PaperBLAST

PaperBLAST Hits for SwissProt::Q8NKR9 Fructose-1,6-bisphosphate aldolase/phosphatase; FBP A/P; FBP aldolase/phosphatase; Fructose-1,6-bisphosphatase; FBPase; EC 3.1.3.11; EC 4.1.2.13 (Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Pyrococcus kodakaraensis (strain KOD1))) (375 a.a., MAVGDKITIS...)

Show query sequence

>SwissProt::Q8NKR9 Fructose-1,6-bisphosphate aldolase/phosphatase; FBP A/P; FBP aldolase/phosphatase; Fructose-1,6-bisphosphatase; FBPase; EC 3.1.3.11; EC 4.1.2.13 (Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Pyrococcus kodakaraensis (strain KOD1)))
MAVGDKITISVIKADIGGWPGHSRVHPQLVETAEDVLSKAVEDGTIIDFYVATCGDDLQL
IMTHKRGVDSPDIHGLAWKAFEEATKVAKELGLYGAGQDLLKDAFSGNVRGMGPGVAEME
ITLRKSEPVVTFHMDKTEPGAFNLPIFRMFADPFNTAGLIIDPKMHMGFRFEVWDILEHK
RVILNTPEELYDLLALIGAKSRYVIKRVYPKPGHPIPENEPVAVVSTEKLYEVAGEYVGK
DDPVAIVRAQSGLPALGEVLEPFAFPHLVSGWMRGSHNGPLMPVPMHQANPTRFDGPPRV
VALGWQISPEGKLVGPVDLFDDPAFDYARQKALEITEYMRRHGPFEPHRLPLEEMEYTTL
PGVLKRLTDRFEPIE

Running BLASTp...

Found 26 similar proteins in the literature:

FBPAP_THEKO / Q8NKR9 Fructose-1,6-bisphosphate aldolase/phosphatase; FBP A/P; FBP aldolase/phosphatase; Fructose-1,6-bisphosphatase; FBPase; EC 3.1.3.11; EC 4.1.2.13 from Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Pyrococcus kodakaraensis (strain KOD1)) (see 3 papers)
Q8NKR9 fructose-bisphosphatase (EC 3.1.3.11) from Thermococcus kodakarensis (see paper)
TK2164 thermophile-specific fructose-1,6-bisphosphatase from Thermococcus kodakaraensis KOD1
100% identity, 100% coverage

• function: Catalyzes two subsequent steps in gluconeogenesis: the aldol condensation of dihydroxyacetone phosphate (DHAP) and glyceraldehyde-3- phosphate (GA3P) to fructose-1,6-bisphosphate (FBP), and the dephosphorylation of FBP to fructose-6-phosphate (F6P) (PubMed:12065581, PubMed:20348906). Does not display hydrolase activity against fructose 2,6-bisphosphate, fructose 6-phosphate, fructose 1- phosphate, glucose 6-phosphate, and glucose 1-phosphate (PubMed:12065581). Exhibits only negligible activity on inositol-1- phosphate (IMP) (PubMed:15317785). Is essential for the growth of T.kodakaraensis under gluconeogenic conditions (PubMed:15317785).
  catalytic activity: beta-D-fructose 1,6-bisphosphate + H2O = beta-D-fructose 6- phosphate + phosphate (RHEA:11064)
  catalytic activity: beta-D-fructose 1,6-bisphosphate = D-glyceraldehyde 3- phosphate + dihydroxyacetone phosphate (RHEA:14729)
  cofactor: Mg(2+)
  subunit: Homooctamer; dimer of tetramers.
  disruption phenotype: Cells lacking this gene cannot grow under gluconeogenic conditions while glycolytic growth is unimpaired, and the gene disruption results in the complete abolishment of intracellular FBPase activity.
• Thermococcus kodakarensis provides a versatile hyperthermophilic archaeal platform for protein expression
  Scott, Methods in enzymology 2021
  • “...al. (2008b) Pcsg TK0895 Thermococcus kodakarensis Constitutive; cell surface glycoprotein Takemasa et al. (2011) Pfbpase TK2164 Thermococcus kodakarensis Inducible; fructose-1,6-bisphosphatase. Involvement in central metabolism hinders tight regulation Sato et al. (2004) PcipA PF0190 Pyrococcus furiosus Inducible; membrane-bound glycoprotein, cold-induced protein A. Induction via heat/cold shock or...”
• Proteome profiling of heat, oxidative, and salt stress responses in Thermococcus kodakarensis KOD1
  Jia, Frontiers in microbiology 2015
  • “...38 Pyridoxine/pyridoxal 5-phosphate biosynthesis protein TK0217 25 2.6 5.57 5.5 36.64 37.7 39 Thermophile-specific fructose-1,6-bisphosphatase TK2164 60 2.7 5.36 5.3 41.63 41.8 40 Serine hydroxymethyltransferase TK0528 41 2.0 5.80 5.2 48.20 47.3 41 Glutamate dehydrogenase TK1431 34 1.8 5.88 5.5 47.03 47.9 42 Deblocking aminopeptidase TK1177...”
  • “...2 DNA/RNA repair helicase TK0928 12 2.1 4.33 4.5 53.15 54.0 3 Thermophile-specific fructose-1,6-bisphosphatase fructose-1,6-bisphosphatase TK2164 15 2.6 5.36 5.4 41.63 43.5 4 Archaeal ATPase TK1465 21 3.0 6.36 6.4 53.84 54.2 5 Zinc-dependent protease TK0699 10 2.9 5.49 5.9 53.56 54.8 6 Thioredoxin reductase TK2100...”
• Carbohydrate metabolism in Archaea: current insights into unusual enzymes and pathways and their regulation
  Bräsen, Microbiology and molecular biology reviews : MMBR 2014
  • “...in gluconeogenic promoters (e.g., the FBPA/ase-encoding gene TK2164) or downstream of glycolytic promoters (e.g., pfp [ADP-PFK]; TK0376) (208). Tgr, like TrmB,...”
• Characterization of fructose 1,6-bisphosphatase and sedoheptulose 1,7-bisphosphatase from the facultative ribulose monophosphate cycle methylotroph Bacillus methanolicus
  Stolzenberger, Journal of bacteriology 2013
  • “...of class V are represented by the FBPases TK2164 from Pyrococcus (Thermococcus) kodakaraensis and ST0318 from Sulfolobus tokodaii (20, 30). Recently, class V...”
• Structural and biochemical characterization of the type II fructose-1,6-bisphosphatase GlpX from Escherichia coli
  Brown, The Journal of biological chemistry 2009
  • “...type V is represented by the FBPases TK2164 from Pyrococcus (Thermococcus) kodakaraensis and ST0318 from Sulfolobus tokodai (10, 21). Three-dimensional...”
• Archaeal RNA polymerase subunits E and F are not required for transcription in vitro, but a Thermococcus kodakarensis mutant lacking subunit F is temperature-sensitive
  Hirata, Molecular microbiology 2008
  • “...TK0901 ( rpoF ) was sufficient to remove the temperature sensitivity of KU2F. Transcription of TK2164 that encodes fructose-1,6-bisphosphatase (FBPase) was known to increase ~15-fold under gluconeogenic versus glycolytic growth conditions ( Kanai et al ., 2007 ) and, in plasmid pCTF ( Fig. 4 ,...”
  • “...1 ), TK0901 ( rpoF ) was positioned immediately downstream from the TK2164 promoter (P TK2164 ). To provide a selectable marker, trpE (TK0254) was cloned adjacent to the rpoF construct, and this selection-expression cassette was ligated between by 5'- and 3'-sequences from TK1765 ( chiA...”
• Complete genome sequence of the hyperthermophilic archaeon Thermococcus kodakaraensis KOD1 and comparison with Pyrococcus genomes
  Fukui, Genome research 2005
  • “...for T. kodakaraensis by proving that a divergent FBPase (TK2164) (Rashid et al. 2002b), but not IMPase/FBPase (TK0787) (Stec et al. 2000), is the bona fide...”

FBPAP_THEON / B6YTP6 Fructose-1,6-bisphosphate aldolase/phosphatase; FBP A/P; FBP aldolase/phosphatase; EC 3.1.3.11; EC 4.1.2.13 from Thermococcus onnurineus (strain NA1) (see paper)
TON_1497 thermophile-specific fructose-1,6-bisphosphatase from Thermococcus onnurineus NA1
91% identity, 100% coverage

• function: Catalyzes two subsequent steps in gluconeogenesis: the aldol condensation of dihydroxyacetone phosphate (DHAP) and glyceraldehyde-3- phosphate (GA3P) to fructose-1,6-bisphosphate (FBP), and the dephosphorylation of FBP to fructose-6-phosphate (F6P) (By similarity). Can also dephosphorylate, with lower activity, other related substrates including fructose-1-phosphate, fructose-6-phosphate, glucose-1- phosphate, glucose-6-phosphate, glycerol-2-phosphate, phosphoenolpyruvate, 5'-AMP, 6'-ADP and 7'-ATP (PubMed:21221938).
  catalytic activity: beta-D-fructose 1,6-bisphosphate = D-glyceraldehyde 3- phosphate + dihydroxyacetone phosphate (RHEA:14729)
  catalytic activity: beta-D-fructose 1,6-bisphosphate + H2O = beta-D-fructose 6- phosphate + phosphate (RHEA:11064)
  cofactor: Mg(2+)
  subunit: Homooctamer; dimer of tetramers.
• Formate Utilization by the Crenarchaeon Desulfurococcus amylolyticus
  Ergal, Microorganisms 2020
  • “...formate utilisation. It was shown that the glyceraldehyde-3-phosphate dehydrogenase (TON_0639), 2-phosphoglycerate kinase, (TON_0742), fructose bisphosphatase (TON_1497), ribose-5-phosphate isomerase (TON_0168), adenine phosphoribosyl transferase (TON_0120), AMP phosphorylase homolog DeoA (TON_1062), and 3-hexulose-6-phosphate synthase/6-phospho-3-hexuloisomerase (HPS/PHI) (TON_0336) were upregulated during growth on formate in T. onnurineus [ 56 ]. It...”
• Proteomic Insights into Sulfur Metabolism in the Hydrogen-Producing Hyperthermophilic Archaeon Thermococcus onnurineus NA1
  Moon, International journal of molecular sciences 2015
  • “...1.00 0.11 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) TON_0639 1.30 0.52 Y 0.89 0.00 Y Thermophile-specific fructose-1,6-bisphosphatase (FBPase) TON_1497 2.77 1.60 Y 1.00 1.00 Y Mevalonate kinase (MVK) TON_0133 Y Y Y Y Y Y Geranylgeranyl hydrogenase TON_0316 1.51 1.92 0.81 1.00 1.00 0.03 UDP- N -acetylglucosamine 2-epimerase (WecB)...”
  • “...and transcriptomic data correlate reasonably well. In addition, enzymes involved in gluconeogenesis (GAPDH: TON_0639, FBPase: TON_1497, PPS: TON_0311), except for PGK (TON_0742), were specifically induced during growth on sulfur. In fact, PGK (TON_0742) was detected with higher abundance in cells grown with formate than with other...”
• Proteome analyses of hydrogen-producing hyperthermophilic archaeon Thermococcus onnurineus NA1 in different one-carbon substrate culture conditions
  Moon, Molecular & cellular proteomics : MCP 2012
  • “...(TON_0639), 2-phosphoglycerate kinase (TON_0742), and FBPase (TON_1497), key enzymes in gluconeogenesis (24, 25); these enzymes were strongly up-regulated...”
  • “...kodakaraensis KOD1 (26, 27), the recently characterized FBPase (TON_1497) from T. onnurineus NA1 has a different range of substrate specificities, although it...”

PF0613 hypothetical protein from Pyrococcus furiosus DSM 3638
88% identity, 100% coverage

• Genome-wide binding analysis of the transcriptional regulator TrmBL1 in Pyrococcus furiosus
  Reichelt, BMC genomics 2016
  • “...no binding of TrmBL1 to the promoter region of the fructose-1,6-bisphosphatase gene ( fbp ; PF0613) was detected in our study. Previous results showed TrmBL1 mediated activation of the transcription of this gene for P. furiosus and T. kodakarensis [ 10 , 11 ]. Additionally, the...”
  • “...P. furiosus genome confirmed the previously reported presence of a corresponding motif sequence in the PF0613 promoter region (Additional file 3 ) [ 20 ]. However, there are several additional putative TrmBL1 binding sites, which also appear to be unbound by TrmBL1 in vivo using ChIP-seq....”
• Carbohydrate metabolism in Archaea: current insights into unusual enzymes and pathways and their regulation
  Bräsen, Microbiology and molecular biology reviews : MMBR 2014
  • “...gluconeogenic function, the transcript of anabolic FBPA/ase (PF0613) is upregulated 15-fold in peptide-grown cells (336). The reversible archaeal-type class I...”
• Shuttle vector-based transformation system for Pyrococcus furiosus
  Waege, Applied and environmental microbiology 2010
  • “...shuttle vector under the control of the fructose-1-6 bisphosphatase (PF0613) promoter (Fig. 1, pYS4). To allow a simple and rapid purification of the protein, a...”
  • “...linked to the 3-end of the gene (24). The PF0613 promoter is repressed under glycolytic and induced under gluconeogenetic conditions (13, 16). The new construct...”
• Impact of substrate glycoside linkage and elemental sulfur on bioenergetics of and hydrogen production by the hyperthermophilic archaeon Pyrococcus furiosus
  Chou, Applied and environmental microbiology 2007
  • “...induced transcription of genes involved in gluconeogenesis (PF0613, PF0289, and PF1874), oligopeptide transport (PF0191 to PF0195), energy conservation via...”
  • “...2.2 2.8 Transcriptional regulator, TrmB homolog Gluconeogenesis PF0613 2.9 2.4 3.12 Archaeal fructose 1,6bisphosphatase Polysaccharide synthesis PF0765 5.9 18.4...”
• Whole-genome DNA microarray analysis of a hyperthermophile and an archaeon: Pyrococcus furiosus grown on carbohydrates or peptides
  Schut, Journal of bacteriology 2003
  • “...Aryl 2-ketoacid metabolism PF0532 PF0533 PF0559 PF0612 PF0613 PF0676 PF0689 PF0692 Hydrogenase I PF0891 PF0892 PF0893 PF0894 PF0913 PF0915 [Acetyl-CoA...”
  • “...observed increase in enzyme activity (Table 3). FBPase (PF0613) is up-regulated 15-fold in peptide-grown cells, and this corresponds to the FBPase proposed by...”

Ferp_1532 protein of unknown function DUF100 from Ferroglobus placidus DSM 10642
75% identity, 98% coverage

• Complete genome sequence of Ferroglobus placidus AEDII12DO
  Anderson, Standards in genomic sciences 2011
  • “...is present ( Figure 3 ), including the recently discovered archaeal bifunctional fructose bisphosphate aldolase/phosphatase (Ferp_1532) [ 39 ]. A second fructose bisphosphate phosphatase may be present (Ferp_0896). Biosynthesis of C5 sugars for anabolic purposes proceeds through the reverse ribulose monophosphate pathway [ 40 , 41...”

GAH_00357 fructose-1,6-bisphosphate aldolase/phosphatase from Geoglobus ahangari
73% identity, 99% coverage

• The complete genome sequence and emendation of the hyperthermophilic, obligate iron-reducing archaeon "Geoglobus ahangari" strain 234(T)
  Manzella, Standards in genomic sciences 2015
  • “...pernix and Desulfurococcus amylolyticus [ 68 , 69 ]. The genome also contains two genes (GAH_00357 and GAH_01437) encoding archaeal fructose 1,6-bisphosphatases, which catalyze the reverse reaction during gluconeogenesis but can also supply fructose 1,6-bisphosphate to the glycolytic pathway from dihydroxyacetone phosphate and D -glyceraldehyde 3-phosphate...”

WP_202319097 fructose-1,6-bisphosphate aldolase/phosphatase from Archaeoglobus neptunius
73% identity, 98% coverage

• Physiological and Genomic Characterization of a Hyperthermophilic Archaeon Archaeoglobus neptunius sp. nov. Isolated From a Deep-Sea Hydrothermal Vent Warrants the Reclassification of the Genus Archaeoglobus
  Slobodkina, Frontiers in microbiology 2021
  • “...catalyze irreversible reactions of glycolysis, pyruvate kinase, and 6-phosphofructokinase. Instead, there are genes encoding fructose-bisphosphatase (WP_202319097) and phosphoenolpyruvate synthase (WP_202318379) that enable glucose production from pyruvate. Thus, the Embden-Meyerhof pathway in this organism operates in reverse direction, toward gluconeogenesis. Although strain SE56 T lacks the key...”

fbp / A8A9E4 fructose-1,6-bisphosphate aldolase/phosphatase (EC 4.1.2.13; EC 3.1.3.11) from Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) (see 2 papers)
FBPAP_IGNH4 / A8A9E4 Fructose-1,6-bisphosphate aldolase/phosphatase; FBP A/P; FBP aldolase/phosphatase; EC 3.1.3.11; EC 4.1.2.13 from Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) (see paper)
Igni_0363 protein of unknown function DUF100 from Ignicoccus hospitalis KIN4/I
68% identity, 96% coverage

• function: Catalyzes two subsequent steps in gluconeogenesis: the aldol condensation of dihydroxyacetone phosphate (DHAP) and glyceraldehyde-3- phosphate (GA3P) to fructose-1,6-bisphosphate (FBP), and the dephosphorylation of FBP to fructose-6-phosphate (F6P).
  catalytic activity: beta-D-fructose 1,6-bisphosphate + H2O = beta-D-fructose 6- phosphate + phosphate (RHEA:11064)
  catalytic activity: beta-D-fructose 1,6-bisphosphate = D-glyceraldehyde 3- phosphate + dihydroxyacetone phosphate (RHEA:14729)
  cofactor: Mg(2+)
  subunit: Homooctamer; dimer of tetramers.
• Multi-omics analysis provides insight to the Ignicoccus hospitalis-Nanoarchaeum equitans association
  Rawle, Biochimica et biophysica acta. General subjects 2017
  • “...Igni_0086 Succinyl-CoA synthetase (ADP-forming) beta subunit t Succinate m Igni_0315 Acetylornithine deacetylase p L-Ornithine m Igni_0363 Hypothetical protein t Igni_1361 Glucokinase p Igni_0415 Glucose-6-phosphate isomerase t Igni_0678 Fumarase Fumarate m Igni_1079 Deoxyribose-phosphate aldolase t,p Igni_0257 Acyl-coenzyme A synthetase/AMP-(fatty) acid ligase-like protein t Igni_0256 AMP-dependent synthetase and...”

FBPAP_METTM / D9PUH5 Fructose-1,6-bisphosphate aldolase/phosphatase; FBP A/P; FBP aldolase/phosphatase; EC 3.1.3.11; EC 4.1.2.13 from Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg) (Methanobacterium thermoautotrophicum) (see paper)
63% identity, 99% coverage

• function: Catalyzes two subsequent steps in gluconeogenesis: the aldol condensation of dihydroxyacetone phosphate (DHAP) and glyceraldehyde-3- phosphate (GA3P) to fructose-1,6-bisphosphate (FBP), and the dephosphorylation of FBP to fructose-6-phosphate (F6P).
  catalytic activity: beta-D-fructose 1,6-bisphosphate + H2O = beta-D-fructose 6- phosphate + phosphate (RHEA:11064)
  catalytic activity: beta-D-fructose 1,6-bisphosphate = D-glyceraldehyde 3- phosphate + dihydroxyacetone phosphate (RHEA:14729)
  cofactor: Mg(2+)
  subunit: Homooctamer; dimer of tetramers.

Desfe_1349 fructose-1,6-bisphosphate aldolase/phosphatase from Desulfurococcus amylolyticus DSM 16532
67% identity, 97% coverage

• Metabolic reconstruction and experimental verification of glucose utilization in Desulfurococcus amylolyticus DSM 16532
  Reischl, Folia microbiologica 2018
  • “...phosphofructokinase (PFK) (Desfe_0717 and Desfe_0968), fructose-bisphosphate aldolase, class I (Desfe_0718), and fructose 1,6-bisphosphate aldolase/phosphatase (FBPase, Desfe_1349). From results of the metabolic reconstruction, D. amylolyticus would be able to use the classical and the archaeal (modified) EMP to convert glyceraldehyde-3-phosphate to glycerate-3-phosphate. For the classical EMP, glyceraldehyde...”
  • “...which would result in 2mol of reduced ferredoxin (Fd 2 ) or NADH respectively. FBPase (Desfe_1349) as well as GAPDH (Desfe_0067) are enzymes used in gluconeogenesis and counteract the irreversible reactions of the modified EMP, like PFK, GAPOR, and pyruvate kinase (Siebers and Schnheit 2005 )....”

FBPAP_MOOTA / Q2RG86 Fructose-1,6-bisphosphate aldolase/phosphatase; FBP A/P; FBP aldolase/phosphatase; EC 3.1.3.11; EC 4.1.2.13 from Moorella thermoacetica (strain ATCC 39073 / JCM 9320) (see paper)
Moth_2266 Protein of unknown function DUF100 from Moorella thermoacetica ATCC 39073
65% identity, 98% coverage

• function: Catalyzes two subsequent steps in gluconeogenesis: the aldol condensation of dihydroxyacetone phosphate (DHAP) and glyceraldehyde-3- phosphate (GA3P) to fructose-1,6-bisphosphate (FBP), and the dephosphorylation of FBP to fructose-6-phosphate (F6P).
  catalytic activity: beta-D-fructose 1,6-bisphosphate + H2O = beta-D-fructose 6- phosphate + phosphate (RHEA:11064)
  catalytic activity: beta-D-fructose 1,6-bisphosphate = D-glyceraldehyde 3- phosphate + dihydroxyacetone phosphate (RHEA:14729)
  cofactor: Mg(2+)
  subunit: Homooctamer; dimer of tetramers.
• Novel Syntrophic Populations Dominate an Ammonia-Tolerant Methanogenic Microbiome
  Frank, mSystems 2016
  • “...supplemental material). These enzymes have previously been characterized as unidirectional in the homoacetogen Moorella thermoacetica (Moth_2266), whereas the closest relative of the unFirm_1 gene was from Syntrophus aciditrophicus , a known syntroph ( 21 ). Lysine (Lys232) and tyrosine (Tyr348) residues that are essential for aldolase...”
  • “...CD01 reactor. 10.1128/mSystems.00092-16.3 FigureS3 Comparison of the fructose-1,6-bisphosphate aldolase/phosphatase from Moorella thermoacetica ( YP_431096.1 , Moth_2266) and the putative representative from unFirm_1 with Clustal Omega. The highlighted (red) amino acids are essential for the aldolase (K232) and phosphatase (Y348) activities, respectively. Download FigureS3, PDF file, 0.4...”

TTE0285 conserved hypothetical protein from Thermoanaerobacter tengcongensis MB4
65% identity, 98% coverage

• A cross-genomic approach for systematic mapping of phenotypic traits to genes
  Jim, Genome research 2004
  • “...Propensity p value t/n Identification TTE2470 TTE0073 TTE0285 TTE1955 TTE0474 TTE1745 TTE1895 TTE2198 TTE1209 TTE1340 TTE0961 TTE1354 TTE1210 TTE1341 TTE1276...”
• A complete sequence of the T. tengcongensis genome
  Bao, Genome research 2002
  • “...protein PflX (TTE1779), and conserved hypothetical proteins (TTE0285, TTE1224, TTE1505, TTE2664, TTE2667, TTE2636, and TTE2662). It is unlikely that...”

SSCH_790022 fructose-1,6-bisphosphate aldolase/phosphatase from Syntrophaceticus schinkii
63% identity, 98% coverage

• Genome-Guided Analysis and Whole Transcriptome Profiling of the Mesophilic Syntrophic Acetate Oxidising Bacterium Syntrophaceticus schinkii
  Manzoor, PloS one 2016
  • “...genes needed for gluconeogenic enzyme activities, such as SSCH_630024 (pyruvate carboxylase), SSCH_180001 (pyruvate-phosphate dikinase), and SSCH_790022 (fructose-1,6 bisphosphatase), were expressed in S . schinkii ( S3 Fig ). Acetate oxidation In our recent genome-scale analysis of the mesophilic SAOB T . acetatoxydans [ 42 ], we...”

FAD_0332 fructose-1,6-bisphosphate aldolase/phosphatase from Ferroplasma acidiphilum
63% identity, 97% coverage

• Metabolic and evolutionary patterns in the extremely acidophilic archaeon Ferroplasma acidiphilum Y^T
  Golyshina, Scientific reports 2017
  • “...FAD_1169, FAD_1350); 18,2-phosphoglycerate kinase (FAD_1810); 19, glyceraldehyde-3-phosphate dehydrogenase (FAD_0549); 20, triosephosphate isomerase (FAD_0107); 21, fructose-2,6-bisphosphatase (FAD_0332); 22,6-phosphofructokinase (FAD_0353); 23, bifunctional phosphoglucose/phosphomannose isomerase (FAD_0562); 24, phosphoglucomutase/phosphomannomutase (FAD_0602); 25, transketolase (FAD_14771476); 26, transaldolase (FAD_1201; FAD_1475); 27, ribulose-phosphate 3-epimerase (FAD_0295). Abbreviations used: Fd, electron carrier ferredoxin; NAD, nicotinamide adenine...”

DET1225 hypothetical protein from Dehalococcoides ethenogenes 195
61% identity, 99% coverage

• Inferring Gene Networks for Strains of Dehalococcoides Highlights Conserved Relationships between Genes Encoding Core Catabolic and Cell-Wall Structural Proteins
  Mansfeldt, PloS one 2016
  • “...histidine kinase 0.89 0.92 DET0564 ATP synthase subunit B DET1263 DAK2 domain protein 0.89 0.92 DET1225 hypothetical protein DET1417 formyltransferase If TCE (and PCE, when provided) was available to be and was respired (1) or not (0) 0.96 0.88 DET1477 hypothetical protein DET1554 hypothetical protein 0.90...”

ST0318 385aa long conserved hypothetical protein from Sulfolobus tokodaii str. 7
63% identity, 95% coverage

• Coxiella burnetii inhibits host immunity by a protein phosphatase adapted from glycolysis
  Zhang, Proceedings of the National Academy of Sciences of the United States of America 2022
  • “...that attacks IB, a key regulatory protein in NF-B signaling. Unlike its homologs such as ST0318 from the archaeon Sulfolobus tokodaii , CinF has lost the enzymatic activity as a fructose-1,6-bisphosphate aldolase/phosphatase. Instead, it specifically targets IB to make it resistant to proteasome-mediated degradation in cells...”
  • “...Sequence analysis by the HHpred algorithm ( 29 ) revealed that Cbu0513 is similar to ST0318 from S. tokodaii ( 30 ) and Tn FBPAP from Thermoproteus neutrophilus ( 31 ). In both cases, the identity is 39%, and the similarity is about 65% ( SI...”
• Characterization of fructose 1,6-bisphosphatase and sedoheptulose 1,7-bisphosphatase from the facultative ribulose monophosphate cycle methylotroph Bacillus methanolicus
  Stolzenberger, Journal of bacteriology 2013
  • “...FBPases TK2164 from Pyrococcus (Thermococcus) kodakaraensis and ST0318 from Sulfolobus tokodaii (20, 30). Recently, class V FBPase in the (hyper)thermophilic...”
• Structural and biochemical characterization of the type II fructose-1,6-bisphosphatase GlpX from Escherichia coli
  Brown, The Journal of biological chemistry 2009
  • “...FBPases TK2164 from Pyrococcus (Thermococcus) kodakaraensis and ST0318 from Sulfolobus tokodai (10, 21). Three-dimensional structures of the type I (from pig...”
  • “...E. coli), type IV (MJ0109 and AF2372), and type V (ST0318) FBPases have been solved (10, 11, 19, 20, 22, 23). FBPases I and IV and inositol monophosphatases...”
• The first crystal structure of the novel class of fructose-1,6-bisphosphatase present in thermophilic archaea
  Nishimasu, Structure (London, England : 1993) 2004 (PubMed)
  • “...archaea, we solved the crystal structure of the ST0318 gene product (St-Fbp) of Sulfolobus tokodaii strain 7. The St-Fbp structure comprises a homooctamer of...”
  • “...St-Fbp, FBPase (Sulfolobus tokodaii strain 7 ORF ST0318); SS0286, Sulfolobus solfataricus ORF SS0286; MJ0299, Methanococcus jannaschii ORF MJ0299; Tk-Fbp,...”

FBPAP_SULTO / F9VMT6 Fructose-1,6-bisphosphate aldolase/phosphatase; FBP A/P; FBP aldolase/phosphatase; Fructose-1,6-bisphosphatase; FBPase; EC 3.1.3.11; EC 4.1.2.13 from Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) (Sulfolobus tokodaii) (see 3 papers)
F9VMT6 fructose-bisphosphatase (EC 3.1.3.11); fructose-bisphosphate aldolase (EC 4.1.2.13) from Sulfurisphaera tokodaii (see 2 papers)
63% identity, 96% coverage

• function: Catalyzes two subsequent steps in gluconeogenesis: the aldol condensation of dihydroxyacetone phosphate (DHAP) and glyceraldehyde-3- phosphate (GA3P) to fructose-1,6-bisphosphate (FBP), and the dephosphorylation of FBP to fructose-6-phosphate (F6P).
  catalytic activity: beta-D-fructose 1,6-bisphosphate + H2O = beta-D-fructose 6- phosphate + phosphate (RHEA:11064)
  catalytic activity: beta-D-fructose 1,6-bisphosphate = D-glyceraldehyde 3- phosphate + dihydroxyacetone phosphate (RHEA:14729)
  cofactor: Mg(2+) (Can also use Zn(2+) or Mn(2+) in vitro, although with much less efficiency than Mg(2+).)
  subunit: Homooctamer; dimer of tetramers.

Q980K6 fructose-bisphosphate aldolase (EC 4.1.2.13) from Saccharolobus solfataricus (see paper)
SSO0286 Conserved hypothetical protein from Sulfolobus solfataricus P2
61% identity, 96% coverage

• Global analysis of viral infection in an archaeal model system
  Maaty, Frontiers in microbiology 2012
  • “...(36); Tryptophan repressor binding protein, SSO3155 (72) Function unknown Hypothetical protein, SSO0276 (12), Hypothetical protein, SSO0286 (36); Conserved hypothetical protein, SSO1098 (12,24,36,48); Hypothetical protein, SSO2569 (48)?; Conserved hypothetical protein, SSO2749 (12,24) Signal transduction mechanisms Universal stress protein, SSO1865 (12,24,36,48) Numbers in parenthesis designate time points (hpi)....”
  • “...documented report of phosphorylation for one of the regulated proteins concerned the conserved hypothetical protein (SSO0286), which was found here in two spots and has 93% sequence similarity to Fructose-1,6-Bisphosphatase from S. tokodaii (Nishimasu et al., 2004 ). Phosphorylation of Fructose-1,6-Bisphosphatase is typically involved in switching...”
• "Hot standards" for the thermoacidophilic archaeon Sulfolobus solfataricus
  Zaparty, Extremophiles : life under extreme conditions 2010
  • “...psi-BLAST approach detected four genes as candidate TFs, which also belong to the reported CCM-genes: SSO0286, SSO2281, SSO3041 and SSO3226; the latter three are considered to be strong candidates for TFs. These genes possibly have both functions (moonlighting), CCM-gene and TF. One of these four moonlighting...”
  • “...transcription factors or DNA-binding proteins might give further insight. The other two moonlighting candidates are SSO0286, a fructose-1,6-bisphosphate phosphatase, and SSO3041, a putative gluconolactonase. For these proteins, no further evidence for moonlighting functions was found in the present literature. Functional genomics Transcriptome analyses In order to...”
• Something old, something new, something borrowed; how the thermoacidophilic archaeon Sulfolobus solfataricus responds to oxidative stress
  Maaty, PloS one 2009
  • “...9.71 138 P3 Succinyl-CoA synthetase, beta subunit SSO2483 37388 5.57 512 P4 COG0045 hypothetical protein SSO0286 42681 5.78 298 P5 COG1980 Thermostable Carboxypeptidase (cpsA-1) SSO1355 43326 5.93 218,419,183 P5,P6,P7 COG1473 Thermostable carboxypeptidase (cpsA-2) SSO1952 43250 5.93 143,301,150 P5,P6,P7 COG1473 Adenylosuccinate synthase (IMP aspartate ligase) SSO0242 37417...”

1umgA / F9VMT6 Crystal structure of fructose-1,6-bisphosphatase (see paper)
63% identity, 98% coverage

• Ligands: magnesium ion; 1,6-fructose diphosphate (linear form) (1umgA)

A3MSD2 fructose-bisphosphatase (EC 3.1.3.11); fructose-bisphosphate aldolase (EC 4.1.2.13) from Pyrobaculum calidifontis (see paper)
Pcal_0111 protein of unknown function DUF100 from Pyrobaculum calidifontis JCM 11548
59% identity, 92% coverage

• Pcal_0111, a highly thermostable bifunctional fructose-1,6-bisphosphate aldolase/phosphatase from Pyrobaculum calidifontis
  Aziz, Extremophiles : life under extreme conditions 2017 (PubMed)
  • “...Pcal_0111, a highly thermostable bifunctional fructose-1,6bisphosphate aldolase/phosphatase from Pyrobaculum calidifontis Iram Aziz1 * Naeem Rashid1 * Raza Ashraf1 * Qamar Bashir1 * Tadayuki Imanaka2 * Muhammad...”
  • “...calidifontis genome harbors an open reading frame Pcal_0111 annotated as fructose bisphosphate aldolase. Although the gene is annotated as fructose bisphosphate...”

FBPAP_METS5 / A4YIZ5 Fructose-1,6-bisphosphate aldolase/phosphatase; FBP A/P; FBP aldolase/phosphatase; EC 3.1.3.11; EC 4.1.2.13 from Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2) (see paper)
60% identity, 97% coverage

• function: Catalyzes two subsequent steps in gluconeogenesis: the aldol condensation of dihydroxyacetone phosphate (DHAP) and glyceraldehyde-3- phosphate (GA3P) to fructose-1,6-bisphosphate (FBP), and the dephosphorylation of FBP to fructose-6-phosphate (F6P).
  catalytic activity: beta-D-fructose 1,6-bisphosphate + H2O = beta-D-fructose 6- phosphate + phosphate (RHEA:11064)
  catalytic activity: beta-D-fructose 1,6-bisphosphate = D-glyceraldehyde 3- phosphate + dihydroxyacetone phosphate (RHEA:14729)
  cofactor: Mg(2+)
  subunit: Homooctamer; dimer of tetramers.

3t2dA / B1YAL1 Fructose-1,6-bisphosphate aldolase/phosphatase from thermoproteus neutrophilus, fbp-bound form (see paper)
59% identity, 94% coverage

• Ligands: magnesium ion; 1,6-di-o-phosphono-d-fructose (3t2dA)

FBPAP_PYRNV / B1YAL1 Fructose-1,6-bisphosphate aldolase/phosphatase; FBP A/P; FBP aldolase/phosphatase; EC 3.1.3.11; EC 4.1.2.13 from Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / NBRC 100436 / V24Sta) (Thermoproteus neutrophilus) (see 2 papers)
B1YAL1 fructose-bisphosphatase (EC 3.1.3.11); fructose-bisphosphate aldolase (EC 4.1.2.13) from Pyrobaculum neutrophilum (see paper)
59% identity, 92% coverage

• function: Catalyzes two subsequent steps in gluconeogenesis: the aldol condensation of dihydroxyacetone phosphate (DHAP) and glyceraldehyde-3- phosphate (GA3P) to fructose-1,6-bisphosphate (FBP), and the dephosphorylation of FBP to fructose-6-phosphate (F6P).
  catalytic activity: beta-D-fructose 1,6-bisphosphate + H2O = beta-D-fructose 6- phosphate + phosphate (RHEA:11064)
  catalytic activity: beta-D-fructose 1,6-bisphosphate = D-glyceraldehyde 3- phosphate + dihydroxyacetone phosphate (RHEA:14729)
  cofactor: Mg(2+)
  subunit: Homooctamer; dimer of tetramers.

Q5SJM8 fructose-bisphosphatase (EC 3.1.3.11) from Thermus thermophilus (see paper)
TTHA0980 hypothetical protein from Thermus thermophilus HB8
46% identity, 98% coverage

• A Transfer Learning-Based Approach for Lysine Propionylation Prediction
  Li, Frontiers in physiology 2021
  • “...(glpX) Q5SM35 Transketolase (TTHA0108) Q5SHF7 Fructose-1,6-bisphosphate aldolase (TTHA1773) Q5SM37 Ribulose-phosphate 3-epimerase (TTHA0106) Q5SLJ4 Glucokinase (TTHA0299) Q5SJM8 Hypothetical protein (TTHA0980) P56194 Histidyl-tRNA synthetase (hisS) 3.2378 Q5SLY2 Leucyl-tRNA synthetase (leuS) Q5SJX7 Seryl-tRNA synthetase (TTHA0875) P56881 Threonyl-tRNA synthetase (thrS) P56206 Glycyl-tRNA synthetase (TTHA0543) P56690 Isoleucyl-tRNA synthetase (ileS) 2.5835 P23395...”
• A Transfer Learning-Based Approach for Lysine Propionylation Prediction
  Li, Frontiers in physiology 2021
  • “...(TTHA0108) Q5SHF7 Fructose-1,6-bisphosphate aldolase (TTHA1773) Q5SM37 Ribulose-phosphate 3-epimerase (TTHA0106) Q5SLJ4 Glucokinase (TTHA0299) Q5SJM8 Hypothetical protein (TTHA0980) P56194 Histidyl-tRNA synthetase (hisS) 3.2378 Q5SLY2 Leucyl-tRNA synthetase (leuS) Q5SJX7 Seryl-tRNA synthetase (TTHA0875) P56881 Threonyl-tRNA synthetase (thrS) P56206 Glycyl-tRNA synthetase (TTHA0543) P56690 Isoleucyl-tRNA synthetase (ileS) 2.5835 P23395 Methionyl-tRNA synthetase (TTHA1298)...”
• The role of ribonucleases in regulating global mRNA levels in the model organism Thermus thermophilus HB8
  Ohyama, BMC genomics 2014
  • “...that is associated with cyclic di-GMP synthetase activity. In addition, most of the genes from TTHA0980 to TTHA0987 were down-regulated by greater than 10-fold after disruption of the RNase HI gene. Disruption of the RNase HII gene led to the identification of 74 and 199 genes...”
  • “...described above. Similarly, TTHA0989 (66-fold), TTHA0994 (2,042-fold), TTHA0995 (177-fold), and most of the genes from TTHA0980 to TTHA0987 (>20-fold) were significantly down-regulated by the disruption of the Argonaute gene, as was the case with the RNase HI gene disruptant. These results suggest some similarity between RNase...”
• Lysine propionylation is a prevalent post-translational modification in Thermus thermophilus
  Okanishi, Molecular & cellular proteomics : MCP 2014
  • “...TTHA0892 TTHA0987 TTHA1124 TTHA1248 TTHA1262 TTHA0906 TTHA0980 TTHA1524 TTHA1698 TTHA1755 TTHA1781 TTHA1928 Carbohydrate transport and metabolism TTHA0002...”

FBPAP_THET2 / Q72K02 Fructose-1,6-bisphosphate aldolase/phosphatase; FBP A/P; FBP aldolase/phosphatase; EC 3.1.3.11; EC 4.1.2.13 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see paper)
46% identity, 98% coverage

• function: Catalyzes two subsequent steps in gluconeogenesis: the aldol condensation of dihydroxyacetone phosphate (DHAP) and glyceraldehyde-3- phosphate (GA3P) to fructose-1,6-bisphosphate (FBP), and the dephosphorylation of FBP to fructose-6-phosphate (F6P).
  catalytic activity: beta-D-fructose 1,6-bisphosphate + H2O = beta-D-fructose 6- phosphate + phosphate (RHEA:11064)
  catalytic activity: beta-D-fructose 1,6-bisphosphate = D-glyceraldehyde 3- phosphate + dihydroxyacetone phosphate (RHEA:14729)
  cofactor: Mg(2+)
  subunit: Homooctamer; dimer of tetramers.

FBPAP_CENSY / A0RV30 Fructose-1,6-bisphosphate aldolase/phosphatase; FBP A/P; FBP aldolase/phosphatase; EC 3.1.3.11; EC 4.1.2.13 from Cenarchaeum symbiosum (strain A) (see paper)
44% identity, 94% coverage

• function: Catalyzes two subsequent steps in gluconeogenesis: the aldol condensation of dihydroxyacetone phosphate (DHAP) and glyceraldehyde-3- phosphate (GA3P) to fructose-1,6-bisphosphate (FBP), and the dephosphorylation of FBP to fructose-6-phosphate (F6P).
  catalytic activity: beta-D-fructose 1,6-bisphosphate + H2O = beta-D-fructose 6- phosphate + phosphate (RHEA:11064)
  catalytic activity: beta-D-fructose 1,6-bisphosphate = D-glyceraldehyde 3- phosphate + dihydroxyacetone phosphate (RHEA:14729)
  cofactor: Mg(2+)
  subunit: Homooctamer; dimer of tetramers.

CBU_0513 hypothetical protein from Coxiella burnetii RSA 493
41% identity, 96% coverage

• Rolling With Host Immunity: Virulence Beyond The Glycolysis
  Guo, Frontiers in cellular and infection microbiology 2022
  • “...NF-B signalling pathway using the NF-B reporter system, and discovered that the effector protein CinF (Cbu_0513) inhibits NF-B activation effectively. Surprisingly, by the bioinformatic analysis, CinF showed high similarities to ST0318, a fructose-1,6-bisphosphate (FBP) aldolase/phosphatase found in numerous bacteria, especially the certain Archaea species ( Fushinobu...”

New Search

Statistics

How It Works

PaperBLAST builds a database of protein sequences that are linked to scientific articles. These links come from automated text searches against the articles in EuropePMC and from manually-curated information from GeneRIF, UniProtKB/Swiss-Prot, BRENDA, CAZy (as made available by dbCAN), BioLiP, CharProtDB, MetaCyc, EcoCyc, TCDB, REBASE, the Fitness Browser, and a subset of the European Nucleotide Archive with the /experiment tag. Given this database and a protein sequence query, PaperBLAST uses protein-protein BLAST to find similar sequences with E < 0.001.

To build the database, we query EuropePMC with locus tags, with RefSeq protein identifiers, and with UniProt accessions. We obtain the locus tags from RefSeq or from MicrobesOnline. We use queries of the form "locus_tag AND genus_name" to try to ensure that the paper is actually discussing that gene. Because EuropePMC indexes most recent biomedical papers, even if they are not open access, some of the links may be to papers that you cannot read or that our computers cannot read. We query each of these identifiers that appears in the open access part of EuropePMC, as well as every locus tag that appears in the 500 most-referenced genomes, so that a gene may appear in the PaperBLAST results even though none of the papers that mention it are open access. We also incorporate text-mined links from EuropePMC that link open access articles to UniProt or RefSeq identifiers. (This yields some additional links because EuropePMC uses different heuristics for their text mining than we do.)

For every article that mentions a locus tag, a RefSeq protein identifier, or a UniProt accession, we try to select one or two snippets of text that refer to the protein. If we cannot get access to the full text, we try to select a snippet from the abstract, but unfortunately, unique identifiers such as locus tags are rarely provided in abstracts.

PaperBLAST also incorporates manually-curated protein functions:

• Proteins from NCBI's RefSeq are included if a GeneRIF entry links the gene to an article in PubMed^®. GeneRIF also provides a short summary of the article's claim about the protein, which is shown instead of a snippet.
• Proteins from Swiss-Prot (the curated part of UniProt) are included if the curators identified experimental evidence for the protein's function (evidence code ECO:0000269). For these proteins, the fields of the Swiss-Prot entry that describe the protein's function are shown (with bold headings).
• Proteins from BRENDA, a curated database of enzymes, are included if they are linked to a paper in PubMed and their full sequence is known.
• Every protein from the non-redundant subset of BioLiP, a database of ligand-binding sites and catalytic residues in protein structures, is included. Since BioLiP itself does not include descriptions of the proteins, those are taken from the Protein Data Bank. Descriptions from PDB rely on the original submitter of the structure and cannot be updated by others, so they may be less reliable. (For SitesBLAST and Sites on a Tree, we use a larger subset of BioLiP so that every ligand is represented among a group of structures with similar sequences, but for PaperBLAST, we use the non-redundant set provided by BioLiP.)
• Every protein from EcoCyc, a curated database of the proteins in Escherichia coli K-12, is included, regardless of whether they are characterized or not.
• Proteins from the MetaCyc metabolic pathway database are included if they are linked to a paper in PubMed and their full sequence is known.
• Proteins from the Transport Classification Database (TCDB) are included if they have known substrate(s), have reference(s), and are not described as uncharacterized or putative. (Some of the references are not visible on the PaperBLAST web site.)
• Every protein from CharProtDB, a database of experimentally characterized protein annotations, is included.
• Proteins from the CAZy database of carbohydrate-active enzymes are included if they are associated with an Enzyme Classification number. Even though CAZy does not provide links from individual protein sequences to papers, these should all be experimentally-characterized proteins.
• Proteins from the REBASE database of restriction enzymes are included if they have known specificity.
• Every protein with an evidence-based reannotation (based on mutant phenotypes) in the Fitness Browser is included.
• Sequence-specific transcription factors (including sigma factors and DNA-binding response regulators) with experimentally-determined DNA binding sites from the PRODORIC database of gene regulation in prokaryotes.
• Putative transcription factors from RegPrecise that have manually-curated predictions for their binding sites. These predictions are based on conserved putative regulatory sites across genomes that contain similar transcription factors, so PaperBLAST clusters the TFs at 70% identity and retains just one member of each cluster.
• Coding sequence (CDS) features from the European Nucleotide Archive (ENA) are included if the /experiment tag is set (implying that there is experimental evidence for the annotation), the nucleotide entry links to paper(s) in PubMed, and the nucleotide entry is from the STD data class (implying that these are targeted annotated sequences, not from shotgun sequencing). Also, to filter out genes whose transcription or translation was detected, but whose function was not studied, nucleotide entries or papers with more than 25 such proteins are excluded. Descriptions from ENA rely on the original submitter of the sequence and cannot be updated by others, so they may be less reliable.

Except for GeneRIF and ENA, the curated entries include a short curated description of the protein's function. For entries from BioLiP, the protein's function may not be known beyond binding to the ligand. Many of these entries also link to articles in PubMed.

For more information see the PaperBLAST paper (mSystems 2017) or the code. You can download PaperBLAST's database here.

Changes to PaperBLAST since the paper was written:

• November 2023: incorporated PRODORIC and RegPrecise. Many PRODORIC entries were not linked to a protein sequence (no UniProt identifier), so we added this information.
• February 2023: BioLiP changed their download format. PaperBLAST now includes their non-redundant subset. SitesBLAST and Sites on a Tree use a larger non-redundant subset that ensures that every ligand is represented within each cluster. This should ensure that every binding site is represented.
• June 2022: incorporated some coding sequences from ENA with the /experiment tag.
• March 2022: incorporated BioLiP.
• April 2020: incorporated TCDB.
• April 2019: EuropePMC now returns table entries in their search results. This has expanded PaperBLAST's database, but most of the new entries are of low relevance, and the resulting snippets are often just lists of locus tags with annotations.
• February 2018: the alignment page reports the conservation of the hit's functional sites (if available from from Swiss-Prot or UniProt)
• January 2018: incorporated BRENDA.
• December 2017: incorporated MetaCyc, CharProtDB, CAZy, REBASE, and the reannotations from the Fitness Browser.
• September 2017: EuropePMC no longer returns some table entries in their search results. This has shrunk PaperBLAST's database, but has also reduced the number of low-relevance hits.

Many of these changes are described in Interactive tools for functional annotation of bacterial genomes.

Secrets

PaperBLAST cannot provide snippets for many of the papers that are published in non-open-access journals. This limitation applies even if the paper is marked as "free" on the publisher's web site and is available in PubmedCentral or EuropePMC. If a journal that you publish in is marked as "secret," please consider publishing elsewhere.

Omissions from the PaperBLAST Database

Many important articles are missing from PaperBLAST, either because the article's full text is not in EuropePMC (as for many older articles), or because the paper does not mention a protein identifier such as a locus tag, or because of PaperBLAST's heuristics. If you notice an article that characterizes a protein's function but is missing from PaperBLAST, please notify the curators at UniProt or add an entry to GeneRIF. Entries in either of these databases will eventually be incorporated into PaperBLAST. Note that to add an entry to UniProt, you will need to find the UniProt identifier for the protein. If the protein is not already in UniProt, you can ask them to create an entry. To add an entry to GeneRIF, you will need an NCBI Gene identifier, but unfortunately many prokaryotic proteins in RefSeq do not have corresponding Gene identifers.

References

PaperBLAST: Text-mining papers for information about homologs.
M. N. Price and A. P. Arkin (2017). mSystems, 10.1128/mSystems.00039-17.

Europe PMC in 2017.
M. Levchenko et al (2017). Nucleic Acids Research, 10.1093/nar/gkx1005.

Gene indexing: characterization and analysis of NLM's GeneRIFs.
J. A. Mitchell et al (2003). AMIA Annu Symp Proc 2003:460-464.

UniProt: the universal protein knowledgebase.
The UniProt Consortium (2016). Nucleic Acids Research, 10.1093/nar/gkw1099.

BRENDA in 2017: new perspectives and new tools in BRENDA.
S. Placzek et al (2017). Nucleic Acids Research, 10.1093/nar/gkw952.

The EcoCyc database: reflecting new knowledge about Escherichia coli K-12.
I. M. Keeseler et al (2016). Nucleic Acids Research, 10.1093/nar/gkw1003.

The MetaCyc database of metabolic pathways and enzymes.
R. Caspi et al (2018). Nucleic Acids Research, 10.1093/nar/gkx935.

CharProtDB: a database of experimentally characterized protein annotations.
R. Madupu et al (2012). Nucleic Acids Research, 10.1093/nar/gkr1133.

The carbohydrate-active enzymes database (CAZy) in 2013.
V. Lombard et al (2014). Nucleic Acids Research, 10.1093/nar/gkt1178.

The Transporter Classification Database (TCDB): recent advances
M. H. Saier, Jr. et al (2016). Nucleic Acids Research, 10.1093/nar/gkv1103.

REBASE - a database for DNA restriction and modification: enzymes, genes and genomes.
R. J. Roberts et al (2015). Nucleic Acids Research, 10.1093/nar/gku1046.

Deep annotation of protein function across diverse bacteria from mutant phenotypes.
M. N. Price et al (2016). bioRxiv, 10.1101/072470.