboxyl-terminal hydrolase USP9X 1.51 O70161-3 Isoform 3 of Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma PIP5K1C 1.51 P32037 Solute carrier family 2, facilitated glucose transporter member 3 SLC2A3 1.51 Q91ZA3 Propionyl-CoA carboxylase alpha chain, mitochondrial PCCA 1.51 E9Q035 Protein Gm20425 GM20425 1.51 Q7TMY8-4 Isoform 4 of E3 ubiquitin-protein...”
- Major facilitator superfamily
Pao, Microbiology and molecular biology reviews : MMBR 1998 - “...P20303 S37476 P11168 P14246 P12336 P47842 P28568 P11169 P32037 P47843 Q07647 P14672 P14142 P19357 P22732 P46408 P43427 Q00712 B30310 U39197 U29377 U43375 U52842...”
Q6BW54 DEHA2B14278p from Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
28% identity, 46% coverage
XP_445530 hypothetical protein from Candida glabrata CBS 138
26% identity, 61% coverage
- Phylogenetic and Transcripts Profiling of Glucose Sensing Related Genes in Candida glabrata
Ng, Jundishapur journal of microbiology 2015 - “...XP_444861 549 61.2 HXT6/7 CAGL0A02211 XP_444860 552 61.5 HXT6/7 CAGL0A00737 XP_444803 549 61.6 HXT2/10 CAGL0D02662 XP_445530 564 62.4 HXT2/10 CAGL0D02640 XP_445530 564 62.4 HXT2/10 CAGL0I00286 XP_447265 555 61.7 HXT14 CAGL0M04103 XP_449525 531 59.0 Table 2. Details of Glucose Sensing-Related Genes of Saccharomyces cerevisiae Target Gene Name...”
NP_001268207 hexose transporter from Vitis vinifera
Q3L7K6 Hexose transporter from Vitis vinifera
27% identity, 56% coverage
- Involvement of abscisic acid in the coordinated regulation of a stress-inducible hexose transporter (VvHT5) and a cell wall invertase in grapevine in response to biotrophic fungal infection.
Hayes, Plant physiology 2010 - GeneRIF: central role for abscisic acid in the regulation of VvcwINV and VvHT5 expression during the transition from source to sink in response to infection by biotrophic pathogens
- cDNA-AFLP analysis of plant and pathogen genes expressed in grapevine infected with Plasmopara viticola
Polesani, BMC genomics 2008 - “...1393 CG TT TC58567 103 - Apocytochrome f precursor (Q68RZ3) 4.92E-10 Transport 1614 TT CA Q3L7K6 185 + Hexose transporter 6.26E-08 * 680 CA GT TC52346 231 - Transporter-like protein (Q9LSH7) 3.88E-47 249 TA AC TC66367 107 - 14-3-3 protein (Q93XW1) 1.13E-16 1534 CC GG TC57372...”
- “...pathogens. In this context, the increased level of two genes with similarity to hexose transporters (Q3L7K6 and TC66367) is also worth noting. Carbohydrate accumulation may inhibit the Calvin cycle, which also limits photosynthesis [ 46 , 47 ]. Several genes encoding enzymes in the Calvin cycle...”
- Molecular analysis of post-harvest withering in grape by AFLP transcriptional profiling
Zamboni, Journal of experimental botany 2008 - “...CB006657 4.90E-08 Chloroplast outer membrane protein Q56WJ7 3.00E-10 Copper-transporting P-type ATPase TC64839 4.10E-11 Hexose transporter Q3L7K6 9.00E-12 Major facilitator superfamily MFS 1 TC61509 8.98E-27 Secretion protein HlyD TC60298 9.43E-39 Secretory carrier-associated membrane protein 1 TC52744 5.01E-05 Sucrose transporter-like protein TC51830 3.18E-22 Metabolic process Dopamine -mono-oxygenase N-terminal...”
- “...et al. , 2007 ). Carbohydrate transport and metabolism Our AFLP-TP experiment showed that VvHT5 (Q3L7K6), which encodes a hexose transporter (HT) located in the plasma membrane ( Hayes et al. , 2007 ), is up-regulated late in the withering process ( Table 3 ). This...”
STP6_ARATH / Q9SFG0 Sugar transport protein 6; Hexose transporter 6 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
TC 2.A.1.1.56 / Q9SFG0 High affinity monosaccharide (KM ≈ 20 µM):H+ symporter, Stp6 (takes up glucose, 3-O-methylglucose, mannose, fructose, galactose and to a lesser extent, xylose and ribulose. from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
STP6 / RF|NP_187247.1 sugar transport protein 6 from Arabidopsis thaliana (see paper)
AT3G05960 STP6 (SUGAR TRANSPORTER 6); carbohydrate transmembrane transporter/ monosaccharide transmembrane transporter/ sugar:hydrogen symporter from Arabidopsis thaliana
28% identity, 56% coverage
- function: Mediates an active uptake of hexoses, probably by sugar/hydrogen symport. Can transport glucose, 3-O-methylglucose, mannose, fructose and galactose, and, to a lower extent, xylose and ribulose.
- substrates: 3-O-methylglucose, Galactose, Mannose, Ribulose, Sugars, Xylose, fructose, glucose
- Basis of Glucose and Fructose Selectivity in Sugar Transport Proteins
Andersen, 2024 - Local Duplication of TIR-NBS-LRR Gene Marks Clubroot Resistance in Brassica napus cv. Tosca
Kopec, Frontiers in plant science 2021 - “...germin-like protein (BnaA03g29240D ortholog of AtGLP8, AT3G05930), up-regulated Sugar Transporter Protein (BnaA03g29310D ortholog of AtSTP6, AT3G05960), down-regulated Fantastic Four protein (BnaA03g57340D ortholog of AtFAF4, AT3G06020), up-regulated protein trichome birefringence-like (BnaA03g57390D ortholog of AtTBL10, AT3G06080). None of them, however, were differentially expressed in the resistant line. Moreover,...”
- Plant glucose transporter structure and function
Geiger, Pflugers Archiv : European journal of physiology 2020 - “...122 , 160 ] AtSTP5 At1g34580 Silique and whole seedling Plasma membrane Non functional? AtSTP6 At3g05960 Fully developed pollen grain Plasma membrane Glucose, galactose, mannose, fructose, arabinose High [ 122 , 134 ] AtSTP7 At4g02050 Multiple tissues with high cell wall turnover except pollen Plasma membrane...”
- Genome-Wide Identification and Expression Profiling of Sugar Transporter Protein (STP) Family Genes in Cabbage (Brassica oleracea var. capitata L.) Reveals their Involvement in Clubroot Disease Responses
Zhang, Genes 2019 - “...Bol041122 C05 LF 1500 499 55.42 9.29 33.25 105.51 0.52 cell membrane tPCK2 F AtSTP6 AT3G05960 1524 507 BoSTP6a Bol002474 Scaffold000387 MF1 1524 507 55.86 8.76 31.67 109.98 0.65 cell membrane BoSTP6b Bol002866 Scaffold000372 LF 1515 504 55.59 8.29 31.06 109.50 0.65 cell membrane BoSTP6c Bol034076...”
- The Vitis vinifera sugar transporter gene family: phylogenetic overview and macroarray expression profiling
Afoufa-Bastien, BMC plant biology 2010 - “...for Arabidopsis thaliana transporters are: At1g11260 (AtSPT1), At1g07340 (AtSTP2), At5g61520 (AtSTP3), At3g19930 (AtSTP4), At1g34580 (AtSTP5), At3g05960 (AtSTP6), At4g02050 (AtSTP7), At5g26250 (AtSTP8), At1g50310 (AtSTP9), At3g19940 (AtSTP10), At5g23270 (AtSTP11), At4g21480 (AtSTP12), At5g26340 (AtSTP13), At1g77210 (AtSTP14); for Vitis ones see Additional file 1 . Vitis vinifera putative Tonoplast Monosaccharide...”
- Pollen development and fertilization in Arabidopsis is dependent on the MALE GAMETOGENESIS IMPAIRED ANTHERS gene encoding a type V P-type ATPase
Jakobsen, Genes & development 2005 - “...6.6 10.7 8.8 36.9 At5g40260 At5g09500 At3g05960 At2g32890 At1g23730 At4g10440 At3g12580 At4g16370 At5g52640 At1g07340 At4g23680 At1g50310 At5g03250 At3g19930...”
- AtSTP6, a new pollen-specific H+-monosaccharide symporter from Arabidopsis
Scholz-Starke, Plant physiology 2003 (PubMed)- “...the Arabidopsis H/monosaccharide transporter family. The AtSTP6 gene (At3g05960) is interrupted by two introns and encodes a protein of 507 amino acids...”
- “...sequence (Munich Information Center for Protein Sequences no. At3g05960) is interrupted by two introns. The open reading frame in the AtSTP6 cDNA clone is...”
AT1G67300 hexose transporter, putative from Arabidopsis thaliana
28% identity, 72% coverage
- Evidence for dual targeting control of Arabidopsis 6-phosphogluconate dehydrogenase isoforms by N-terminal phosphorylation
Doering, Journal of experimental botany 2024 - “...phosphomimicry of a serine residue (conserved among 14-3-3 family members) promoted dimerization of Arabidopsis GRF2/GF14-omega (At1g67300) in the context -ApSWRIL- ( Gkirmak et al. , 2015 ), having potential for co-regulation. Under normal growth conditions, the crucial N-terminal S/T residues of the PGD isoforms are probably...”
- Quinoa: A Promising Crop for Resolving the Bottleneck of Cultivation in Soils Affected by Multiple Environmental Abiotic Stresses
Dehghanian, Plants (Basel, Switzerland) 2024 - “...Transmembrane domains genes: WAKL8 Wall-associated receptor kinase-like 8 (AUR62006689) (AUR62029668) At1g21890 WAT1-related protein At1g21890 (AUR62039756) At1g67300 Probable plastidic glucose transporter 2 (AUR62021463) CYP75B1 Flavonoid 3- monooxygenase (AUR62007451) psbD Photosystem II D2 protein (AUR62039871) CER1: Protein ECERIFERUM (AUR62043781) (AUR62043583) AAP6 Amino acid permease 6 (AUR62034957) SULTR1;1 Sulfate...”
- Identification of Putative Transmembrane Proteins Involved in Salinity Tolerance in Chenopodium quinoa by Integrating Physiological Data, RNAseq, and SNP Analyses
Schmöckel, Frontiers in plant science 2017 - “...Loss in 4 comparisons (Cherry Vanilla vs. Regalona, Ollague, Real and Chucapaca) 2.31 9 AUR62021463 At1g67300 Probable plastidic glucose transporter 2 Gain in 6 comparisons (Kurmi, G-205 and Cherry Vanilla vs. Regalona and Chucapaca), loss in 2 comparisons (Ames 22157 vs. Ollague and Real) 1.04 10...”
- Identification of conserved drought-adaptive genes using a cross-species meta-analysis approach
Shaar-Moshe, BMC plant biology 2015 - “...TIP/NIP loc_os03g05290 (AT2G36830, TIP1;1), loc_os06g22960 (AT3G16240, TIP2;1), loc_os10g36924 (AT4G10380, NIP5;1), loc_os06g12310 (AT5G37820, NIP4;2) Sugars loc_os02g17500 (AT1G67300, hexose transporter) loc_os07g39350, loc_os03g10090 (AT3G18830, ATPLT5), loc_os07g01560 (AT1G11260, STP1) Amino acids loc_os02g54730 (AT2G41190, amino acid transporter family protein) loc_os07g04180 (AT5G49630, AAP6) Nitrate loc_os04g40410 (AT5G50200, NRT3.1) Peptides and misc. loc_os05g32630 (AT3G05290,...”
- Phylloxera (Daktulosphaira vitifoliae Fitch) alters the carbohydrate metabolism in root galls to allowing the compatible interaction with grapevine (Vitis ssp.) roots
Griesser, Plant science : an international journal of experimental plant biology 2015 - “...q value c L2 (1dai) L2 (3dai) L2 (7dai) TC130780 GSVIVT01015361001 Plastidial glucose transporter VvGlcT2 (at1g67300) 0.17 0.0425 0.9 1.0 1.1 TC134625 f GSVIVT01003181001 Hexose transporter VvHT8 (at1g11260) 1.36 7.56E06 0.6 0.7 * 0.4 ** TC104920 GSVIVT01017937001 Hexose transporter VvHT5 (at5g26340) n.s. n.s. 0.8 0.9 2.0...”
- Reduced expression of a gene encoding a Golgi localized monosaccharide transporter (OsGMST1) confers hypersensitivity to salt in rice (Oryza sativa)
Cao, Journal of experimental botany 2011 - “...protein sequence is compared with OsMST1-8, Os09g23110, OspGlcT, and OsTMT1-4 from Oryza sativa , AtSGB1, At1g67300, At1g05030, and AtpGlcT from Arabidopsis thaliana , ScRGT2 from Saccharomyces cerevisiae , HsSLC2A3 from Homo sapiens , NtpGlcT from Nicotiana tabacum, and ZmpGlcT from Zea mays . (C) OsGMST1 is...”
- “...( Fig. 1B ) shows that the putative Arabidopsis paralogues to OsGMST1 are encoded by At1g67300 , SGB1 , At1g05030 , and AtpGlcT and the proteins have 67%, 65%, 44%, and 43% identity to OsGMST1, respectively. These four MST proteins are in the pGlcT subfamily (...”
- The Vitis vinifera sugar transporter gene family: phylogenetic overview and macroarray expression profiling
Afoufa-Bastien, BMC plant biology 2010 - “...In a similar way, the fact that Vv16716001 and Vv34389001 form a second group with At1g67300 and SGB1 indicates that these two Vitis putative transporters could be localized in Golgi apparatus. Finally Vv25939001 forms a third group with At1g05030. Search for cis -elements putatively involved in...”
CNBG_6144 sugar transporter from Cryptococcus deuterogattii R265
29% identity, 54% coverage
SS1G_07132 hypothetical protein from Sclerotinia sclerotiorum 1980 UF-70
27% identity, 57% coverage
HXT3_YEAST / P32466 Low-affinity glucose transporter HXT3 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
NP_010632 hexose transporter HXT3 from Saccharomyces cerevisiae S288C
NP_010632, YDR345C Hxt3p from Saccharomyces cerevisiae
26% identity, 64% coverage
- function: Low-affinity glucose transporter
- Regulation of Hxt3 and Hxt7 turnover converges on the Vid30 complex and requires inactivation of the Ras/cAMP/PKA pathway in Saccharomyces cerevisiae.
Snowdon, PloS one 2012 - GeneRIF: turnover of both Hxt3 and Hxt7 is dependent on the essential E3 ubiquitin ligase, Rsp5, indicating that the role of the Vid30c might be indirect of Hxt ubiquitylation
- Advances in fungal sugar transporters: unlocking the potential of second-generation bioethanol production
Pereira, Applied microbiology and biotechnology 2025 - “...S. cerevisiae Reifenberger et al. ( 1995 ); Apel et al. ( 2016 ) HXT3 P32466 Glucose, fructose, and mannose S. cerevisiae Reifenberger et al. ( 1995 ); Apel et al. ( 2016 ) HXT4 P32467 Glucose, xylose, fructose and mannose S. cerevisiae Reifenberger et al....”
- Yeast α-arrestin Art2 is the key regulator of ubiquitylation-dependent endocytosis of plasma membrane vitamin B1 transporters
Savocco, PLoS biology 2019 - “...Q05998 THI7 0.14 P38631 FKS1 0.18 P04817 CAN1 0.19 Q01896 ENA2 0.24 P32791 FRE1 0.31 P32466 HXT3 0.35 P38085 TAT1 0.38 Q06689 INA1 0.41 P32465 HXT1 0.42 P39004 HXT7 0.44 P32467 HXT4 0.48 P38079 YRO2 0.55 P40088 FTR1 0.55 P05030 PMA1 0.58 Q12256 TPO4 0.58 P38993...”
- “...1.1 P32791 FRE1 5.4 4.2 4.7 3.1 3.6 2.4 2.5 1.9 2.8 1.9 2.8 1.7 P32466 HXT3 3.0 1.5 2.1 8.4 1.3 0.7 1.7 0.8 3.6 1.2 1.5 0.7 P38085 TAT1 2.4 1.8 2.2 1.1 1.6 1.6 1.4 1.4 0.7 1.2 1.2 1.6 Q06689 INA1 1.2...”
- Knockout of the Hmt1p Arginine Methyltransferase in Saccharomyces cerevisiae Leads to the Dysregulation of Phosphate-associated Genes and Processes
Chia, Molecular & cellular proteomics : MCP 2018 - “...YJR029W* Lac1p Dbp10p Hxt3p P25369 P35688 P47100 P28496 Q12389 P32466 a Uniprot accession number of protein. bAverage (mean) ratio of both A and B replicates....”
- Novel Citronellyl-Based Photoprobes Designed to Identify ER Proteins Interacting with Dolichyl Phosphate in Yeast and Mammalian Cells.
Rush, Current chemical biology 2015 - “...11 High-affinity hexose transporter HXT6 + + P39004 11 High-affinity hexose transporter HXT6 + + P32466 11 Low-affinity glucose transporter HXT3 + + P32467 11 Low-affinity glucose transporter HXT4 + + Q03516 11 Uncharacterized protein RSN1 + P53154 10 Glycerol uptake protein 1 GUP1 + P40441...”
- Functional survey for heterologous sugar transport proteins, using Saccharomyces cerevisiae as a host
Young, Applied and environmental microbiology 2011 - “...15, 36 P39924 HXT13 15, 36 P39004 HXT7 15, 36 P32466 HXT4 a EcoRI ClaI XmaI ClaI BamHI-HF ClaI XmaI ClaI P13181 GAL2 S. cerevisiae 3, 38 Introns, Synthesized...”
- Rapid response of the yeast plasma membrane proteome to salt stress
Szopinska, Molecular & cellular proteomics : MCP 2011 - “...and MT P23291 P38250 P39004 P39003 P38695 P32467 P32466 P23585 P32465 P06775 P53154 P10823 P08539 P38631 Q08193 Q03655 P22146 P38196 P40088 Q12333 P32791 P23900...”
- Optimizing pentose utilization in yeast: the need for novel tools and approaches
Young, Biotechnology for biofuels 2010 - “...H2219 + Saccharomyces cerevisiae HXT1 P32465 p4H7 [ 64 ] TMB3201 - Saccharomyces cerevisiae HXT3 P32466 p4H7 [ 64 ] TMB3201 - Saccharomyces cerevisiae HXT4 P32467 p4H7 [ 64 ] TMB3201 + Saccharomyces cerevisiae HXT5 P38695 p4H7 [ 64 ] TMB3201 + Saccharomyces cerevisiae HXT7 P39004...”
- Major facilitator superfamily
Pao, Microbiology and molecular biology reviews : MMBR 1998 - “...818 569 S59368 P13181 L21753 P49374 P32465 P23585 P32466 P32467 P38695 P39003 P39004 P40886 P43581 P40885 P39924 P42833 P47185 Z71687 P30605 X98622 P30606...”
- Functional analysis of a Phytophthora host-translocated effector using the yeast model system
Wilson, PeerJ 2021 - “...genes following PsAvh110 expression. LFC * Gene name Protein description & function (SGD) 1.5 HXT3 (YDR345C) Low affinity glucose transporter of the major facilitator superfamily; expression is induced in low and high glucose conditions 1.3 FRM2 (YCL026C-A) Type II nitroreductase; possible role in lipid signaling, oxidative...”
- “...* Term size Query size Intersecting genes GO:0005353 Fructose transmembrane transporter activity 2.43 15 4 YDR345C, YHR092C GO:0015578 Mannose transmembrane transporter activity 2.43 15 4 YDR345C, YHR092C TF:M00061_0 Factor: Mig1p; motif: KANWWWWATSYGGGGWA; match class: 0 2.83 74 6 YDR345C, YDR384C, YHR092C Notes: Gene set enrichment analysis...”
- Yeast Double Transporter Gene Deletion Library for Identification of Xenobiotic Carriers in Low or High Throughput
Almeida, mBio 2021 - “...YBR068C, YBR069C, YBR180W, YBR294W, YBR295W, YBR296C, YBR298C, YCL025C, YCR010C, YCR011C, YCR028C, YCR098C, YDL199C, YDR011W, YDR046C, YDR345C, YDR384C, YDR387C, YDR406W, YDR497C, YDR508C, YDR536W, YEL063C, YEL065W, YER056C, YER145C, YER166W, YFL011W, YFL040W, YFL050C, YFL055W, YGL077C, YGL114W, YGL255W, YGR055W, YGR121C, YGR138C, YGR217W, YGR224W, YGR260W, YGR281W, YGR289C, YHL016C, YHL040C, YHL047C, YHR092C,...”
- Transcriptional profiling reveals molecular basis and novel genetic targets for improved resistance to multiple fermentation inhibitors in Saccharomyces cerevisiae
Chen, Biotechnology for biofuels 2016 - “...YLR205C, YOL052C-A, YPL091W Transmembrane transport (GO:0055085) YAL053W, YBR008C, YBR054W , YCL025C, YCR021C , YDR011W, YDR135C, YDR345C , YER060W, YGL255W, YGR065C, YGR138C , YGR260W, YGR281W, YHL036W, YHR092C, YHR096C , YKL175W, YKR039W, YLL028W, YLR130C, YLR237W, YML116W, YOL119C, YOR153W, YOR306C, YOR328W, YPL036W, YPL058C, YPL274W YBR054W , YCL025C, YCR021C ,...”
- “..., YHR094C, YHR096C , YPL036W YBL075C, YBR008C, YBR054W , YBR069C, YCR021C , YDR011W, YDR046C, YDR135C, YDR345C , YDR497C, YER103W, YFL054C, YGL255W, YGR138C , YGR281W, YHR092C, YHR096C , YJR095W, YKL175W, YLL028W, YLR237W, YLR259C, YML116W, YOR153W, YOR328W, YPL058C, YPL274W, YPR138C, YPR156C Ion transport (GO: 0006811) YAL053W, YBR054W, YCL025C,...”
- Analysis of COPII Vesicles Indicates a Role for the Emp47-Ssp120 Complex in Transport of Cell Surface Glycoproteins
Margulis, Traffic (Copenhagen, Denmark) 2016 - “...Plasma membrane ferro-oxidoreductase, involved in iron uptake YMR307W Gas1 1 5 Plasma membrane GPI-anchored -glucanosyltransferase YDR345C Hxt3 4 7 Plasma membrane glucose transporter YDR245W Mnn10 0 3 Subunit of a Golgi mannosyltransferase complex YOR153W Pdr5 0 10 Plasma membrane ATP-binding cassette (ABC) transporter YGL008C Pma1 21...”
- Phylogenetic and Transcripts Profiling of Glucose Sensing Related Genes in Candida glabrata
Ng, Jundishapur journal of microbiology 2015 - “...YGL035C CAA96736 504 55.6 HXT1 YHR094C DAA06789 570 63.3 HXT2 YMR011W DAA09909 541 59.8 HXT3 YDR345C DAA12185 567 62.6 HXT4 YHR092C DAA06788 576 63.9 HXT5 YHR096C DAA06790 592 66.3 HXT6 YDR343C DAA12184 570 62.7 HXT7 YDR342C DAA12183 570 62.7 HXT8 YJL214W DAA08597 569 63.5 HXT9 YJL219W...”
- Transcription analysis of recombinant industrial and laboratory Saccharomyces cerevisiae strains reveals the molecular basis for fermentation of glucose and xylose
Matsushika, Microbial cell factories 2014 - “...6.13 11.97 9.20 Xylulokinase Hexose transporters YMR011W HXT2 41.40 26.68 2.20 2.38 High-affinity glucose transporter YDR345C HXT8 7.17 16.25 4.10 5.35 Protein of unknown function with similarity to hexose transporter family members Other transporters YCR098C GIT1 13.32 8.90 2.53 2.28 Plasma membrane permease, mediates uptake of...”
- “...2.32 4.56 Mitochondrial protein Hexose transporters YHR094C HXT1 -30.45 -21.51 -56.36 -46.31 Low-affinity glucose transporter YDR345C HXT3 -54.60 -20.87 -83.61 -32.66 Low-affinity glucose transporter YHR096C HXT5 22.20 48.69 22.78 44.86 Hexose transporter with moderate affinity for glucose Galactose metabolism YBR020W GAL1 19.10 32.47 3.71 5.48 Galactokinase...”
- Changes in cell morphology are coordinated with cell growth through the TORC1 pathway
Goranov, Current biology : CB 2013 - “..., S267, S288, S575 ; up S255 YPR185W Atg13 down down S454, S461, S652, S656 YDR345C Hxt3 down up S3 YJR001W Avt1 down NA YNL321W Vnx1 up up T26, S110, S121 YML035C Amd1 down down S105 YMR205C Pfk2 up up S41, S42, S170 YOL061W Prs5 up...”
- Identification of a novel deletion mutant strain in Saccharomyces cerevisiae that results in a microsatellite instability phenotype
Ji, BioDiscovery 2012 - “...10866.08 0.47 YBR301W uptag antisense 607.88 7201.59 0.52 YBR301W uptag sense 811.12 9768.15 0.52 DNF2 YDR345C downtag antisense 222.58 1070.08 0.52 YDR345C downtag sense 286.95 2700.63 0.52 YDR345C uptag antisense 243.56 2034.80 0.43 GYP8 YFL027C downtag sense 175.96 1300.91 0.52 YFL027C uptag antisense 780.84 5998.65 0.52...”
- More
CTRG_06249 hypothetical protein from Candida tropicalis MYA-3404
29% identity, 52% coverage
AT1G34580 monosaccharide transporter, putative from Arabidopsis thaliana
28% identity, 56% coverage
- Calcium regulation of the Arabidopsis Na+/K+ transporter HKT1;1 improves seed germination under salt stress
Chandran, Plant physiology 2024 - “...binding 21.88 AT3G18080 BGLU44 B-S glucosidase 20.8 AT5G41020 MYB family transcription factor 20.75 NaCl Upregulated AT1G34580 Monosaccharide transmembrane transport 15.98 AT3G10860 Cytochrome bc1 complex, subunit 8 13.9 AT1G02310 MAN1 Glycosyl hydrolase 9.55 AT5G15960 KIN1 ABA signaling pathway component 8.37 AT1G04450 RIC3 Intracellular calcium gradient maintenance 7.0...”
- Interaction between phenylpropane metabolism and oil accumulation in the developing seed of Brassica napus revealed by high temporal-resolution transcriptomes
Yu, BMC biology 2023 - “...AT2G42850 CYP718 BnaA05G0330700ZS 0.2963 0.0134 0.3255 0.0105 BnaA05g16630D AT3G23090 BnaA08G0068400ZS 0.2676 0.0002 0.4331 0 BnaA08g29710D AT1G34580 STP5 BnaA08G0294900ZS 0.1615 0.0132 0.1704 0.0175 BnaA08g26420D AT1G09430 ACLA-3 BnaA09G0210400ZS 0.1702 0.0111 0.219 0.0025 BnaAnng07300D AT5G46880 HDG5 HD-ZIP BnaA09G0461900ZS 0.2985 0 0.3258 0 BnaA09g30660D AT1G22410 BnaC01G0103400ZS 0.2117 0.0054 0.1911 0.0217...”
- Dynamic Development of White Lupin Rootlets Along a Cluster Root
Le, Frontiers in plant science 2021 - “...Others Profile 5 Lalb_Chr04g0261571 AT1G01340 Cyclic Nucleotide Gated Channel 10 (CNGC10) Others Profile 5 Lalb_Chr08g0242031 AT1G34580 Major facilitator superfamily protein Others Profile 4 Lalb_Chr08g0242041 AT1G34580 Major facilitator superfamily protein Others Profile 5 Lalb_Chr16g0391341 AT4G10770 Oligopeptide transporter 7 (OPT7) Others Profile 6 Lalb_Chr19g0130401 AT4G27970 SLAC1 homolog 2...”
- Plant glucose transporter structure and function
Geiger, Pflugers Archiv : European journal of physiology 2020 - “...xylose, arabinose High [ 35 , 36 , 94 , 122 , 160 ] AtSTP5 At1g34580 Silique and whole seedling Plasma membrane Non functional? AtSTP6 At3g05960 Fully developed pollen grain Plasma membrane Glucose, galactose, mannose, fructose, arabinose High [ 122 , 134 ] AtSTP7 At4g02050 Multiple...”
- Genome-Wide Identification and Expression Profiling of Sugar Transporter Protein (STP) Family Genes in Cabbage (Brassica oleracea var. capitata L.) Reveals their Involvement in Clubroot Disease Responses
Zhang, Genes 2019 - “...Bol017006 C06 LF 1512 503 54.76 9.12 40.17 100.95 0.45 cell membrane tPCK1 B AtSTP5 AT1G34580 1521 506 BoSTP5 Bol009461 Scaffold000233 MF1 1521 506 54.43 9.28 30.06 109.13 0.69 cell membrane tPCK4 U AtSTP12 AT4G21480 1509 502 BoSTP12 Bol028422 C01 LF 1542 513 56.62 8.70 30.38...”
- MaRAP2-4, a waterlogging-responsive ERF from Mentha, regulates bidirectional sugar transporter AtSWEET10 to modulate stress response in Arabidopsis
Phukan, Plant biotechnology journal 2018 - “...genes carrying MaRAP24 interacting cis elements TAIR ID Name cis elements Fold induction P value AT1G34580 Sugar transport protein 5 3 DRE 7.00 0.0287 AT4G15210 Betaamylase 5 2 DRE 6.86 0.0079 AT4G35670 Pectin lyaselike 1 DRE 4.76 0.0488 AT2G05790 Oglycosyl hydrolases 1 DRE 4.70 0.0142 AT2G36190...”
- Transcriptomic and proteomic approach to identify differentially expressed genes and proteins in Arabidopsis thaliana mutants lacking chloroplastic 1 and cytosolic FBPases reveals several levels of metabolic regulation
Soto-Suárez, BMC plant biology 2016 - “...while sugar transporter 4 (At3g19930), GDP-mannose transmembrane transporter 1 (At2g13650), and a putative monosaccharide transporter (At1g34580) were up-regulated in cfbp1 roots (Additional file 1 : Table S1 and Additional file 5 : Table S4). Sugar transporter 2 (At1g07340) and three sugar transporter family proteins (At3g05155, At4g04760,...”
- “...At3g59360) were up-regulated in cyfbp roots, whereas two monosaccharide transporters were down-regulated in this organ (At1g34580 and At1g54730) (Additional file 1 : Table S1 and Additional file 5 : Table S4). Validation of differentially expressed genes, using QRT-PCR To validate the cfbp1 and cyfbp microarray results,...”
- Re-analysis of protein data reveals the germination pathway and up accumulation mechanism of cell wall hydrolases during the radicle protrusion step of seed germination in Podophyllum hexandrum- a high altitude plant
Dogra, Frontiers in plant science 2015 - “...54. AT5G54200 GO:0007165 Transducin/WD40 repeat-like superfamily protein 55. AT5G63400 GO:0004017 Adenylate kinase 1 (ADK1) 56. AT1G34580 GO:0005351 Sugar transport protein 5 57. AT3G06720 GO:0006886 Importin alpha isoform 1 (IMPA1) 58. AT1G02690 GO:0000226 Importin alpha isoform 6 (IMPA6) 59. AT3G54840 GO:0003924 Ras-related small GTP-binding family protein (RABF1)...”
- More
HXT1 / P32465 low-affinity glucose/mannose transporter HXT1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (see 65 papers)
HXT1_YEAST / P32465 Low-affinity glucose transporter HXT1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
TC 2.A.1.1.108 / P32465 Low-affinity glucose transporter HXT1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (see 9 papers)
NP_011962 hexose transporter HXT1 from Saccharomyces cerevisiae S288C
NP_011962, YHR094C Hxt1p from Saccharomyces cerevisiae
26% identity, 60% coverage
- function: Low-affinity glucose transporter. HXT1 is as well involved in the transport of mannose
- substrates: glucose
- Advances in fungal sugar transporters: unlocking the potential of second-generation bioethanol production
Pereira, Applied microbiology and biotechnology 2025 - “...) MtCDT-2 G2Q6B1 Xylobiose and cellobiose M. thermophila Liu et al. ( 2024 ) HXT1 P32465 Glucose, xylose, fructose, and mannose S. cerevisiae Reifenberger et al. ( 1995 ); Apel et al. ( 2016 ) HXT2 P23585 Glucose, xylose, fructose, and mannose S. cerevisiae Reifenberger et...”
- Yeast α-arrestin Art2 is the key regulator of ubiquitylation-dependent endocytosis of plasma membrane vitamin B1 transporters
Savocco, PLoS biology 2019 - “...Q01896 ENA2 0.24 P32791 FRE1 0.31 P32466 HXT3 0.35 P38085 TAT1 0.38 Q06689 INA1 0.41 P32465 HXT1 0.42 P39004 HXT7 0.44 P32467 HXT4 0.48 P38079 YRO2 0.55 P40088 FTR1 0.55 P05030 PMA1 0.58 Q12256 TPO4 0.58 P38993 FET3 0.60 P49573 CTR1 0.63 P40474 QDR2 0.64 P22146...”
- “...1.6 Q06689 INA1 1.2 0.9 1.6 0.8 0.8 0.4 0.8 0.4 0.5 0.7 0.1 0.3 P32465 HXT1 4.6 2.8 4.4 9.3 2.6 1.6 2.2 1.8 1.7 2.4 1.4 1.9 P39004 HXT7 0.6 0.4 0.3 1.1 0.6 0.2 0.9 0.6 0.1 0.7 0.1 0.4 P32467 HXT4 0.7...”
- Relationship between Metabolic Fluxes and Sequence-Derived Properties of Enzymes
Zikmanis, International scholarly research notices 2014 (no snippet) - Mutations in SLC2A2 gene reveal hGLUT2 function in pancreatic β cell development
Michau, The Journal of biological chemistry 2013 - “...GLUT2; Q102R8 for zebrafish (Danio rerio) GLUT2; P32465 for yeast (Saccharomyces cerevisiae) HXT1; and Q9FRL3 for plant (Arabidopsis thaliana) sugar transporter...”
- Rapid response of the yeast plasma membrane proteome to salt stress
Szopinska, Molecular & cellular proteomics : MCP 2011 - “...P23291 P38250 P39004 P39003 P38695 P32467 P32466 P23585 P32465 P06775 P53154 P10823 P08539 P38631 Q08193 Q03655 P22146 P38196 P40088 Q12333 P32791 P23900 Q07651...”
- Optimizing pentose utilization in yeast: the need for novel tools and approaches
Young, Biotechnology for biofuels 2010 - “...TMB3201 - Trichoderma reesei Xlt1 Q1EG32 pAJ401 [ 66 ] H2219 +* Saccharomyces cerevisiae HXT1 P32465 pYX212 [ 66 ] H2219 + Saccharomyces cerevisiae HXT2 P23585 pYX212 [ 66 ] H2219 + Saccharomyces cerevisiae HXT4 P32467 pYX212 [ 66 ] H2219 + Saccharomyces cerevisiae HXT7 P39004...”
- Major facilitator superfamily
Pao, Microbiology and molecular biology reviews : MMBR 1998 - “...486 457 602 818 569 S59368 P13181 L21753 P49374 P32465 P23585 P32466 P32467 P38695 P39003 P39004 P40886 P43581 P40885 P39924 P42833 P47185 Z71687 P30605 X98622...”
- Local Anesthetics and Antipsychotic Phenothiazines Interact Nonspecifically with Membranes and Inhibit Hexose Transporters in Yeast.
Uesono, Genetics 2016 - GeneRIF: Local anesthetics and antipsychotic phenothiazine inhibit uptake of glucose by interacting nonspecifically with hexose transporter HXT1
- Assessing glucose uptake through the yeast hexose transporter 1 (Hxt1).
Roy, PloS one 2015 - GeneRIF: Results show that Hxt1 transports 2-NBDG in a mechanism similar to human glucose transporters and, that some of the putative glucose-binding residues of Hxt1 are involved in endocytosis with N370 residue as critical for its stability and function.
- Psy2 targets the PP4 family phosphatase Pph3 to dephosphorylate Mth1 and repress glucose transporter gene expression.
Ma, Molecular and cellular biology 2014 - GeneRIF: Data show that Pph3-Psy2 targets the glucose signal transducer protein Mth1, which is required for the dephosphorylation of Rgt1 upon glucose withdrawal, a critical event in the repression of HXT genes, which encode glucose transporters.
- Expression of the glucose transporter HXT1 involves the Ser-Thr protein phosphatase Sit4 in Saccharomyces cerevisiae.
Souza, FEMS yeast research 2012 (PubMed)- GeneRIF: Association of the HXT1 mRNA with polysomes is regulated by SIT4.
- Different signalling pathways mediate glucose induction of SUC2, HXT1 and pyruvate decarboxylase in yeast.
Belinchón, FEMS yeast research 2007 (PubMed)- GeneRIF: Hxk2 is required for the high expression of HXT1.
- TOR kinase pathway and 14-3-3 proteins regulate glucose-induced expression of HXT1, a yeast low-affinity glucose transporter.
Tomás-Cobos, Yeast (Chichester, England) 2005 (PubMed)- GeneRIF: TOR kinase pathway participates actively in the induction of HXT1 expression by glucose. Inhibition of the TOR kinase pathway by rapamycin treatment abolishes HXT1 glucose induction.
- Furfural tolerance of mutant Saccharomyces cerevisiae selected via ionizing radiation combined with adaptive laboratory evolution
Ren, Biotechnology for biofuels and bioproducts 2024 - “...RPA12 229.45 4.64 RNA polymerase I subunit A12.2 YNL112W DBP2 1399.74 4.67 ATP-dependent RNA helicase YHR094C HXT1 237.18 3.35 Low-affinity glucose transporter YKL166C TPK3 75.28 1.76 cAMP-dependent protein kinase catalytic subunit YGR087C PDC6 0.97 2.12 Minor isoform of pyruvate decarboxylase YKL029C MAE1 118.05 2.60 Mitochondrial malic...”
- DebaryOmics: an integrative -omics study to understand the halophilic behaviour of Debaryomyces hansenii
Navarrete, Microbial biotechnology 2022 - “...NO HXT1 Lowaffinity glucose transporter. HXT1 is as well involved in the transport of mannose YHR094C DEHA2E04224g YES NO HXT5 Hexose transporter with moderate affinity for glucose YHR096C DEHA2D18876g YES YES RRS1 Regulator of ribosome biosynthesis YOR294W DEHA2F09834g NO NO BFR2 Involved in endoplasmic reticulum to...”
- Yeast Double Transporter Gene Deletion Library for Identification of Xenobiotic Carriers in Low or High Throughput
Almeida, mBio 2021 - “...YGL077C, YGL114W, YGL255W, YGR055W, YGR121C, YGR138C, YGR217W, YGR224W, YGR260W, YGR281W, YGR289C, YHL016C, YHL040C, YHL047C, YHR092C, YHR094C, YHR096C, YIL013C, YIL088C, YIL120W, YIL121W, YJL093C, YJL129C, YJL212C, YJL214W, YJR040W, YJR054W, YJR152W, YKL174C, YKL217W, YKR039W, YKR050W, YKR103W, YKR106W, YLL028W, YLL043W, YLL048C, YLL052C, YLL061W, YLR081W, YLR092W, YLR130C, YLR138W, YLR237W, YML047C, YML116W,...”
- Identification of the Genetic Requirements for Zinc Tolerance and Toxicity in Saccharomyces cerevisiae
Zhao, G3 (Bethesda, Md.) 2020 - “...GOS1 YLR242C ARV1 YMR243C ZRC1 YDR186C SND1 YHR026W VMA16 YKL080W VMA5 YNL323W LEM3 YDR276C PMP3 YHR094C HXT1 YKL119C VPH2 YOR270C VPH1 YDR456W NHX1 YHR108W GGA2 YKR020W VPS51 YPL045W VPS16 Unclassified proteins (15) YCL007C YHR112C YKL044W MMO1 YNL204C SPS18 YDL041W YHR151C MTC6 YLR149C YPL261C YDR203W YJL211C YLR232W...”
- Improved Xylose Metabolism by a CYC8 Mutant of Saccharomyces cerevisiae
Nijland, Applied and environmental microbiology 2017 - “...CYC8(Y353) Probe YMR011W YDR343C YDR342C YHR092C YHR096C YHR094C YJL214W YDL245C YJR158W YEL069C YFL011W YJL219W YOL156W YLR081W YNL318C Sum of all HXTs...”
- Extensive Copy Number Variation in Fermentation-Related Genes Among Saccharomyces cerevisiae Wine Strains
Steenwyk, G3 (Bethesda, Md.) 2017 - “...the absolute CN of all other 10 members ( GAL2 / YLR081W , HXT1 / YHR094C , HXT2 / YMR011W , HXT4 / YHR092C , HXT5 / YHR096C , HXT8 / YJL214W , HXT10 / YFL011W , HXT16 / YJR158W , RGT2 / YDL138W , and...”
- Acetylated Deoxynivalenol Generates Differences of Gene Expression that Discriminate Trichothecene Toxicity
Suzuki, Toxins 2016 - “...plasma membrane Plasma membrane glucose sensor YDL194W SNF3 plasma membrane Plasma membrane low glucose sensor YHR094C HXT1 plasma membrane Low-affinity glucose transporter YMR011W HXT2 plasma membrane High-affinity glucose transporter YHR092C HXT4 plasma membrane High-affinity glucose transporter The gene expression of RGT1 , RGT2 , and SNF3...”
- Transcriptional profiling reveals molecular basis and novel genetic targets for improved resistance to multiple fermentation inhibitors in Saccharomyces cerevisiae
Chen, Biotechnology for biofuels 2016 - “...YOR306C, YOR328W, YPL036W, YPL058C, YPL274W YBR054W , YCL025C, YCR021C , YDR345C , YER103W, YGR138C , YHR094C, YHR096C , YPL036W YBL075C, YBR008C, YBR054W , YBR069C, YCR021C , YDR011W, YDR046C, YDR135C, YDR345C , YDR497C, YER103W, YFL054C, YGL255W, YGR138C , YGR281W, YHR092C, YHR096C , YJR095W, YKL175W, YLL028W, YLR237W, YLR259C,...”
- More
GTR5_BOVIN / P58353 Solute carrier family 2, facilitated glucose transporter member 5; Fructose transporter; Glucose transporter type 5, small intestine; GLUT-5 from Bos taurus (Bovine) (see paper)
NP_001094512 solute carrier family 2, facilitated glucose transporter member 5 from Bos taurus
LOC107131287 solute carrier family 2, facilitated glucose transporter member 5 from Bos taurus
32% identity, 47% coverage
- function: Functions as a fructose transporter that has only low activity with other monosaccharides. Can mediate the uptake of deoxyglucose, but with low efficiency. Essential for fructose uptake in the small intestine. Plays a role in the regulation of salt uptake and blood pressure in response to dietary fructose. Required for the development of high blood pressure in response to high dietary fructose intake.
catalytic activity: D-fructose(out) = D-fructose(in) (RHEA:60372) - Structural comparison of GLUT1 to GLUT3 reveal transport regulation mechanism in sugar porter family.
Custódio, Life science alliance 2021 - “...), GLUT3 (UniProt P11169 ), GLUT4 (UniProt P14672 ), rGLUT5 (UniProt P43427 ), bGLUT5 (UniProt P58353 ), atSTP10 (UniProt Q9LT15 ), XylE (UniProt P0AGF4 ), and GlcPse (UniProt A0A0H2VG78 ). Conserved residues are highlighted with gray-scale. Alpha helices as found in GLUT1 are represented above the...”
- Structure and mechanism of the mammalian fructose transporter GLUT5
Nomura, Nature 2015 - “...taurus GLUT5 cloned sequence containing 1 to 473 out of 501 residues (UniProt accession number: P58353); N51A deglycosylation mutation is underlined and additional C-terminal residues retained after TEV cleavage are shown in italic (see next section for cloning details). MEPQDPVKREGRLTPVIVLATLIAAFGSSFQYGYNVAAINSPSEFMKDFY A YTYYDRVG EYMNEFYLTLLWSVTVSMFPFGGFLGSLMVGPLVNNLGRKGTLLFNNIFSIVPALLMGF SELAKSFEMIIVARVLVGICAGLSSNVVPMYLGELAPKNWRGALGVVPQLFITIGILVAQI FGLRSLLANEEGWPILLGLTGIPAVLQLLFLPFFPESPRYLLIQKKDEAAAKSALRRLRG WHDVDAEIEEILEEDRAEKAVGFISVLKLFKMRSLRWQVISIIVLMAGQQLSGVNAIYYY...”
- Structure and mechanism of the mammalian fructose transporter GLUT5.
Nomura, Nature 2015 - GeneRIF: crystal structures of GLUT5 from Rattus norvegicus and Bos taurus in open outward- and open inward-facing conformations, respectively
- Assessing genomic diversity and signatures of selection in Pinan cattle using whole-genome sequencing data
Zhang, BMC genomics 2022 - “...LOC112449293 15: 48.4848.57 0.015635 LOC781483, LOC781444, LOC781403 16: 8.928.97 0.022505 LOC789494 16: 44.3244.41 0.008253 GPR157, LOC107131287 neuronal differentiation [ 32 ] 18: 44.6044.67 0.013972 LSM14A antiviral immune response [ 33 ] 19: 27.0827.13 0.015391 NLGN2, SPEM2, LOC112442746, TMEM102, TMEM256, SPEM1, FGF11, CHRNB1 disease-related [ 34 38...”
- Genetic Diversity and Signatures of Selection for Thermal Stress in Cattle and Other Two Bos Species Adapted to Divergent Climatic Conditions
Freitas, Frontiers in genetics 2021 - “...blood coagulation F3, FGA, FGG, VWF 0.026 SCEN2INTERPRO General substrate and sugar transporter SLC2A1, SLC2A10, LOC107131287 0.047 SCEN2GOTERM Platelet activation FGA, FGG, VWF 0.04 SCEN2GOTERM Myosin complex MYO1D, MYO1E, MYO5A, MYO5C 0.041 SCEN2GOTERM Steroid hormone receptor activity RORA, RORB, HNF4A, THRA 0.040 SCEN2GOTERM Collagen C1QTNF7, COL4A3,...”
FGSG_02978 hypothetical protein from Fusarium graminearum PH-1
29% identity, 55% coverage
An02g08230 uncharacterized protein from Aspergillus niger
25% identity, 55% coverage
XP_042994240 uncharacterized protein from Ustilaginoidea virens
30% identity, 55% coverage
Q1K4S3 Hexose transporter HXT13 from Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
NCU01633 hexose transporter HXT13 from Neurospora crassa OR74A
28% identity, 52% coverage
- Advances in fungal sugar transporters: unlocking the potential of second-generation bioethanol production
Pereira, Applied microbiology and biotechnology 2025 - “...( 2017a ) HGT-2 Q7S3Q4 Glucose N. crassa Wang et al. ( 2017a ) GLT-1 Q1K4S3 Glucose and xylose N. crassa Li et al. ( 2014 ); Wang et al. ( 2017a ) NCU00809 Q7SEC5 Lactose N. crassa Tamayo et al. ( 2024 ) CdtC S8AIR7...”
- Do mitochondria use efflux pumps to protect their ribosomes from antibiotics?
Islam, Microbiology (Reading, England) 2023 - “...NCU05226 Q7S8I2 ABC O42765, 7.8E^6 A0A1P8ATY7, 6.7E^12 Q8WW24, 1.4E^14 [ 79, 112 ] HXT13, NCU01633 Q1K4S3 MFS Q8J2J7, 2.1E^85 P23586, 1.2E^52 P11168, 2.6E^48 [ 79 ] NCU04809 Q756M6 MFS T2AWG3, 0.0014 Q8GYF4, 1.4E^24 B3KT41, 0.0022 [ 79 ] NCU09551 Q7S2B0 MFS G1UAY0, 2.3E^6 Q56ZZ7, 2.3E^7 Q8NBP5,...”
- Revisiting 2-Deoxyglucose Resistance in Neurospora crassa: Insights into Transcriptional Regulation of Hexose Transporters, Sugar Metabolism and Possible Modulation by Mating Type
Pandey, 2023 - Do mitochondria use efflux pumps to protect their ribosomes from antibiotics?
Islam, Microbiology (Reading, England) 2023 - “...] NCU05226 Q7S8I2 ABC O42765, 7.8E^6 A0A1P8ATY7, 6.7E^12 Q8WW24, 1.4E^14 [ 79, 112 ] HXT13, NCU01633 Q1K4S3 MFS Q8J2J7, 2.1E^85 P23586, 1.2E^52 P11168, 2.6E^48 [ 79 ] NCU04809 Q756M6 MFS T2AWG3, 0.0014 Q8GYF4, 1.4E^24 B3KT41, 0.0022 [ 79 ] NCU09551 Q7S2B0 MFS G1UAY0, 2.3E^6 Q56ZZ7, 2.3E^7...”
- The F-box protein gene exo-1 is a target for reverse engineering enzyme hypersecretion in filamentous fungi
Gabriel, Proceedings of the National Academy of Sciences of the United States of America 2021 (secret) - Transcriptional Profiling of Myceliophthora thermophila on Galactose and Metabolic Engineering for Improved Galactose Utilization
Wang, Frontiers in microbiology 2021 - “...and most likely, it is the major galactose transporter in this fungus, of which ortholog (NCU01633, glt-1 ) in N. crassa has been identified as a glucose transporter and also has the capability of transportation of multiple other monosaccharides, including galactose ( Li et al., 2014...”
- Evaluating the circadian rhythm and response to glucose addition in dispersed growth cultures of Neurospora crassa
Kelliher, Fungal biology 2020 - “...genome, three genes were recently identified and characterized as major components of System I: glt-1 (NCU01633), and of System II: hgt-1 and hgt-2 (NCU10021 and NCU04963) ( Wang et al., 2017 ). The K m values for all three transporters fall within the ranges of earlier...”
- Identification and characterization of the glucose dual-affinity transport system in Neurospora crassa: pleiotropic roles in nutrient transport, signaling, and carbon catabolite repression
Wang, Biotechnology for biofuels 2017 - “...dual-affinity transport system in the model fungus N. crassa . One low-affinity glucose transporter, GLT-1 (NCU01633), and two high-affinity transporters, HGT-1/-2 (NCU10021 and NCU04963), were identified as the major components of systems I and II, respectively. Simultaneous deletion of hgt - 1/ - 2 (strain 2hgt...”
- Neurospora crassa transcriptomics reveals oxidative stress and plasma membrane homeostasis biology genes as key targets in response to chitosan
Lopez-Moya, Molecular bioSystems 2016 - “...other genes related with sugars assimilation were also induces in presence of chitosan such as NCU01633 ( hxt13 ; Table S2 ). Clusters 2M and 3M, had gene expression changes in the control but not in the chitosan treatment ( Figs. 4B and 4C ). Genes...”
- Involvement of the adaptor protein 3 complex in lignocellulase secretion in Neurospora crassa revealed by comparative genomic screening
Pei, Biotechnology for biofuels 2015 - “...alcohol oxidase 616.825.92 7.26 61 15869 NCU00335 jgi|Trire2|5140| Pre-mRNA-splicing factor cwc15 612.1815.31 6.51 62 13160 NCU01633 jgi|Trire2|62380| Hexose transporter HXT13 611.2919.85 6.33 63 19733 NCU06832 jgi|Trire2|112231| Kinesin 609.845.91 5.93 64 12341 NCU09864 jgi|Trire2|56726| 2-Oxoisovalerate dehydrogenase alpha subunit 608.184.15 5.88 65 11030 NCU07788 jgi|Trire2|52368| Fungal specific transcription...”
- More
GRMZM2G063824 carbohydrate transporter/ sugar porter from Zea mays
30% identity, 51% coverage
- Transcriptome Analysis of Maize Ear Leaves Treated with Long-Term Straw Return plus Nitrogen Fertilizer under the Wheat-Maize Rotation System
Li, Plants (Basel, Switzerland) 2023 - “...two genes encoding beta-glucosidase 1 ( GRMZM2G016890 and GBA1 ), GRMZM2G066162 encoding endoglucanase 12-like and GRMZM2G063824 encoding carbohydrate transporter/sugar porter were significantly up-regulated in N treatment, but their expression level kept the same as in SR and SRN treatments. There were three DEGs ( GRMZM2G178014 ,...”
- “...the regulation of sugar transport. In this work, two sugar transporter genes ( GRMZM2G157675 and GRMZM2G063824 ) showed quite opposite expression patterns in N treatment, but their expression level did not change in SR and SRN treatment. It indicated that sugar transport in maize leaf was...”
- Analysis of weighted co-regulatory networks in maize provides insights into new genes and regulatory mechanisms related to inositol phosphate metabolism
Zhang, BMC genomics 2016 - “...were related to carbohydrate metabolism. Representative genes include a UDP-galactose transporter (GRMZM2G089630, node CD2), carbohydrate/inositol-transporters (GRMZM2G063824, GRMZM2G064437, nodes CA1 and CC1), and a glycerol-3-phosphate transporter (GRMZM2G078757, node CC4). The correlation between IP6 levels and the expression of carbohydrate transporters (correlation coefficient ranged from 0.51 to 0.95,...”
- Transcriptional analyses of natural leaf senescence in maize
Zhang, PloS one 2014 - “...(AtPLT5) Abscission control [97] GRMZM2G302604 AT3G18830 ARABIDOPSIS THALIANA POLYOL/MONOSACCHARIDE TRANSPORTER 5 (AtPLT5) Abscission control [97] GRMZM2G063824 AT3G18830 ARABIDOPSIS THALIANA POLYOL/MONOSACCHARIDE TRANSPORTER 5 (AtPLT5) Abscission control [97] GRMZM5G862325 AT3G18830 ARABIDOPSIS THALIANA POLYOL/MONOSACCHARIDE TRANSPORTER 5 (AtPLT5) Abscission control [97] GRMZM2G339563 AT3G44880 PHEOPHORBIDE A OXYGENASE (PAO) Positive regulator in...”
AL01_03450 sugar porter family MFS transporter from Bombella intestini
31% identity, 53% coverage
9g11A / Q9SFG0 Sugar/h+ symporter stp6 in inward occluded conformation with glucose bound
28% identity, 56% coverage
- Ligands: beta-d-glucopyranose; cholesterol hemisuccinate (9g11A)
CNH02990 sugar transporter from Cryptococcus neoformans var. neoformans JEC21
28% identity, 55% coverage
Q7UF68 Xylose transporter from Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
26% identity, 54% coverage
D9T18_05400 sugar porter family MFS transporter from Pseudoalteromonas agarivorans
27% identity, 53% coverage
- Pan-Genomic and Transcriptomic Analyses of Marine Pseudoalteromonas agarivorans Hao 2018 Revealed Its Genomic and Metabolic Features
Jv, Marine drugs 2022 - “...shown in Table 2 , the expression levels of genes encoding sugar transporters (D9T18_18920 and D9T18_05400) at 2 h were higher than those at 24 h. Monosaccharides need to be converted into corresponding nucleotide sugars before they can be used to synthesize EPS. Upon analysis of...”
- “...Annotation Locus Tag 2 h_RPKM 24 h_RPKM glucose/galactose MFS transporter D9T18_18920 210.32 90.40 MFS transporter D9T18_05400 150.59 42.61 marinedrugs-20-00248-t003_Table 3 Table 3 Gene expression related to nucleotide sugar synthesis. Annotation Locus Tag 2 h_RPKM 24 h_RPKM UDP-glucuronate-epimerase D9T18_02060 188.19 45.88 dTDP-4-dehydrorhamnose 3,5-epimerase D9T18_02110 657.00 66.08 dTDP-4-dehydrorhamnose...”
O62787 Solute carrier family 2, facilitated glucose transporter member 3 from Sus scrofa
26% identity, 56% coverage
- GPX5-Enriched Exosomes Improve Sperm Quality and Fertilization Ability.
Huang, International journal of molecular sciences 2024 - “...Accession Protein Name Fold of Change (HCR/LCR) p -Value O18994 Glutathione peroxidase 5 4.14 0.0094 O62787 Glucose transporter type 3 3.46 0.0141 O97763 Niemann Pick type C2 protein homolog 2.01 0.0010 P00336 L-lactate dehydrogenase B chain 4.50 0.0340 P00339 L-lactate dehydrogenase A chain isoform X3 2.62...”
AO090010000063 No description from Aspergillus oryzae RIB40
27% identity, 53% coverage
LOC100232961 hexose transporter HT2 from Vitis vinifera
27% identity, 55% coverage
- Transcripts switched off at the stop of phloem unloading highlight the energy efficiency of sugar import in the ripening V. vinifera fruit
Savoi, Horticulture research 2021 - “...GIN1 Vitvi14g01977 LOC100244103 297 2 3 99 294.2 93 [Cell wall] Expansin A (VvEXPA16) Vitvi18g00397 LOC100232961 333 119 52 84 280.7 105 [Sugar] Hexose transporter HT2 Vitvi03g00209 LOC100258952 286 35 25 91 260.4 113 [Cell wall] Expansin A-like (VvEXLA01) Vitvi18g01628 LOC100255463 351 133 106 70 245.8...”
- “...probable PM H + hexose symporter inhibited with phloem arrest was VviHT2 ( Vitvi18g00397 - LOC100232961 ) 43 . It also exhibited a considerable increase during ripening, followed by a 35% decrease in 2 weeks 44 . Synchronised berries show here that more than 50% inhibition...”
HGT12 potential sugar sensor or transporter from Candida albicans (see 4 papers)
XP_720385 Hgt12p from Candida albicans SC5314
Q8J2J7 Putative glucose sensor protein from Candida albicans
28% identity, 55% coverage
- CharProtDB CGD description: glucose, fructose, mannose transporter; major facilitator superfamily; role in macrophage-induced hyphal growth; detected at germ tube plasma membrane by mass spectrometry; Snf3p-induced; 12 probable transmembrane segments
- The Candida albicans gene HGT12 (orf19.7094) encodes a hexose transporter.
Luo, FEMS immunology and medical microbiology 2007 (PubMed)- GeneRIF: The HGT12 gene encodes a fructose, glucose, and mannose transporter.
- GeneRIF: The C. albicans gene HGT12, which is specifically expressed during macrophage infection, encodes a protein that transports fructose, glucose and mannose.
- Do mitochondria use efflux pumps to protect their ribosomes from antibiotics?
Islam, Microbiology (Reading, England) 2023 - “...ABC O42765, 7.8E^6 A0A1P8ATY7, 6.7E^12 Q8WW24, 1.4E^14 [ 79, 112 ] HXT13, NCU01633 Q1K4S3 MFS Q8J2J7, 2.1E^85 P23586, 1.2E^52 P11168, 2.6E^48 [ 79 ] NCU04809 Q756M6 MFS T2AWG3, 0.0014 Q8GYF4, 1.4E^24 B3KT41, 0.0022 [ 79 ] NCU09551 Q7S2B0 MFS G1UAY0, 2.3E^6 Q56ZZ7, 2.3E^7 Q8NBP5, 8.4E^9 [...”
An11g05280 uncharacterized protein from Aspergillus niger
27% identity, 58% coverage
LOC8056880 sugar transport protein 13 from Sorghum bicolor
27% identity, 56% coverage
- Deciphering the Genetic Mechanisms of Salt Tolerance in Sorghum bicolor L.: Key Genes and SNP Associations from Comparative Transcriptomic Analyses
Jeon, Plants (Basel, Switzerland) 2023 - “...with salt tolerance were inferred, including LOC8071970 , LOC8067721 , LOC110430887 , LOC8070256 , and LOC8056880 . These genes demonstrated notable differences in nsSNPs in comparison to the wild type, suggesting their potential roles in salt tolerance. Additionally, LOC8060874 (cyanohydrin beta-glucosyltransferase) was suggested as a key...”
- “...abiotic stress such as wounding, extreme temperatures, UV-rays, oxidative stress, and drought [ 50 ]. LOC8056880 is a functional sugar transport protein 13. Six nsSNPs were detected in the mutant, which is six times higher than in the wild type. SWEETs (Sugars Will Eventually be Exported...”
CNBG_0457 MFS transporter SP family solute carrier family 2 (myo-inositol transporter) member 13 from Cryptococcus deuterogattii R265
28% identity, 52% coverage
TC 2.A.1.1.6 / P13181 Galactose, glucose uniporter, Gal2. Also transports xylose from Saccharomyces cerevisiae (Baker's yeast) (see 4 papers)
GAL2 / GI|1360445 galactose transporter from Saccharomyces cerevisiae
NP_013182 galactose permease GAL2 from Saccharomyces cerevisiae S288C
NP_013182, YLR081W Gal2p from Saccharomyces cerevisiae
25% identity, 56% coverage
- substrates: Galactose, Xylose, glucose
tcdb comment: This transporter has been engineered by mutation (N376F) to transport xylose without being inhibited by glucose or transporting other hexoses (Farwick et al. 2014). The 3-d structure is known (Wang et al. 2015) - Advances in fungal sugar transporters: unlocking the potential of second-generation bioethanol production
Pereira, Applied microbiology and biotechnology 2025 - “...) HXT13 P39924 Glucose and mannose S. cerevisiae Young et al. ( 2011 ) Gal2 P13181 Glucose, xylose, L-arabinose, galactose, fructose, mannose, and ribose S. cerevisiae Hamacher et al. ( 2002 ); Becker and Boles ( 2003 ); Young et al. ( 2011 ) GXF1 Q2MDH1...”
- The Penicillium chrysogenum transporter PcAraT enables high-affinity, glucose-insensitive l-arabinose transport in Saccharomyces cerevisiae
Bracher, Biotechnology for biofuels 2018 - “...rooted in iTOL ( https://itol.embl.de/ ) [ 54 ]. Gene accession numbers were ScGAL2 : P13181, PcaraT : CAP85508, SsaraT : XP_001382755, Atstp2 : OAP13698, Kmaxt1 : GZ791039, Pgaxt1 : GZ791040, Amlat1 : AY923868, Amlat2 : AY923869, Nclat - 1 : EAA30346, Mtlat - 1 :...”
- “...literature references for each transporter are provided in Table 6 . Accession numbers: Sc Gal2: P13181, Pc AraT: CAP85508, Ss AraT: A3LQQ5-1, At Stp2: OAP13698, Km Axt1: GZ791039, Pg Axt1: GZ791040, Am Lat1: AY923868, Am Lat2: AY923869, Nc Lat-1: EAA30346, Mt Lat-1: G2QFT5-1 l -Arabinose transport...”
- Functional survey for heterologous sugar transport proteins, using Saccharomyces cerevisiae as a host
Young, Applied and environmental microbiology 2011 - “...a EcoRI ClaI XmaI ClaI BamHI-HF ClaI XmaI ClaI P13181 GAL2 S. cerevisiae 3, 38 Introns, Synthesized by Blue Heron Biotechnology EY220 EY221 EY194 EY208 EY159...”
- Optimizing pentose utilization in yeast: the need for novel tools and approaches
Young, Biotechnology for biofuels 2010 - “...TMB3201 - Saccharomyces cerevisiae HXT15 P54854 p4H7 [ 64 ] TMB3201 - Saccharomyces cerevisiae GAL2 P13181 pHL125 [ 64 ] TMB3201 + Several previous studies have evaluated the capacity of selected transport proteins to uptake xylose in yeast. The strain genotype (described in Table 2) used...”
- Major facilitator superfamily
Pao, Microbiology and molecular biology reviews : MMBR 1998 - “...687 555 540 486 457 602 818 569 S59368 P13181 L21753 P49374 P32465 P23585 P32466 P32467 P38695 P39003 P39004 P40886 P43581 P40885 P39924 P42833 P47185 Z71687...”
- “...Th2A of Trypanosoma brucei P37021 P09830 P09098 P21906 P43581 P13181 P11636 P30605 P07921 P15685 S59368 Q07647 U11843 P15686 Q02563 X78855 Q06222 SP SP SP SP SP...”
- Identification of a glucose-insensitive variant of Gal2 from Saccharomyces cerevisiae exhibiting a high pentose transport capacity.
Rojas, Scientific reports 2021 - GeneRIF: Identification of a glucose-insensitive variant of Gal2 from Saccharomyces cerevisiae exhibiting a high pentose transport capacity.
- The regulatory roles of the galactose permease and kinase in the induction response of the GAL network in Saccharomyces cerevisiae.
Hawkins, The Journal of biological chemistry 2006 (PubMed)- GeneRIF: The roles of GAL1 and GAL2 in the activation of the galactose metabolism network of S. cerevisiae are reported.
- The ubiquitin ligase SCF(Grr1) is required for Gal2p degradation in the yeast Saccharomyces cerevisiae.
Horak, Biochemical and biophysical research communications 2005 (PubMed)- GeneRIF: In this study, we show that the other components of SCF(Grr1), including Skp1, Rbx1p, and the ubiquitin-conjugating enzyme Cdc34, are also necessary for glucose-induced Gal2p degradation.
- Phenotypic selection during laboratory evolution of yeast populations leads to a genome-wide sustainable chromatin compaction shift
Moreno, Frontiers in microbiology 2022 - “...alanine tRNA, five of them code for uncharacterized or dubious ORFs (YFL063W, YHR217C, YLL066W-B, YLL065W, YLR081W, and YML122C), and the last one for the plasma membrane permease GIT1 which mediates uptake of glycerophosphoinositol and glycerophosphocholine. Between day10 and day28, during which no selection pressure was applied,...”
- Yeast Double Transporter Gene Deletion Library for Identification of Xenobiotic Carriers in Low or High Throughput
Almeida, mBio 2021 - “...YJL214W, YJR040W, YJR054W, YJR152W, YKL174C, YKL217W, YKR039W, YKR050W, YKR103W, YKR106W, YLL028W, YLL043W, YLL048C, YLL052C, YLL061W, YLR081W, YLR092W, YLR130C, YLR138W, YLR237W, YML047C, YML116W, YML123C, YMR011W, YMR177W, YMR243C, YMR279C, YMR319C, YNL065W, YNL142W, YNL268W, YNL270C, YNL275W, YNL291C, YNL318C, YNR002C, YNR055C, YNR056C, YNR072W, YOL020W, YOL103W, YOL122C, YOL158C, YOR011W, YOR071C, YOR153W,...”
- Improved Xylose Metabolism by a CYC8 Mutant of Saccharomyces cerevisiae
Nijland, Applied and environmental microbiology 2017 - “...YHR096C YHR094C YJL214W YDL245C YJR158W YEL069C YFL011W YJL219W YOL156W YLR081W YNL318C Sum of all HXTs Sum of all genes Gene HXT2 HXT36 HXT7 HXT4 HXT5 HXT1...”
- Extensive Copy Number Variation in Fermentation-Related Genes Among Saccharomyces cerevisiae Wine Strains
Steenwyk, G3 (Bethesda, Md.) 2017 - “...), we also examined the absolute CN of all other 10 members ( GAL2 / YLR081W , HXT1 / YHR094C , HXT2 / YMR011W , HXT4 / YHR092C , HXT5 / YHR096C , HXT8 / YJL214W , HXT10 / YFL011W , HXT16 / YJR158W , RGT2...”
- Multiplexed gene control reveals rapid mRNA turnover
Baudrimont, Science advances 2017 - “...endogenous, substitutional, and insertional promoters. ( B ) Time course of the decay of the YLR081W ( GAL2 ) mRNA driven by its endogenous promoter (shut down by galactose removal; t 1/2 = 2.6 min) or driven by the substitutional promoter ( t 1/2 = 2.6...”
- Genetic basis of the highly efficient yeast Kluyveromyces marxianus: complete genome sequence and transcriptome analyses
Lertwattanasakul, Biotechnology for biofuels 2015 - “...of amino acid sequences of sugar transporters are as follows: Ps_HGT2, XP_001382755; Sc_HXT7, NP_010629; Sc_GAL2, NP_013182; Dh_xylhp, AY347871; Ci_GXS1, GN107181; Ci_GXF1, GN107179; Ps_SUT1, XP_001387898; Ps_SUT2, XP_001384295; Ps_SUT3, XP_001386019; Ps_HXT2.4, XP_001387757; Ps_XUT1, XP_001385583; Ps_XUT2, XP_001387242; Ps_XUT3, XP_001387138; Ps_XUT4, XP_001386715; Ps_XUT5, XP_001385962; Ps_XUT6, XP_001386589; Ps_XUT7, XP_001387067; Ps_RGT2, XP_001386588;...”
- Conservation of replication timing reveals global and local regulation of replication origin activity
Müller, Genome research 2012 - “...genome. Second, we noted that one of the genes adjacent to ARS1212 ( GAL2 / YLR081W ) is duplicated in S. bayanus , raising the possibility that ARS1212 is also duplicated (Supplemental Fig. S18). The presence of two close origins could then account for the observed...”
- Positional analyses of BRCA1-dependent expression in Saccharomyces cerevisiae
Skibbens, Cell cycle (Georgetown, Tex.) 2008 - “...Up 14.4041395 Up YBR020W GAL1 76.735115 Up 166.01247 Up YBR019C GAL10 78.75131 Up 53.76265 Up YLR081W GAL2 101.56116 Up 93.95381 Up YPL248C GAL4 36.34818 Up 46.29145 Up YBR018C GAL7 5.330396 Up 4.0937595 Up YDR019C GCV1 2.5090592 Up 2.682127 Up YPR184W GDB1 4.222917 Up 3.8256583 Up YAL062W...”
- More
STP9_ARATH / Q9SX48 Sugar transport protein 9; Hexose transporter 9 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
stp9 / CAC69072.1 STP9 protein from Arabidopsis thaliana (see paper)
AT1G50310 STP9 (SUGAR TRANSPORTER 9); carbohydrate transmembrane transporter/ sugar:hydrogen symporter from Arabidopsis thaliana
25% identity, 54% coverage
- function: Mediates an active uptake of hexoses, probably by sugar/hydrogen symport. Mostly transports glucose, and barely galactose, xylose and mannose.
- Exploration of Sugar and Starch Metabolic Pathway Crucial for Pollen Fertility in Rice
Lee, International journal of molecular sciences 2022 - “...the hexose transporters resulted in male sterility. A T-DNA insertion mutant of Arabidopsis AtSTP9 ( At1g50310 ), a monosaccharide transporter that is expressed specifically in pollen, was not male-sterile [ 20 ]. A group of SWEET efflux transporters is also involved in the capability of transporting...”
- Rho GTPase ROP1 Interactome Analysis Reveals Novel ROP1-Associated Pathways for Pollen Tube Polar Growth in Arabidopsis
Li, International journal of molecular sciences 2020 - “...transporters were found for transmembrane trafficking of nutrients and energy, such as STP4&STP9 (AT3G19930 and AT1G50310) for sucrose and AT1G71680 for amino acids. 3.4. ROP1 Signaling and Endocytosis Exocytosis of secretory vesicles is critical for pollen tube expansion by supplying membrane, cell wall components, and other...”
- Plant glucose transporter structure and function
Geiger, Pflugers Archiv : European journal of physiology 2020 - “...and ovules Plasma membrane Glucose, galactose, mannose, arabinose High [ 122 , 123 ] AtSTP9 At1g50310 Fully developed pollen grain Plasma membrane Glucose, galactose, arabinose High [ 122 , 131 ] AtSTP10 At3g19940 Germinating pollen and growing pollen Plasma membrane Glucose, galactose, mannose, High [ 109...”
- Genome-Wide Identification and Expression Profiling of Sugar Transporter Protein (STP) Family Genes in Cabbage (Brassica oleracea var. capitata L.) Reveals their Involvement in Clubroot Disease Responses
Zhang, Genes 2019 - “...Bol000550 Scaffold000531 MF1 1545 514 56.99 8.99 38.20 102.80 0.56 cell membrane tPCK1 C AtSTP9 AT1G50310 1554 517 BoSTP9a Bol010165 C07 LF 1551 516 56.27 6.89 32.15 99.01 0.53 cell membrane BoSTP9b Bol014014 Scaffold000180 MF2 1551 516 56.15 6.89 33.77 101.67 0.54 cell membrane tPCK2 F...”
- Modulation of Auxin Levels in Pollen Grains Affects Stamen Development and Anther Dehiscence in Arabidopsis
Salinas-Grenet, International journal of molecular sciences 2018 - “...STP2 , At1g07340), intermediate pollen promoter 1 (from the sugar transporter 9 gene, STP9 , At1g50310), intermediate pollen promoter 2 (from the pollen-specific gene 2 gene, PSG2 , At1g28550), and late pollen promoter (from the phosphatase and tensin homolog deleted on chromosome 10 gene, PTEN1 ,...”
- Analysis of miRNAs and their targets during adventitious shoot organogenesis of Acacia crassicarpa
Liu, PloS one 2014 - “...superfamily protein MIR2592 AT4G11040 3 Protein phosphatase 2C family protein MIR2916 AT1G15780 3 unknown protein AT1G50310 3 sugar transporter 9 AT1G65875 3 pseudogene AT1G66120 3 AMP-dependent synthetase and ligase family protein AT4G00450 3 RNA polymerase II transcription mediators AT5G66710 3 Protein kinase superfamily protein MIR4414 AT2G04860...”
- The pectin lyases in Arabidopsis thaliana: evolution, selection and expression profiles
Cao, PloS one 2012 - “...AT1G23460 had 36 ( Table S3 ). Some of these interacting genes include AtSTP9 ( AT1G50310 ), IRT1 ( AT5G43370 ), AT3G09820 ( ADK1 , adenosine kinase 1), LOS2 ( AT2G36530 ), and flagellin-sensitive 2 ( FLS2 , AT5G46330 ). AtSTP9 encodes a member of sugar...”
- Proline is required for male gametophyte development in Arabidopsis
Mattioli, BMC plant biology 2012 - “...is high at tricellular stage and low in mature pollen [ 35 ] and AtSTP9 (AT1G50310), whose gene product can only be detected by immunofluorescence microscopy after the onset of germination [ 36 ]. In addition, as above stated, high levels of expression of either P5CS1...”
- More
Q1EG32 Putative xylose permease from Hypocrea jecorina
26% identity, 54% coverage
TC 2.A.1.1.42 / Q8G3X1 The D-glucose:H+ symporter, GlcP (glucose uptake is inhibited by 2-deoxyglucose, mannose and galactose) from Bifidobacterium longum (see paper)
BL1631 D-Glucose-proton symporter from Bifidobacterium longum NCC2705
29% identity, 53% coverage
- substrates: D-glucose, H+
- The Pleiotropic Effects of Carbohydrate-Mediated Growth Rate Modifications in Bifidobacterium longum NCC 2705
Duboux, Microorganisms 2023 - “...(bifid-shunt). It revealed that growth on glucose induced the expression of glucose import systems ( Bl1631 (MFS) and BL1633 (part of PTS)), enzymes involved in glucose-6-phosphate conversion ( BL1631 ; 6PGL ), pyruvate and acetate formation ( BL0707 ( pgk ) and BL1124 ( aldH )),...”
- “...malE )), channeling of galactose and glucose into the bifid-shunt ( BL1630 ( pgm ), BL1631 ( pgm ), BL0279 ( pgi )). Notably, two of the MalR1 target loci were induced when the strain was grown on glucose, i.e., genes involved in metabolization of amylose...”
- Preferential sugar utilization by bifidobacterial species
Murakami, Microbiome research reports 2023 - “...we investigated the homolog distribution of the glcP , ptsG , and licT gene cluster (BL1631, BL1632, and BL1633 in B. longum NCC2705), which are reportedly involved in the preferential utilization of lactose in NCC2705 [ 20 ] . Of the 40 isolates, 12 strains had...”
- Carbohydrate-controlled serine protease inhibitor (serpin) production in Bifidobacterium longum subsp. longum
Duboux, Scientific reports 2021 - “...glucose in the environment. In B. longum NCC 2705, the glucose/mannose transporter protein (encoded by BL1631; glcP) is involved in galactose import 8 . This protein was demonstrated to have the highest specificity for glucose followed by mannose and galactose 23 , which could explain why...”
- “...to have a higher affinity to the Major Facilitator Superfamily (MFS) transport protein glcP protein (BL1631). As well, presence of glucose in the cell has been previously shown to inhibit the production of the ATP-binding cassette transporters (ABC) encoded by the genes located in the operon...”
- Lactose-over-glucose preference in Bifidobacterium longum NCC2705: glcP, encoding a glucose transporter, is subject to lactose repression
Parche, Journal of bacteriology 2006 - “...Gene Accession number Primer pair BL1631 ( glcP) AAN25419 BL1631-F1, GCAACGCCTTCAAAGTGCTT BL1631-R1, TGCACCTGGGTCTGATCCA AAN25418 BL1630-F1, TCAAGCGTGTGCCCTACGA...”
- “...repressed by lactose and probably induced by glucose. BL1631 expression is mediated by lactose. Comparative analysis of gene expression using genome-wide DNA...”
XP_444860 hypothetical protein from Candida glabrata CBS 138
26% identity, 60% coverage
An02g00590 uncharacterized protein from Aspergillus niger
28% identity, 53% coverage
XP_006237358 solute carrier family 2, facilitated glucose transporter member 3 isoform X1 from Rattus norvegicus
27% identity, 51% coverage
- Fructose-rich diet and walnut supplementation differently regulate rat hypothalamic and hippocampal glucose transporters expression.
Dakic, Journal of the science of food and agriculture 2021 (PubMed)- GeneRIF: Fructose-rich diet and walnut supplementation differently regulate rat hypothalamic and hippocampal glucose transporters expression.
- Aging alters glucose uptake in the naïve and injured rodent spinal cord.
von, Neuroscience letters 2019 - GeneRIF: findings show that age alters glucose uptake and GLUT3/4 expression profiles before and after Spinal Cord Injury.
- Altered lactate metabolism in Huntington's disease is dependent on GLUT3 expression.
Solís-Maldonado, CNS neuroscience & therapeutics 2018 - GeneRIF: Study found no differences in mRNA or protein levels of neuronal monocarboxylate transporters (MCTs). Functional analyses revealed that neuronal MCT2 had high catalytic efficiency in Huntington's disease (HD) cells. Ascorbic acid did not stimulate lactate uptake in HD cells; and was unable to inhibit glucose transport in HD cells because they exhibit decreased expression of the neuronal glucose transporter GLUT3.
- Chronic stress modulates regional cerebral glucose transporter expression in an age-specific and sexually-dimorphic manner.
Kelly, Physiology & behavior 2014 - GeneRIF: Hippocampal mRNA abundance of GLUT3 decreases with age in males and females
- Extracellular ATP-prinoceptor signaling and AMP-activated protein kinase regulate astrocytic glucose transporter 3 in an in vitro ischemia.
Iwabuchi, Neurochemistry international 2013 (PubMed)- GeneRIF: results suggest AMPK-regulated ATP production triggers the release of ATP to activate P2Y receptor signaling, which is another candidate that regulates GLUT3 expression under the ischemic condition
- IGF-1 induces hypoxia-inducible factor 1α-mediated GLUT3 expression through PI3K/Akt/mTOR dependent pathways in PC12 cells.
Yu, Brain research 2012 (PubMed)- GeneRIF: Expression of GLUT3 in response to IGF-1 is dependent on phosphatidylinositol (PI)-3-kinase and mTOR activity and requires transcription factor HIF-1alpha in neuronal PC12 cells.
- Triiodothyronine stimulates glucose transport in bone cells.
Zoidis, Endocrine 2012 (PubMed)- GeneRIF: Data suggest that triiodothyronine (T3) up-regulates Glut1 and Glut3 in osteoblasts; thus, increased glucose uptake induced by T3 may be mediated by these high-affinity glucose transporters.
- The expression of genes involved in glucose metabolism is affected by N-methyl-D-aspartate receptor antagonism: a putative link between metabolism and an animal model of psychosis.
Iasevoli, Journal of neuroscience research 2012 (PubMed)- GeneRIF: The results show that Hk1 and GLUT3 may play a role in the pathophysiology of ketamine-induced behavioral abnormalities.
- More
LOC102620675 sugar transport protein 13 from Citrus sinensis
29% identity, 56% coverage
- Plant volatile-triggered defense in citrus against biotic stressors
Pérez-Hedo, Frontiers in plant science 2024 - “...synthesis proteins for sugar synthesis during photosynthesis and the sugar transport proteins like STP13 ( LOC102620675 ). Genes associated with cell wall synthesis, including cellulose synthase A ( CSLG3 ) ( LOC102624770 ), expansin-B1 ( Ptrif.0004s1042 ), extensin-2 ( LOC102608242 ), extensin-3 ( LOC102627738 ), and...”
CNAG_05662 sugar transporter from Cryptococcus neoformans var. grubii H99
28% identity, 54% coverage
- Single nucleotide polymorphisms are associated with strain-specific virulence differences among clinical isolates of Cryptococcus neoformans
Jackson, Nature communications 2024 - “...14 CNAG_05664 Upstream of coding region Branched-chain-amino-acid transaminase Inositol sensing and metabolism 14 ITR4 ( CNAG_05662 ) Downstream of coding region Membrane bound inositol signaler 4 CNAG_05329 Upstream of coding region myo -inositol 2-dehydrogenase Enzyme regulator 5 CNAG_01241 Upstream of coding region Enzyme regulator; putative role...”
- Deciphering the Association among Pathogenicity, Production and Polymorphisms of Capsule/Melanin in Clinical Isolates of Cryptococcus neoformans var. grubii VNI
Vélez, Journal of fungi (Basel, Switzerland) 2022 - “..., OVA1 and ROM2 ). The gene encoding the polyol transporter protein PTP1 (with identifier CNAG_05662 or its synonym ITR4 ) is involved in functions such as proliferation, cell differentiation, programmed cell-death and stress responses [ 71 , 72 ]. In the present investigation, non-synonymous variants...”
- Identification of Pathogen Genomic Differences That Impact Human Immune Response and Disease during Cryptococcus neoformans Infection
Gerstein, mBio 2019 - “...encodes APP1, a cytoplasmic protein involved in extracellular secretion and reduced phagocytosis ( 28 ); CNAG_05662 encodes ITR4, a protein involved in transport or sensing of 5-carbon and 6-carbon sugar alcohols (e.g., inositol, mannitol, sorbitol) ( 29 31 ); and CNAG_05663 encodes SCW1, a protein with...”
- “...NS 0.024 0.142 CNAG_05661 14 908850 Upstream 0.042 0.928 CNAG_05663 14 910328 Downstream 0.042 0.12 CNAG_05662 14 911099 Downstream 0.045 0.143 14 911129 Downstream 0.048 0.046 10.1128/mBio.01440-19.2 FIGS2 PCA. (A) Each dashed line represents 1 of 20 randomized trials. (B) There was no association between PC1...”
- Role of the inositol pyrophosphate multikinase Kcs1 in Cryptococcus inositol metabolism
Liao, Fungal genetics and biology : FG & B 2018 - “...ITR3 1.55892 1.44987 CNAG_00867 ITR3A 3.68902 1.60298 CNAG_05667 ITR3B 3.80998 1.60194 CNAG_05381 ITR3C 30.5358 25.8554 CNAG_05662 ITR4 12.4597 13.8718 CNAG_04024 ITR5 1.07981 1.62615 CNAG_03910 ITR6 1.07981 1.62615 Inositol biosynthesis CNAG_01539 INO1 4.21058 5.1748 CNAG_01823 INM1 1.12981 1.21511 CNAG_03262 INM2 1.44061 1.21405 Inositol metabolism CNAG_05384 PIS1 1.24315...”
- Cryptococcus neoformans can form titan-like cells in vitro in response to multiple signals
Trevijano-Contador, PLoS pathogens 2018 - “...polymerase II promoters. In the former category there were included diverse sugar transporters (CNAG_01862, CNAG_02733, CNAG_05662, CNAG_06292, and CNAG_06932), plus a likely glycerol proton symporter similar to budding yeast Stl1 (CNAG_04784). The latter category contained 14 putative transcription factors, most of them belonging to the zinc...”
- “...TPO3 family) 0.2 5.3E-04 0.5 4.4E-02 CNAG_04818 MFS monocarboxylate transporter, putative 0.1 2.2E-02 0.2 2.4E-02 CNAG_05662 hexose transporter ( HXT8 , HXT13 , HXT17 family) 0.1 1.2E-02 0.3 2.2E-02 CNAG_05867 L-fucose permease, putative 0.2 0.2 1.1E-05 CNAG_05992 Allantoate permease 0.1 0.0 1.9E-02 CNAG_06102 ADP,ATP carrier protein,...”
- A Wor1-Like Transcription Factor Is Essential for Virulence of Cryptococcus neoformans
Paes, Frontiers in cellular and infection microbiology 2018 - “...0.0017488 CNAG_01611 LIV8 required for lung infection, unknown activity Chr_11 412787 415620 + 1.17352 0.0017488 CNAG_05662 ITR4 sugar transporter Chr_14 908236 910766 + GO:0022857, GO:0005575 1.1498 0.0017488 CNAG_02899 Hypothetical protein Chr_03 500229 501212 + GO:0005622 1.18091 0.0017488 CNAG_05079 Hypothetical protein Chr_04 381088 381903 1.42738 0.0017488 CNAG_05265...”
- Galectin-3 impacts Cryptococcus neoformans infection through direct antifungal effects
Almeida, Nature communications 2017 - “...symporter XM_012194171.1 5.91 0.0000 0.0 2.4 CNAG_06812 Phospholipase D, variant XM_012198528.1 5.45 0.0000 11.7 513.7 CNAG_05662 Sugar transporter XM_012191199.1 4.87 0.0000 4.8 142.9 CNAG_00183 Alternative cyclin Pcl12, variant XM_012191495.1 4.66 0.0407 1.3 33.0 CNAG_00680 Kinetochore protein Nuf2, variant XM_012191826.1 4.39 0.0000 3.9 81.8 CNAG_03772 Glucose transporter...”
- The transcriptional response of Cryptococcus neoformans to ingestion by Acanthamoeba castellanii and macrophages provides insights into the evolutionary adaptation to the mammalian host
Derengowski, Eukaryotic cell 2013 - “...groups, we focused on open reading frame (ORF) CNAG_05662, which was potentially related to sugar transport but had no determined biological function. To...”
- “...mutant and the ptp1::ptp1 complemented strains for the CNAG_05662 open reading frame (ORF). We also used the D1307 mutant strain depleted for the CNAG_05662...”
- More
CNAG_05340 monosaccharide transporter from Cryptococcus neoformans var. grubii H99
27% identity, 54% coverage
- RELATe enables genome-scale engineering in fungal genomics
Li, Science advances 2020 - “...strains (CNAG_02878, CNAG_04469, CNAG_04501, CNAG_05908, CNAG_06873, CNAG_06920, CNAG_01150, CNAG_02553, CNAG_03177, CNAG_00531, CNAG_03764, CNAG_00876, CNAG_03102, and CNAG_05340) were incorrect based on restriction fragments (table S3). Of the 68 deletion strains verified by diagnostic PCR, 4 deletion strains (CNAG_00467, CNAG_01536, CNAG_02490, and CNAG_05404) showed growth defect at host...”
- Transmembrane transporter expression regulated by the glucosylceramide pathway in Cryptococcus neoformans
Singh, BMC research notes 2015 - “...in gene expression. All the six genes we identified, viz siderochrome-iron transporter (CNAG_02083), monosaccharide transporter (CNAG_05340), glucose transporter (CNAG_03772), membrane protein (CNAG_03912), membrane transport protein (CNAG_00539), and sugar transporter (CNAG_06963), are membrane-localized and have significantly altered gene expression levels. Therefore, we hypothesize that these genes function...”
- “...5-GGTTTGCAAGGATTGATGCTTATC-3, reverse: 5-GTACGGTGGGTCAGAAAGGA-3; CNAG_00539 (Membrane-transport-protein), forward: 5-ACGCCGATGGATTATTACTAGC-3, reverse: 5-CGACCTAGCAGTTCCGAAAG-3; CNAG_06963 (Sugar-transporter), forward: 5-TGGTCCTATCGGTGACTACTCT-3, reverse: 5-GCCAACTTGAGACACAAGCA-3; CNAG_05340 (Monosaccharide-transporter), forward: 5-AGGGATCGTTAGCTTTTGGTATG-3, reverse: 5-GGAAAATTGTTCGAGGACGA-3; CNAG_03772 (Glucose-transporter), forward: 5-GGACTGGTGTCAACTTCATTTTC-3, reverse: 5-CGACACCAATGATACCGACA-3; CNAG_00334 (Heat-shock-protein), forward: 5-GAGTCGAGATCATCGCCAAC-3, reverse: 5-TTAACGTCAGCGTCGTCGTA-3; CNAG_03780 (Prcdna95), forward: 5-AAGGGTGTCGTTGCCTTCTAC-3, reverse: 5-ATAGCCAAAACCCTCCATCC-3; CNAG_00092 (Mitochondrial-protein), forward: 5-GACCCAAGACCATCTTCTTCT-3, reverse: 5-GCAGCGAGGGAGTAGTTGAC-3; CNAG_01307...”
MST4_ORYSJ / Q10PW9 Sugar transport protein MST4; Monosaccharide transporter 4; OsMST4; Sugar:proton symporter MST4 from Oryza sativa subsp. japonica (Rice) (see 2 papers)
28% identity, 54% coverage
- function: Mediates active uptake of hexoses by sugar:proton symport (Probable). Can transport glucose, fructose, mannose and galactose (PubMed:17874189, PubMed:18506478). Can transport xylose and ribose (PubMed:18506478).
Q9ZR63 Hexose transporter from Vitis vinifera
28% identity, 52% coverage
- Transcriptomic and metabolite analyses of Cabernet Sauvignon grape berry development
Deluc, BMC genomics 2007 - “...3 2.45 1618277_at CF568829 TC56963 Q8VWN9 Glyceraldehyde-3-phosphate dehydrogenase Phosphate Metabolism 21 2.22 1616083_at CB009608 TC51694 Q9ZR63 Hexose transporter (VvHT1) Transport 2 12.37 1610527_at CA815926 TC52979 Q84QH3 Sorbitol transporter Transport 2 5.49 1615257_at CB972713 TC65400 Q4U339 Hexose transporter (VvHT6) Transport 15 4.7 1619691_at CF211807 TC62520 Q4U339 Hexose...”
BT_3606 sugar-proton symporter from Bacteroides thetaiotaomicron VPI-5482
27% identity, 53% coverage
VDAG_05443 galactose transporter from Verticillium dahliae VdLs.17
26% identity, 58% coverage
TC 2.A.1.1.51 / Q2MEV7 Glucose/xylose: H+ symporter, Gsx1 from Candida intermedia (see paper)
GXS1 / CAI44932.1 glucose/xylose symporter 1 from [Candida] intermedia (see paper)
29% identity, 55% coverage
- substrates: H+, Xylose, glucose
- Advances in fungal sugar transporters: unlocking the potential of second-generation bioethanol production.
Pereira, Applied microbiology and biotechnology 2025 - “...C. intermedia Leandro et al. ( 2006 ); Young et al. ( 2011 ) GXS1 Q2MEV7 Glucose, xylose, galactose, fructose, mannose, and ribose C. intermedia Leandro et al. ( 2006 ); Young et al. ( 2011 ) XylHP Q64L87 Glucose, xylose, galactose, fructose, and mannose D....”
- Optimizing pentose utilization in yeast: the need for novel tools and approaches.
Young, Biotechnology for biofuels 2010 - “...TMB3201 - Candida intermedia Gxf1 Q2MDH1 YEplac195 [ 72 ] TMB3201 + Candida intermedia Gxs1 Q2MEV7 YEplac195 [ 72 ] TMB3201 + Chlorella kessleri Hup1 P15686 p4H7 [ 64 ] TMB3201 - Escherichia coli XylE P0AGF4 p4H7 [ 64 ] TMB3201 - Pichia stipitis SUT1 O94155...”
BBMN68_1664 sugar porter family MFS transporter from Bifidobacterium longum subsp. longum BBMN68
29% identity, 53% coverage
- Mechanism analysis of acid tolerance response of bifidobacterium longum subsp. longum BBMN 68 by gene expression profile using RNA-sequencing
Jin, PloS one 2012 - “...major facilitator superfamily proteins (MFS), which allow glucose to be symported with H + . BBMN68_1664 encoding the D-glucose-H + symporter (GlcP), one member of the putative permeases of the MFS in BBMN68, was found to have been upregulated by 2.17 fold ( Table S2 )....”
- Complete genome sequence of Bifidobacterium longum subsp. longum BBMN68, a new strain from a healthy chinese centenarian
Hao, Journal of bacteriology 2011 - “...(BBMN68_1004, BBMN68_1297) and sugar efflux (BBMN68_78, BBMN68_188, BBMN68_1664, BBMN68_1684) were found in the genome. A gene encoding a serine protease...”
FGSG_02641 hypothetical protein from Fusarium graminearum PH-1
28% identity, 53% coverage
E2C2M2 Glucose transporter type 1 from Harpegnathos saltator
31% identity, 35% coverage
- A proteomic insight into the midgut proteome of Ornithodoros moubata females reveals novel information on blood digestion in argasid ticks.
Oleaga, Parasites & vectors 2017 - “...Another important protein in using glucose as an energy source is the glucose transporter 1 (E2C2M2), also identified in the transcriptome, which would be responsible for transporting blood glucose from the intestinal lumen to the inside of the enterocytes (Table 4 ). Table 4 Proteins involved...”
- “...(T) 0.13 Hydrolase activity Unfed EST_Acari A0A0B1PR88 Glucose-6-phosphate isomerase (T) 0.35 Isomerase activity Unfed mRNA_Om E2C2M2 Glucose transporter type 1 (T) 0.08 Carbohydrate transporter activity Fed mRNA_Om A0A087UZ87 ADP-dependent glucokinase (T) 0.05 Transferase activity Fed mRNA_Om Q7Q4V0 AGAP000862-PA (T) 0.24 Hydrolase activity Fed mRNA_Om B7PE53 Beta-hexosaminidase...”
GTR3_RAT / Q07647 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Rattus norvegicus (Rat) (see 3 papers)
TC 2.A.1.1.12 / Q07647 Glucose uniporter, Glut3 (also transports dehydro-ascorbate; Maulén et al., 2003). Down-regulated in the brains of Alzheimer's disease patients (Liu et al., 2008b) from Rattus norvegicus (Rat) (see 2 papers)
27% identity, 51% coverage
- function: Facilitative glucose transporter. Can also mediate the uptake of various other monosaccharides across the cell membrane. Mediates the uptake of glucose, 2-deoxyglucose, galactose, mannose, xylose and fucose, and probably also dehydroascorbate. Does not mediate fructose transport. Required for mesendoderm differentiation (By similarity).
catalytic activity: D-glucose(out) = D-glucose(in) (RHEA:60376)
catalytic activity: D-galactose(in) = D-galactose(out) (RHEA:34915)
subunit: Interacts with SMIM43; the interaction may promote SLC2A3- mediated glucose transport to meet the energy needs of mesendoderm differentiation. - substrates: glucose
tcdb comment: The structure of the human orthologue with D-glucose bound was solved at 1.5 Å resolution in the outward occluded conformation (Deng et al. 2015). Sugars are predominantly coordinated by polar residues in the C-terminal domain. The conformational transition from the outward-open to the outward-occluded states entails a prominent local rearrangement of the extracellular part of TMS 7. Comparison of the outward-facing GLUT3 structures with inward-open GLUT1 provides insight into the alternating access cycle for GLUTs, whereby the C-terminal domain provides the primary substrate-binding site and the N-terminal domain undergoes rigid-body rotation with respect to the C-terminal domain (Deng et al. 2015). Glut3 is involved in several disease states in humans (Lechermeier et al. 2019) - Proteomic investigation of acute and chronic hypoxia/reoxygenation responsive proteins and pathways in H9C2 cardiomyoblasts
Öztuğ, Turkish journal of biology = Turk biyoloji dergisi 2024 - “...alpha 1.56564E-16 O55043 Rho guanine nucleotide exchange factor 7 1.69661E-06 Q63433 Serine/threonine-protein kinase N1 8.76119E-12 Q07647 Solute carrier family 2, facilitated glucose transporter member 3 6.61577E-08 Q2M2R8 Peroxisomal targeting signal 1 receptor 4.86371E-05 Q9Z2J4 Nexilin 1.56564E-16 Q7TP54 Rho family-interacting cell polarization regulator 2 1.1613E-06 D4ACN8 Plasminogen...”
- Major facilitator superfamily
Pao, Microbiology and molecular biology reviews : MMBR 1998 - “...P11168 P14246 P12336 P47842 P28568 P11169 P32037 P47843 Q07647 P14672 P14142 P19357 P22732 P46408 P43427 Q00712 B30310 U39197 U29377 U43375 U52842 Z46381 L27651...”
- “...P37021 P09830 P09098 P21906 P43581 P13181 P11636 P30605 P07921 P15685 S59368 Q07647 U11843 P15686 Q02563 X78855 Q06222 SP SP SP SP SP SP SP SP SP SP PIR SP GB...”
LOC7486368 sugar transport protein 10 from Populus trichocarpa
26% identity, 60% coverage
- The genetic architecture of trait covariation in Populus euphratica, a desert tree
Lu, Frontiers in plant science 2023 - “...is active in mitochondria, organelle envelope and cytoplasm. Q2345(nn_np_11278, Linkage Group 4) is homologous with LOC7486368, the gene encoding sugar transport protein (STP) 10 in Poplus tricocarpa . STP is a plant-specific transport protein, which is responsible for absorbing glucose from the apoplast into plant cells....”
HGT19 potential myo-inositol transporter from Candida albicans (see paper)
28% identity, 41% coverage
- CharProtDB CGD description: Putative glucose/myo-inositol transporter of major facilitator superfamily; 12 transmembrane segments, extended N terminus; expressed in rich medium, 2% glucose; phagocytosis-induced; C. albicans glucose transporter family has 20 members
MSMEG_5559 metabolite/sugar transport protein from Mycobacterium smegmatis str. MC2 155
27% identity, 54% coverage
- Azido Inositol Probes Enable Metabolic Labeling of Inositol-Containing Glycans and Reveal an Inositol Importer in Mycobacteria
Hodges, ACS chemical biology 2023 - “...on their similarity to known inositol importer genes, including MSMEG_5166 , MSMEG_0190 , MSMEG_5161 , MSMEG_5559 , and MSMEG_4462 . We found that when silenced, these genes did not prevent growth on 1 mM inositol in the presence of ATc, indicating that these genes are unlikely...”
- Characterization of Mycobacterium smegmatis sigF mutant and its regulon: overexpression of SigF antagonist (MSMEG_1803) in M. smegmatis mimics sigF mutant phenotype, loss of pigmentation, and sensitivity to oxidative stress
Singh, MicrobiologyOpen 2015 - “...2.22/0.91 MSMEG_5343 a Conserved hypothetical protein 3.09/1.07 GTTTN 16 GGCTA 35 MSMEG_5374 Glutamateammonia ligase 2.22/0.03 MSMEG_5559 Metabolite/sugar transport protein 2.83/0.35 GTTTN 16 GGGTA 39 MSMEG_5623 Lcarnitine dehydratase 3.24/1.20 GTTCN 15 GGGCA 51 MSMEG_5731 Transcriptional regulator, GntR family 2.31/0.25 GTCTN 18 GGGAT 785 MSMEG_6507 Glycogen debranching enzyme...”
- The SigF regulon in Mycobacterium smegmatis reveals roles in adaptation to stationary phase, heat, and oxidative stress
Hümpel, Journal of bacteriology 2010 - “...MSMEG_4737 MSMEG_5011 MSMEG_5376 MSMEG_5434 MSMEG_5499 MSMEG_5559 MSMEG_5580d MSMEG_5754 MSMEG_5773 MSMEG_5872 MSMEG_5907 MSMEG_6091 MSMEG_6199 MSMEG_6427...”
- A genomic view of sugar transport in Mycobacterium smegmatis and Mycobacterium tuberculosis
Titgemeyer, Journal of bacteriology 2007 - “...found four homologs (msmeg_2966, msmeg_4098, msmeg_4182, and msmeg_5559), of which msmeg_4182 exhibited 53% identity to glucose symporters (Fig. 2). msmeg_4182...”
MAA_02403 hexose transporter from Metarhizium robertsii ARSEF 23
25% identity, 57% coverage
- Carbon translocation from a plant to an insect-pathogenic endophytic fungus
Behie, Nature communications 2017 - “...MST2 during plant root colonization 25 . Metarhizium has three identified monosaccharide transporters (accession numbers: MAA_02403, MAA_03088, MAA_07773), and while these transporters have not been characterized in terms of specific function or location, BLAST analyses show sequence identities with sugar transporters in other root colonizing fungi...”
FTN_1079 sugar porter (SP) family from Francisella tularensis subsp. novicida U112
27% identity, 54% coverage
- Genotype-phenotype associations in a nonmodel prokaryote
Enstrom, mBio 2012 - “...Three additional gene functions were needed for growth on N -acetylglucosamine: a predicted sugar porter, FTN_1079 (here named nagP ), glucokinase ( glk ), and a putative transaminase, FTN_1080 ( nagB ). The FTN_1080 ( nagB ) product was annotated as a phosphosugar-binding protein and appears...”
XAC1777 MFS transporter from Xanthomonas axonopodis pv. citri str. 306
26% identity, 57% coverage
GTR3_RABIT / Q9XSC2 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Oryctolagus cuniculus (Rabbit) (see paper)
28% identity, 53% coverage
- function: Facilitative glucose transporter. Can also mediate the uptake of various other monosaccharides across the cell membrane. Mediates the uptake of glucose, 2-deoxyglucose, galactose, mannose, xylose and fucose, and probably also dehydroascorbate. Does not mediate fructose transport. Required for mesendoderm differentiation (By similarity).
catalytic activity: D-glucose(out) = D-glucose(in) (RHEA:60376)
catalytic activity: D-galactose(in) = D-galactose(out) (RHEA:34915)
subunit: Interacts with SMIM43; the interaction may promote SLC2A3- mediated glucose transport to meet the energy needs of mesendoderm differentiation.
For advice on how to use these tools together, see
Interactive tools for functional annotation of bacterial genomes.
The PaperBLAST database links 793,807 different protein sequences to 1,259,118 scientific articles. Searches against EuropePMC were last performed on March 13 2025.
PaperBLAST builds a database of protein sequences that are linked
to scientific articles. These links come from automated text searches
against the articles in EuropePMC
and from manually-curated information from GeneRIF, UniProtKB/Swiss-Prot,
BRENDA,
CAZy (as made available by dbCAN),
BioLiP,
CharProtDB,
MetaCyc,
EcoCyc,
TCDB,
REBASE,
the Fitness Browser,
and a subset of the European Nucleotide Archive with the /experiment tag.
Given this database and a protein sequence query,
PaperBLAST uses protein-protein BLAST
to find similar sequences with E < 0.001.
To build the database, we query EuropePMC with locus tags, with RefSeq protein
identifiers, and with UniProt
accessions. We obtain the locus tags from RefSeq or from MicrobesOnline. We use
queries of the form "locus_tag AND genus_name" to try to ensure that
the paper is actually discussing that gene. Because EuropePMC indexes
most recent biomedical papers, even if they are not open access, some
of the links may be to papers that you cannot read or that our
computers cannot read. We query each of these identifiers that
appears in the open access part of EuropePMC, as well as every locus
tag that appears in the 500 most-referenced genomes, so that a gene
may appear in the PaperBLAST results even though none of the papers
that mention it are open access. We also incorporate text-mined links
from EuropePMC that link open access articles to UniProt or RefSeq
identifiers. (This yields some additional links because EuropePMC
uses different heuristics for their text mining than we do.)
For every article that mentions a locus tag, a RefSeq protein
identifier, or a UniProt accession, we try to select one or two
snippets of text that refer to the protein. If we cannot get access to
the full text, we try to select a snippet from the abstract, but
unfortunately, unique identifiers such as locus tags are rarely
provided in abstracts.
PaperBLAST also incorporates manually-curated protein functions:
- Proteins from NCBI's RefSeq are included if a
GeneRIF
entry links the gene to an article in
PubMed®.
GeneRIF also provides a short summary of the article's claim about the
protein, which is shown instead of a snippet.
- Proteins from Swiss-Prot (the curated part of UniProt)
are included if the curators
identified experimental evidence for the protein's function (evidence
code ECO:0000269). For these proteins, the fields of the Swiss-Prot entry that
describe the protein's function are shown (with bold headings).
- Proteins from BRENDA,
a curated database of enzymes, are included if they are linked to a paper in PubMed
and their full sequence is known.
- Every protein from the non-redundant subset of
BioLiP,
a database
of ligand-binding sites and catalytic residues in protein structures, is included. Since BioLiP itself
does not include descriptions of the proteins, those are taken from the
Protein Data Bank.
Descriptions from PDB rely on the original submitter of the
structure and cannot be updated by others, so they may be less reliable.
(For SitesBLAST and Sites on a Tree, we use a larger subset of BioLiP so that every
ligand is represented among a group of structures with similar sequences, but for
PaperBLAST, we use the non-redundant set provided by BioLiP.)
- Every protein from EcoCyc, a curated
database of the proteins in Escherichia coli K-12, is included, regardless
of whether they are characterized or not.
- Proteins from the MetaCyc metabolic pathway database
are included if they are linked to a paper in PubMed and their full sequence is known.
- Proteins from the Transport Classification Database (TCDB)
are included if they have known substrate(s), have reference(s),
and are not described as uncharacterized or putative.
(Some of the references are not visible on the PaperBLAST web site.)
- Every protein from CharProtDB,
a database of experimentally characterized protein annotations, is included.
- Proteins from the CAZy database of carbohydrate-active enzymes
are included if they are associated with an Enzyme Classification number.
Even though CAZy does not provide links from individual protein sequences to papers,
these should all be experimentally-characterized proteins.
- Proteins from the REBASE database
of restriction enzymes are included if they have known specificity.
- Every protein with an evidence-based reannotation (based on mutant phenotypes)
in the Fitness Browser is included.
- Sequence-specific transcription factors (including sigma factors and DNA-binding response regulators)
with experimentally-determined DNA binding sites from the
PRODORIC database of gene regulation in prokaryotes.
- Putative transcription factors from RegPrecise
that have manually-curated predictions for their binding sites. These predictions are based on
conserved putative regulatory sites across genomes that contain similar transcription factors,
so PaperBLAST clusters the TFs at 70% identity and retains just one member of each cluster.
- Coding sequence (CDS) features from the
European Nucleotide Archive (ENA)
are included if the /experiment tag is set (implying that there is experimental evidence for the annotation),
the nucleotide entry links to paper(s) in PubMed,
and the nucleotide entry is from the STD data class
(implying that these are targeted annotated sequences, not from shotgun sequencing).
Also, to filter out genes whose transcription or translation was detected, but whose function
was not studied, nucleotide entries or papers with more than 25 such proteins are excluded.
Descriptions from ENA rely on the original submitter of the
sequence and cannot be updated by others, so they may be less reliable.
Except for GeneRIF and ENA,
the curated entries include a short curated
description of the protein's function.
For entries from BioLiP, the protein's function may not be known beyond binding to the ligand.
Many of these entries also link to articles in PubMed.
For more information see the
PaperBLAST paper (mSystems 2017)
or the code.
You can download PaperBLAST's database here.
Changes to PaperBLAST since the paper was written:
- November 2023: incorporated PRODORIC and RegPrecise. Many PRODORIC entries were not linked to a protein sequence (no UniProt identifier), so we added this information.
- February 2023: BioLiP changed their download format. PaperBLAST now includes their non-redundant subset. SitesBLAST and Sites on a Tree use a larger non-redundant subset that ensures that every ligand is represented within each cluster. This should ensure that every binding site is represented.
- June 2022: incorporated some coding sequences from ENA with the /experiment tag.
- March 2022: incorporated BioLiP.
- April 2020: incorporated TCDB.
- April 2019: EuropePMC now returns table entries in their search results. This has expanded PaperBLAST's database, but most of the new entries are of low relevance, and the resulting snippets are often just lists of locus tags with annotations.
- February 2018: the alignment page reports the conservation of the hit's functional sites (if available from from Swiss-Prot or UniProt)
- January 2018: incorporated BRENDA.
- December 2017: incorporated MetaCyc, CharProtDB, CAZy, REBASE, and the reannotations from the Fitness Browser.
- September 2017: EuropePMC no longer returns some table entries in their search results. This has shrunk PaperBLAST's database, but has also reduced the number of low-relevance hits.
Many of these changes are described in Interactive tools for functional annotation of bacterial genomes.
PaperBLAST cannot provide snippets for many of the papers that are
published in non-open-access journals. This limitation applies even if
the paper is marked as "free" on the publisher's web site and is
available in PubmedCentral or EuropePMC. If a journal that you publish
in is marked as "secret," please consider publishing elsewhere.
Many important articles are missing from PaperBLAST, either because
the article's full text is not in EuropePMC (as for many older
articles), or because the paper does not mention a protein identifier such as a locus tag, or because of PaperBLAST's heuristics. If you notice an
article that characterizes a protein's function but is missing from
PaperBLAST, please notify the curators at UniProt
or add an entry to GeneRIF.
Entries in either of these databases will eventually be incorporated
into PaperBLAST. Note that to add an entry to UniProt, you will need
to find the UniProt identifier for the protein. If the protein is not
already in UniProt, you can ask them to create an entry. To add an
entry to GeneRIF, you will need an NCBI Gene identifier, but
unfortunately many prokaryotic proteins in RefSeq do not have
corresponding Gene identifers.
References
PaperBLAST: Text-mining papers for information about homologs.
M. N. Price and A. P. Arkin (2017). mSystems, 10.1128/mSystems.00039-17.
Europe PMC in 2017.
M. Levchenko et al (2017). Nucleic Acids Research, 10.1093/nar/gkx1005.
Gene indexing: characterization and analysis of NLM's GeneRIFs.
J. A. Mitchell et al (2003). AMIA Annu Symp Proc 2003:460-464.
UniProt: the universal protein knowledgebase.
The UniProt Consortium (2016). Nucleic Acids Research, 10.1093/nar/gkw1099.
BRENDA in 2017: new perspectives and new tools in BRENDA.
S. Placzek et al (2017). Nucleic Acids Research, 10.1093/nar/gkw952.
The EcoCyc database: reflecting new knowledge about Escherichia coli K-12.
I. M. Keeseler et al (2016). Nucleic Acids Research, 10.1093/nar/gkw1003.
The MetaCyc database of metabolic pathways and enzymes.
R. Caspi et al (2018). Nucleic Acids Research, 10.1093/nar/gkx935.
CharProtDB: a database of experimentally characterized protein annotations.
R. Madupu et al (2012). Nucleic Acids Research, 10.1093/nar/gkr1133.
The carbohydrate-active enzymes database (CAZy) in 2013.
V. Lombard et al (2014). Nucleic Acids Research, 10.1093/nar/gkt1178.
The Transporter Classification Database (TCDB): recent advances
M. H. Saier, Jr. et al (2016). Nucleic Acids Research, 10.1093/nar/gkv1103.
REBASE - a database for DNA restriction and modification: enzymes, genes and genomes.
R. J. Roberts et al (2015). Nucleic Acids Research, 10.1093/nar/gku1046.
Deep annotation of protein function across diverse bacteria from mutant phenotypes.
M. N. Price et al (2016). bioRxiv, 10.1101/072470.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory