PaperBLAST
PaperBLAST Hits for SwissProt::Q91ZA3 Propionyl-CoA carboxylase alpha chain, mitochondrial; PCCase subunit alpha; Propanoyl-CoA:carbon dioxide ligase subunit alpha; EC 6.4.1.3 (Mus musculus (Mouse)) (724 a.a., MAGQWVRTVA...)
Show query sequence
>SwissProt::Q91ZA3 Propionyl-CoA carboxylase alpha chain, mitochondrial; PCCase subunit alpha; Propanoyl-CoA:carbon dioxide ligase subunit alpha; EC 6.4.1.3 (Mus musculus (Mouse))
MAGQWVRTVALLAARRHWRRSSQQQLLGTLKHAPVYSYQCLVVSRSLSSVEYEPKEKTFD
KILIANRGEIACRVIKTCKKMGIKTVAIHSDVDASSVHVKMADEAVCVGPAPTSKSYLNM
DAIMEAIKKTRAQAVHPGYGFLSENKEFAKRLAAEDVTFIGPDTHAIQAMGDKIESKLLA
KRAKVNTIPGFDGVVKDADEAVRIAREIGYPVMIKASAGGGGKGMRIAWDDEETRDGFRF
SSQEAASSFGDDRLLIEKFIDNPRHIEIQVLGDKHGNALWLNERECSIQRRNQKVVEEAP
SIFLDPETRQAMGEQAVALAKAVKYSSAGTVEFLVDSQKNFYFLEMNTRLQVEHPVTECI
TGLDLVQEMILVAKGYPLRHKQEDIPISGWAVECRVYAEDPYKSFGLPSIGRLSQYQEPI
HLPGVRVDSGIQPGSDISIYYDPMISKLVTYGSDRAEALKRMEDALDNYVIRGVTHNIPL
LREVIINTRFVKGDISTKFLSDVYPDGFKGHTLTLSERNQLLAIASSVFVASQLRAQRFQ
EHSRVPVIRPDVAKWELSVKLHDEDHTVVASNNGPAFTVEVDGSKLNVTSTWNLASPLLS
VNVDGTQRTVQCLSREAGGNMSIQFLGTVYKVHILTKLAAELNKFMLEKVPKDTSSTLCS
PMPGVVVAVSVKPGDMVAEGQEICVIEAMKMQNSMTAGKMGKVKLVHCKAGDTVGEGDLL
VELE
Running BLASTp...
Found 270 similar proteins in the literature:
PCCA_MOUSE / Q91ZA3 Propionyl-CoA carboxylase alpha chain, mitochondrial; PCCase subunit alpha; Propanoyl-CoA:carbon dioxide ligase subunit alpha; EC 6.4.1.3 from Mus musculus (Mouse) (see paper)
100% identity, 100% coverage
- function: This is one of the 2 subunits of the biotin-dependent propionyl-CoA carboxylase (PCC), a mitochondrial enzyme involved in the catabolism of odd chain fatty acids, branched-chain amino acids isoleucine, threonine, methionine, and valine and other metabolites. Propionyl-CoA carboxylase catalyzes the carboxylation of propionyl- CoA/propanoyl-CoA to D-methylmalonyl-CoA/(S)-methylmalonyl-CoA (By similarity). Within the holoenzyme, the alpha subunit catalyzes the ATP-dependent carboxylation of the biotin carried by the biotin carboxyl carrier (BCC) domain, while the beta subunit then transfers the carboxyl group from carboxylated biotin to propionyl-CoA (By similarity). Propionyl-CoA carboxylase also significantly acts on butyryl-CoA/butanoyl-CoA, which is converted to ethylmalonyl-CoA/(2S)- ethylmalonyl-CoA (By similarity). Other alternative minor substrates include (2E)-butenoyl-CoA/crotonoyl-CoA (By similarity).
catalytic activity: propanoyl-CoA + hydrogencarbonate + ATP = (S)-methylmalonyl- CoA + ADP + phosphate + H(+) (RHEA:23720)
catalytic activity: butanoyl-CoA + hydrogencarbonate + ATP = (2S)-ethylmalonyl-CoA + ADP + phosphate + H(+) (RHEA:59520)
cofactor: Mg(2+) Mn(2+) (Binds 2 magnesium or manganese ions per subunit.)
cofactor: biotin
subunit: The holoenzyme is a dodecamer composed of 6 PCCA/alpha subunits and 6 PCCB/beta subunits (By similarity). Interacts (via the biotin carboxylation domain) with SIRT4 (PubMed:23438705). Interacts with SIRT3 and SIRT5 (PubMed:23438705). - ISG15 Is a Novel Regulator of Lipid Metabolism during Vaccinia Virus Infection.
Albert, Microbiology spectrum 2022 - “...Q99MN9 Pccb Propionyl-CoA carboxylase beta chain, mitochondrial 10.02 P51174 Acadl Long-chain-specific acyl-CoA dehydrogenase, mitochondrial 8.64 Q91ZA3 Pcca Propionyl-CoA carboxylase alpha chain, mitochondrial 8.63 Q9EPL9 Acox3 Peroxisomal acyl-coenzyme A oxidase 3 8.62 Q8QZT1 Acat1 Acetyl-CoA acetyltransferase, mitochondrial 7.71 Q9Z2Z6 Slc25a20 Mitochondrial carnitine/acylcarnitine carrier protein 6.67 Q9JHI5 Ivd...”
- A Quantitative Proteomics Approach to Gain Insight into NRF2-KEAP1 Skeletal Muscle System and Its Cysteine Redox Regulation
Abu, Genes 2021 - “...Protein Log 2 FC Nrf2-KO Log 2 FC Keap1-KO Q9CXV1 Sdhd 1.87569 a 1.48549 b Q91ZA3 Pcca 1.69494 a 1.65623 b Q70IV5 Synm 1.67506 a 1.58577 b Q9JMH6 Txnrd1 1.38643 b 1.5322 a P15626 Gstm2 2.18014 b 1.4955 a Q9D6Y9 Gbe1 8.56657 b 3.97791 a a...”
- Action potential-coupled Rho GTPase signaling drives presynaptic plasticity
O'Neil, eLife 2021 - “...expression levels were intensity-scaled to the endogenously biotinylated proteins, pyruvate carboxylase (Q05920) and propionyl-CoA carboxylase (Q91ZA3). Imputation of missing values was performed after normalization ( Karpievitch et al., 2012 ) using the MinDet method ( Lazar et al., 2016 ). Missing values were replaced by the...”
- The role of cellular prion protein in lipid metabolism in the liver
Arora, Prion 2020 - “...155 1.59 0.031 5.16 4 Not identified 4.65 0.025 5 Propionyl-CoA carboxylase alpha chain, mitochondrial Q91ZA3 79.92 17.70% 17 1.58 0.04 6.04 Male 14-month-old mice 6 U5 small nuclear ribonucleoprotein 200 kDa helicase Q6P4T2 244.55 12.30% 36 1.77 0.012 5.73 7 3-mercaptopyruvate sulfurtransferase Q99J99 33.02 67.30%...”
- Environmental Enrichment Upregulates Striatal Synaptic Vesicle-Associated Proteins and Improves Motor Function
Song, Frontiers in neurology 2018 - “...gamma PIP5K1C 1.51 P32037 Solute carrier family 2, facilitated glucose transporter member 3 SLC2A3 1.51 Q91ZA3 Propionyl-CoA carboxylase alpha chain, mitochondrial PCCA 1.51 E9Q035 Protein Gm20425 GM20425 1.51 Q7TMY8-4 Isoform 4 of E3 ubiquitin-protein ligase HUWE1 HUWE1 1.51 D3YU23 Latrophilin-3 LPHN3 1.51 Q8C1A5 Thimet oligopeptidase THOP1...”
- Adenosine A1 receptor activation increases myocardial protein S-nitrosothiols and elicits protection from ischemia-reperfusion injury in male and female hearts
Shao, PloS one 2017 - “...1 P09542 191 85, 191 ND 85, 191 ND ND Propionyl CoA carboxylase alpha chain Q91ZA3 107 107 107 107 107 107 Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 O55143 349, 364, 447, 471 344, 349, 364, 447, 471, 635, 669 364, 635 344, 364, 447, 635, 998...”
- Characterization of the sex-dependent myocardial S-nitrosothiol proteome
Shao, American journal of physiology. Heart and circulatory physiology 2016 - “...75 (ND), 92 (ND), 727 (ND) 85 (ND) 85 (ND), 191 (ND) Q91ZA3 O55143 107 (ND) 344 (3.02) P07724 77 (ND), 289 (ND) 77 (ND), 289 (ND), 301 (ND), 302 (ND), 501 (ND),...”
- Apigenin Attenuates Atherogenesis through Inducing Macrophage Apoptosis via Inhibition of AKT Ser473 Phosphorylation and Downregulation of Plasminogen Activator Inhibitor-2.
Zeng, Oxidative medicine and cellular longevity 2015 - “...(25) 71270 6.23 Guanylate-binding protein 4 4 P12265 (BGLR_MOUSE) 143 (28) 74648 6.22 Beta-glucuronidase 5 Q91ZA3 (PCCA_MOUSE) 80 (27) 80498 6.83 Propionyl-CoA carboxylase alpha chain, mitochondrial 6 P58252 (EF2_MOUSE) 264 (27) 96222 6.41 Elongation factor 2 7 N/A e 8 P60710 (ACTB_MOUSE) 79 (26) 42052 5.29...”
- More
Pcca / P14882 propionyl-CoA carboxylase α subunit (EC 6.4.1.3) from Rattus norvegicus (see paper)
P14882 Propionyl-CoA carboxylase alpha chain, mitochondrial from Rattus norvegicus
95% identity, 98% coverage
- Proteomic mapping reveals dysregulated angiogenesis in the cerebral arteries of rats with early-onset hypertension
Bastrup, The Journal of biological chemistry 2023 - “...and casein kinase substrate in neurons 2 protein 0.32 13.94 1.51E-04 1.12E-02 Pcca Isoform of P14882, propanoyl-CoA:carbon dioxide ligase subunit alpha; propionyl-CoA carboxylase alpha chain, mitochondrial 0.20 15.31 5.55E-04 2.53E-02 Pccb Propionyl-CoA carboxylase beta chain, mitochondrial; isoform of P07633, propionyl coenzyme A carboxylase, beta polypeptide 0.26...”
- Extracellular vesicles released by steatotic hepatocytes alter adipocyte metabolism
Mleczko, Journal of extracellular biology 2022 - “...CP2CN_RAT P24470 1.75 8.02E03 Cytochrome P450 2C23 PDIA3_RAT P11598 1.75 5.38E05 Protein disulfideisomerase A3 PCCA_RAT P14882 1.77 1.95E03 PropionylCoA carboxylase alpha chain, mitochondrial ANGL4_RAT Q6TMA8 1.77 3.93E03 Angiopoietinrelated protein 4 HMGCL_RAT P97519 1.78 1.01E03 HydroxymethylglutarylCoA lyase, mitochondrial SDC4_RAT P34901 1.78 1.17E04 Syndecan4 CP2DQ_RAT P10634 1.79 1.03E03...”
- Proteomic analysis of spinal cord tissue in a rat model of cancer-induced bone pain.
Yang, Frontiers in molecular neuroscience 2022 - “...E9PU28 Impdh2 0.13 3.0 Down Q6IFU8 Krt17 0.13 3.0 Down Q6KC51 Ablim2 0.13 3.0 Down P14882 Pcca 0.13 3.0 Down Q5M819 Psph 0.13 3.0 Down Q704S8 Crat 0.13 2.9 Down P63269 Actg2 0.13 2.9 Down P62738 Acta2 0.13 2.9 Down Functional classification of differentially expressed protein...”
- Functional Redox Proteomics Reveal That Salvia miltiorrhiza Aqueous Extract Alleviates Adriamycin-Induced Cardiomyopathy via Inhibiting ROS-Dependent Apoptosis.
Hung, Oxidative medicine and cellular longevity 2020 - “...May play a role in the control of cell proliferation and cellular aging. 3 PCCA P14882 82.198/7.59 113 (32%) 16 Mitochondrion matrix This is one of the 2 subunits of the biotin-dependent propionyl-CoA carboxylase (PCC), a mitochondrial enzyme involved in the catabolism of odd chain fatty...”
- Functional proteomic analysis of corticosteroid pharmacodynamics in rat liver: Relationship to hepatic stress, signaling, energy regulation, and drug metabolism.
Ayyar, Journal of proteomics 2017 - “...UP P57093 Phyh Phytanoyl-CoA dioxygenase, peroxisomal Fatty acid metabolism - converts phytanoyl-CoA to 2-hydroxyphytanoyl-CoA UP P14882 Pcca Propionyl-CoA carboxylase alpha chain, mitochondrial Fatty acid beta oxidation - catalyses the carboxylation reaction of propionyl CoA to form (S)-methylmalonyl CoA UP P70584 Acadsb Short/branched chain acyl-CoA dehydrogenase, mitochondrial...”
- The Proteome Profiles of the Cerebellum of Juvenile, Adult and Aged Rats--An Ontogenetic Study
Wille, International journal of molecular sciences 2015 - “...Gmps GMP synthase (glutamine-hydrolyzing) Cp up 0.0062 - - 0.52 5 130 17 77,507 6.21 P14882 PCCA_RAT Pcca Propionyl-CoA carboxylase alpha chain, mitochondrial Mmt down 0.0283 - - 2.14 5 262 32 82,198 7.59 Fat Metabolism Q5XI22 THIC_RAT Acat2 Acetyl-CoA acetyltransferase, cytosolic Cp - - up...”
- Identification of εPKC targets during cardiac ischemic injury
Budas, Circulation journal : official journal of the Japanese Circulation Society 2012 - “...225 83kDa 6.18 75kDa 6.35 5.1 mitochondria 0.02* 8 Propionyl-CoA carboxylase alpha chain, mitochondrial precursor P14882 12 78 77kDa 6.33 69kDa 6.41 5.1 mitochondria 0.02* 9 Dihydrolipoyl dehydrogenase, mitochondrial precursor Q6P6R2 13 207 54kDa 7.96 48kDa 7.33 4.1 mitochondria 0.01* 10 ATP synthase subunit alpha, mitochondrial...”
- Use of biotinylated ubiquitin for analysis of rat brain mitochondrial proteome and interactome.
Buneeva, International journal of molecular sciences 2012 - “...beta chain, mitochondrial precursor P07633 13 67.94 M 2 Propionyl-CoA carboxylase alpha chain, mitochondrial precursor P14882 5 37.33 M Transporters ( n = 4) 1 Excitatory amino acid transporter 1 P24942 6 34.57 PM 2 Excitatory amino acid transporter 2 P31596 2 26.35 PM 3 Glial...”
- “...P26284, Dlat = P08461, Hspd1 = P63039, Hspe1 = P26772, Slc25a5 = Q09073, Pcca = P14882, Pccb = P07633, Atp1a2 = P06686, Atp1a1 = P06685, Nefm = P12839, Nefl = P19527, Camk2a = P11275, Ina = P23565, Gfap = P47819, Slc1a3 = P24942, ENSRNOG00000018630 = Q0QEU1,...”
- More
A0A0G2K401 Propionyl-CoA carboxylase alpha chain, mitochondrial from Rattus norvegicus
94% identity, 100% coverage
PCCA / P05165 propionyl-CoA carboxylase α chain, mitochondrial (EC 6.4.1.3) from Homo sapiens (see 4 papers)
PCCA_HUMAN / P05165 Propionyl-CoA carboxylase alpha chain, mitochondrial; PCCase subunit alpha; Propanoyl-CoA:carbon dioxide ligase subunit alpha; EC 6.4.1.3 from Homo sapiens (Human) (see 11 papers)
P05165 propionyl-CoA carboxylase (subunit 1/2) (EC 6.4.1.3) from Homo sapiens (see paper)
NP_000273 propionyl-CoA carboxylase alpha chain, mitochondrial isoform a precursor from Homo sapiens
89% identity, 99% coverage
- function: This is one of the 2 subunits of the biotin-dependent propionyl-CoA carboxylase (PCC), a mitochondrial enzyme involved in the catabolism of odd chain fatty acids, branched-chain amino acids isoleucine, threonine, methionine, and valine and other metabolites (PubMed:6765947, PubMed:8434582). Propionyl-CoA carboxylase catalyzes the carboxylation of propionyl-CoA/propanoyl-CoA to D-methylmalonyl- CoA/(S)-methylmalonyl-CoA (PubMed:10101253, PubMed:6765947, PubMed:8434582). Within the holoenzyme, the alpha subunit catalyzes the ATP-dependent carboxylation of the biotin carried by the biotin carboxyl carrier (BCC) domain, while the beta subunit then transfers the carboxyl group from carboxylated biotin to propionyl-CoA (By similarity). Propionyl-CoA carboxylase also significantly acts on butyryl-CoA/butanoyl-CoA, which is converted to ethylmalonyl-CoA/(2S)- ethylmalonyl-CoA at a much lower rate (PubMed:6765947). Other alternative minor substrates include (2E)-butenoyl-CoA/crotonoyl-CoA (By similarity).
catalytic activity: propanoyl-CoA + hydrogencarbonate + ATP = (S)-methylmalonyl- CoA + ADP + phosphate + H(+) (RHEA:23720)
catalytic activity: butanoyl-CoA + hydrogencarbonate + ATP = (2S)-ethylmalonyl-CoA + ADP + phosphate + H(+) (RHEA:59520)
cofactor: Mg(2+) Mn(2+) (Binds 2 magnesium or manganese ions per subunit.)
cofactor: biotin
subunit: The holoenzyme is a dodecamer composed of 6 PCCA/alpha subunits and 6 PCCB/beta subunits (PubMed:20725044, PubMed:6765947). Interacts (via the biotin carboxylation domain) with SIRT4 (PubMed:23438705). Interacts with SIRT3 and SIRT5 (PubMed:23438705). - Raphe and ventrolateral medulla proteomics in sudden unexplained death in childhood with febrile seizure history
Leitner, Acta neuropathologica 2024 - “...1.3 RPL12 60S ribosomal protein L12 P30050 4.07E04 1.4 PCCA Propionyl-CoA carboxylase alpha chain, mitochondrial P05165 5.33E04 1.2 VAMP2 Vesicle-associated membrane protein 2 P63027 6.15E04 1.7 CCT3 T-complex protein 1 subunit gamma P49368 7.86E04 1.1 ATP6V1D V-type proton ATPase subunit D Q9Y5K8 8.20E04 1.2 FARSA PhenylalaninetRNA...”
- Generation and Characterization of Trastuzumab/Pertuzumab-Resistant HER2-Positive Breast Cancer Cell Lines.
Sanz-Álvarez, International journal of molecular sciences 2023 - “...0.32 1.65 10 28 426 P18564 ITGB6 Integrin beta 6 0.33 1.59 3 5 103 P05165 PCCA Propionyl-CoA carboxylase alpha chain, mitochondrial 0.34 1.57 7 10 144 Q8IW45 NAXD ATP-dependent (S)-NAD(P)H-hydrate dehydratase 0.37 1.44 5 10 163 Q96AY3 FKBP10 Peptidyl-prolyl cis/trans isomerase FKBP10 0.38 1.41 14...”
- Interactome Analysis of the ER Stress Sensor Perk Uncovers Key Components of ER-Mitochondria Contact Sites and Ca2+ Signalling
Sassano, Contact (Thousand Oaks (Ventura County, Calif.)) 2021 - “...94 31 100% 100% Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Homo sapiens OX=9606 GN=PCCA PE=1 SV=4 P05165 PCCA 80 kDa 117 49 114 45 100% 100% Pyruvate carboxylase, mitochondrial OS=Homo sapiens OX=9606 GN=PC PE=1 SV=2 P11498 PC 130 kDa 122 54 121 49 100% 100% Considering our...”
- Proteome biology of primary colorectal carcinoma and corresponding liver metastases.
Fahrner, Neoplasia (New York, N.Y.) 2021 - “...0.917 2.35E-04 7.92E-03 PLG Plasminogen O95671 1.631 1.89E-06 4.55E-04 ASMTL Probable bifunctional dTTP/UTP pyrophosphatase/methyltransferase protein P05165 0.69 2.54E-03 3.95E-02 PCCA Propionyl-CoA carboxylase alpha chain P00734 0.896 2.93E-03 4.29E-02 F2 Prothrombin P11498 2.044 7.18E-07 2.77E-04 PC Pyruvate carboxylase Q99575 0.746 4.31E-04 1.14E-02 POP1 Ribonucleases P/MRP protein subunit...”
- Cigarette smoke extract stimulates bronchial epithelial cells to undergo a SUMOylation turnover.
Zhou, BMC pulmonary medicine 2020 - “...Down NACA P15104 Glutamine synthetase 0.336 Down GLUL P20290 Transcription factor BTF3 0.337 Down BTF3 P05165 Propionyl-CoA carboxylase alpha chain, mitochondrial 0.345 Down PCCA P08865 40S ribosomal protein SA 0.407 Down RPSA P16401 Histone H1.5 0.407 Down HIST1H1B P67809 Nuclease-sensitive element-binding protein 1 0.426 Down YBX1...”
- Investigating the structural impacts of a novel missense variant identified with whole exome sequencing in an Egyptian patient with propionic acidemia.
Ibrahim, Molecular genetics and metabolism reports 2020 - “...The protein sequence for the PCCA was obtained from the UniProt database with the ID P05165 [ 11 ]. The PCCA protein lacks the crystal structure in the public databases to date. Henceforth, the protein sequence obtained from the UniProt database was used to build the...”
- SAMHD1 Posttranscriptionally Controls the Expression of Foxp3 and Helios in Human T Regulatory Cells.
Kim, Journal of immunology (Baltimore, Md. : 1950) 2018 - “...MCCA_HUMAN 249.9351293 (Q96RQ3) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial Mitochondrial enzymes with Biotin cofactor PCCA_HUMAN 93.580363 (P05165) Propionyl-CoA carboxylase alpha chain, mitochondrial Mitochondrial enzymes with Biotin cofactor DLDH_HUMAN 165.104467 (P09622) Dihydrolipoyldehydrogenase, mitochondrial Photo damage-related proteins ARGI1_HUMAN 349.6449536 (P05089) Arginase-1 Photo damage-related proteins CASPE_HUMAN 198.6111486 (P31944) Caspase-14 Heterogeneous...”
- Combining patient proteomics and in vitro cardiomyocyte phenotype testing to identify potential mediators of heart failure with preserved ejection fraction
Raphael, Journal of translational medicine 2016 - “...YP010 Q96M66 Putative uncharacterized protein FLJ32790 PSMD4 P55036 26S proteasome non-ATPase regulatory subunit 4 PCCA P05165 Propionyl-CoA carboxylase alpha chain, mitochondrial TCPR2 O15040 Tectonin beta-propeller repeat-containing protein KPRP Q5T749 Keratinocyte proline-rich protein GTPB5 Q9H4K7 GTP-binding protein 5 CV031 O95567 Uncharacterized protein C22orf31 TFB2M Q9H5Q4 Dimethyladenosine transferase...”
- More
- The mitochondrial carboxylase PCCA interacts with Listeria monocytogenes phospholipase PlcB to modulate bacterial survival.
Wang, Applied and environmental microbiology 2024 - GeneRIF: The mitochondrial carboxylase PCCA interacts with Listeria monocytogenes phospholipase PlcB to modulate bacterial survival.
- A novel small molecule approach for the treatment of propionic and methylmalonic acidemias.
Armstrong, Molecular genetics and metabolism 2021 - GeneRIF: A novel small molecule approach for the treatment of propionic and methylmalonic acidemias.
- Functional Analysis of the PCCA and PCCB Gene Variants Predicted to Affect Splicing.
Bychkov, International journal of molecular sciences 2021 - GeneRIF: Functional Analysis of the PCCA and PCCB Gene Variants Predicted to Affect Splicing.
- Identification of 34 novel mutations in propionic acidemia: Functional characterization of missense variants and phenotype associations.
Rivera-Barahona, Molecular genetics and metabolism 2018 (PubMed)- GeneRIF: his work represents a large-scale update on pathogenic mutations in the PCCA and PCCB genes causing Propionic acidemia (PA), and confirms previous reports indicating a major causative role of mutation-induced protein destabilization
- Seventeen Novel Mutations in PCCA and PCCB Genes in Indian Propionic Acidemia Patients, and Their Outcomes.
Gupta, Genetic testing and molecular biomarkers 2016 (PubMed)- GeneRIF: The majority of patients had mutations in the PCCA gene (18/25). A total of 26 mutations were noted: 20 in the PCCA gene and 6 in PCCB gene. Seventeen mutations were novel (14 in PCCA and 3 in PCCB). The SNP c.937C>T (p.Arg313Ter), was noted in 9/36 (25%) alleles in the PCCA gene
- Frameshift mutations of OGDH, PPAT and PCCA genes in gastric and colorectal cancers.
Jo, Neoplasma 2016 (PubMed)- GeneRIF: The data indicate that amino acid/nucleotide metabolism-related genes OGDH, PPAT and PCCA acquire somatic mutations in microsatellite instability-high gastric cancers and colorectal cancers and that mutational intratumoral heterogeneity may occur in at least some of these tumors.
- [Analysis of PCCA and PCCB gene mutations in patients with propionic acidemia].
Chen, Zhonghua yi xue yi chuan xue za zhi = Zhonghua yixue yichuanxue zazhi = Chinese journal of medical genetics 2015 (PubMed)- GeneRIF: Ten propionic acidemia mutations were confirmed, including 8 affecting the PCCA gene and 2 affecting the PCCB gene
- Clinical characteristics and mutation analysis of propionic acidemia in Thailand.
Vatanavicharn, World journal of pediatrics : WJP 2014 (PubMed)- GeneRIF: Mutation analysis of the PCCA gene identified homozygous c.1284+1G>A in patient 1, c.230G>A (p.R77Q) and c.1855C>T (p.R619X) in patient 2, homozygous c.2125T>C (p.S709P) in patient 3, and only one mutant allele, c.231+1G>T in patient 4.
- More
A0A8I3S647 Propionyl-CoA carboxylase alpha chain, mitochondrial from Canis lupus familiaris
89% identity, 99% coverage
PCCA_PIG / P0DTA4 Propionyl-CoA carboxylase alpha chain, mitochondrial; PCCase subunit alpha; Propanoyl-CoA:carbon dioxide ligase subunit alpha; EC 6.4.1.3 from Sus scrofa (Pig) (see paper)
88% identity, 99% coverage
- function: This is one of the 2 subunits of the biotin-dependent propionyl-CoA carboxylase (PCC), a mitochondrial enzyme involved in the catabolism of odd chain fatty acids, branched-chain amino acids isoleucine, threonine, methionine, and valine and other metabolites (PubMed:13752080). Propionyl-CoA carboxylase catalyzes the carboxylation of propionyl-CoA/propanoyl-CoA to D-methylmalonyl- CoA/(S)-methylmalonyl-CoA (PubMed:13752080). Within the holoenzyme, the alpha subunit catalyzes the ATP-dependent carboxylation of the biotin carried by the biotin carboxyl carrier (BCC) domain, while the beta subunit then tranfers the carboxyl group from carboxylated biotin to propionyl-CoA (By similarity). Propionyl-CoA carboxylase also significantly acts on butyryl-CoA/butanoyl-CoA, which is converted to ethylmalonyl-CoA/(2S)-ethylmalonyl-CoA at a much lower rate (PubMed:13752080). Other alternative minor substrates include (2E)- butenoyl-CoA/crotonoyl-CoA (PubMed:13752080).
catalytic activity: propanoyl-CoA + hydrogencarbonate + ATP = (S)-methylmalonyl- CoA + ADP + phosphate + H(+) (RHEA:23720)
catalytic activity: butanoyl-CoA + hydrogencarbonate + ATP = (2S)-ethylmalonyl-CoA + ADP + phosphate + H(+) (RHEA:59520)
cofactor: Mg(2+) Mn(2+) (Binds 2 magnesium or manganese ions per subunit.)
cofactor: biotin
subunit: The holoenzyme is a dodecamer composed of 6 PCCA/alpha subunits and 6 PCCB/beta subunits. Interacts (via the biotin carboxylation domain) with SIRT4. Interacts with SIRT3 and SIRT5. - Label-Free Quantitative Analysis of Pig Liver Proteome after Hepatitis E Virus Infection
Martino, Viruses 2024 - “...phosphoenolpyruvate carboxykinase, cytosolic [GTP] 18 98.33 0.0036 2.90 P26234 VCL Vinculin 18 63.18 0.0007 2.28 P0DTA4 PCCA propionyl-CoA carboxylase alpha chain, mitochondrial 18 78.68 0.0025 1.98 A0A8D1MNH9 SPTAN1 spectrin alpha chain, non-erythrocytic 1 17 65.06 0.0000 2.68 P33198 IDH2 isocitrate dehydrogenase, mitochondrial 16 66.34 0.0113 1.53...”
B2RDE0 Propionyl-CoA carboxylase alpha chain, mitochondrial from Homo sapiens
91% identity, 96% coverage
7ybuA / P05165 Human propionyl-coenzyme a carboxylase (see paper)
92% identity, 92% coverage
- Ligand: 5-(hexahydro-2-oxo-1h-thieno[3,4-d]imidazol-6-yl)pentanal (7ybuA)
F1KUZ6 Propionyl-CoA carboxylase alpha chain, mitochondrial from Ascaris suum
58% identity, 93% coverage
PCCA_CAEEL / Q19842 Propionyl-CoA carboxylase alpha chain, mitochondrial; PCCase subunit alpha; Propanoyl-CoA:carbon dioxide ligase subunit alpha; EC 6.4.1.3 from Caenorhabditis elegans (see paper)
Q19842 propionyl-CoA carboxylase (subunit 2/2) (EC 6.4.1.3) from Caenorhabditis elegans (see paper)
NP_509293 Propionyl-CoA carboxylase alpha chain, mitochondrial from Caenorhabditis elegans
59% identity, 94% coverage
- function: This is one of the 2 subunits of the biotin-dependent propionyl-CoA carboxylase (PCC), a mitochondrial enzyme involved in the catabolism of odd chain fatty acids, branched-chain amino acids isoleucine, threonine, methionine, and valine and other metabolites. Propionyl-CoA carboxylase catalyzes the carboxylation of propionyl- CoA/propanoyl-CoA to D-methylmalonyl-CoA/(S)-methylmalonyl-CoA (By similarity). Within the holoenzyme, the alpha subunit catalyzes the ATP-dependent carboxylation of the biotin carried by the biotin carboxyl carrier (BCC) domain, while the beta subunit then transfers the carboxyl group from carboxylated biotin to propionyl-CoA (By similarity). Propionyl-CoA carboxylase also significantly acts on butyryl-CoA/butanoyl-CoA, which is converted to ethylmalonyl-CoA/(2S)- ethylmalonyl-CoA (By similarity). Other alternative minor substrates include (2E)-butenoyl-CoA/crotonoyl-CoA (By similarity).
catalytic activity: propanoyl-CoA + hydrogencarbonate + ATP = (S)-methylmalonyl- CoA + ADP + phosphate + H(+) (RHEA:23720)
catalytic activity: butanoyl-CoA + hydrogencarbonate + ATP = (2S)-ethylmalonyl-CoA + ADP + phosphate + H(+) (RHEA:59520)
cofactor: biotin
cofactor: Mg(2+) Mn(2+) (Binds 2 magnesium or manganese ions per subunit.)
subunit: The holoenzyme is a dodecamer composed of 6 alpha subunits and 6 beta subunits (By similarity). Interacts with sir-2.2 and sir-2.3 (PubMed:23438705). - Propionyl-CoA carboxylase pcca-1 and pccb-1 gene deletions in Caenorhabditis elegans globally impair mitochondrial energy metabolism.
Chapman, Journal of inherited metabolic disease 2018 - GeneRIF: Two C. elegans model animals of propionic acidemia with single-gene pcca-1 or pccb-1 deletions have reduced lifespan with significantly reduced mitochondrial energy metabolism and increased oxidative stress.
- Life cycle stage-resolved proteomic analysis of the excretome/secretome from Strongyloides ratti--identification of stage-specific proteases
Soblik, Molecular & cellular proteomics : MCP 2011 - “...2e 104 No 317 12.0 3 9.17 25 SR00383 Propionyl Coenzyme A Carboxylase C. elegans NP_509293 2e 17 No 76 50.0 3 9.10 1 SR01608 EF hand family protein Brugia malayi XP_001901161 2e 37 Yes 158 69.0 8 23.28 2 SR03191 Prolyl endopeptidase Rattus norvegicus EDL99674...”
- Altered proteostasis in aging and heat shock response in C. elegans revealed by analysis of the global and de novo synthesized proteome
Liang, Cellular and molecular life sciences : CMLS 2014 - “...0.8 0.4 Q22111 mmaa-1 Methylmalonic aciduria type A protein 4 0.7 0.4 4 0.8 0.3 Q19842 pcca-1 Propionyl coenzyme-A carboxylase alpha subunit 4 0.8 0.6 Q9U2M4 Y38F1A.6 Ortholog, human isoform 1, HOT 1 0.6 0.3 Q9U2M4 Y38F1A.6 Ortholog, human isoform 1, HOT 5 0.8 0.3 Ribosomal...”
- Proteomic analysis of Oesophagostomum dentatum (Nematoda) during larval transition, and the effects of hydrolase inhibitors on development
Ondrovics, PloS one 2013 - “...Cyathostominae A7LGW9 741 83 9*10 77 2 / Propionyl-CoA carboxylase alpha chain / Caenorhabditis elegans Q19842 / / / 3 / Propionyl-CoA carboxylase alpha chain / C. elegans Q19842 / / / 4+5 Oden_isotig22486 Phosphoenolpyruvate carboxy kinase GTP Putative uncharacterized protein C. briggsae A8WMQ5 787 80...”
Q612F5 Propionyl-CoA carboxylase alpha chain, mitochondrial from Caenorhabditis briggsae
59% identity, 92% coverage
G7YW97 Propionyl-CoA carboxylase alpha chain from Clonorchis sinensis
57% identity, 88% coverage
L7MAU7 Propionyl-CoA carboxylase alpha chain, mitochondrial (Fragment) from Rhipicephalus pulchellus
60% identity, 88% coverage
- Quantitative Proteomics Identifies Metabolic Pathways Affected by Babesia Infection and Blood Feeding in the Sialoproteome of the Vector Rhipicephalus bursa
Couto, Vaccines 2020 - “...potential protective antigens resulting in a vaccine candidate. The amino acid sequences of L7M1X7 and L7MAU7 were analyzed in silico in order to predict the protein localization (CELLO v.2.5 [ 50 ]), transmembrane domains (TMHMM v.2.0, based on a hidden Markov model [ 51 , 52...”
- “...a recombinant protein (based on L7M1X7, UB2N, 151 a.a.) and a peptide (VKTPEECVKIAQSIGYPVMIKASAGGGGKGMRIAWND based on L7MAU7, PCCA, 37 a.a.) were selected to be synthetically produced by GenScript Corporation (Piscataway, NJ, USA) for the polyclonal antibodies production and immunoassays. To increase peptide immunogenicity, an Imject Blue Carrier...”
Pden_3684 Carbamoyl-phosphate synthase L chain, ATP-binding from Paracoccus denitrificans PD1222
PDEN_RS18285 acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha from Paracoccus denitrificans
54% identity, 92% coverage
PCCA_RUEPO / Q5LUF3 Propionyl-CoA carboxylase alpha chain; EC 6.4.1.3 from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) (Silicibacter pomeroyi) (see paper)
Q5LUF3 propionyl-CoA carboxylase (EC 6.4.1.3) from Ruegeria pomeroyi (see paper)
53% identity, 92% coverage
- function: This is one of the 2 subunits of the biotin-dependent propionyl-CoA carboxylase (PCC), the enzyme catalyzing the carboxylation of propionyl-CoA/propanoyl-CoA to D-methylmalonyl- CoA/(S)-methylmalonyl-CoA (PubMed:20725044). Within the holoenzyme, the alpha subunit catalyzes the ATP-dependent carboxylation of the biotin carried by the biotin carboxyl carrier (BCC) domain, while the beta subunit then tranfers the carboxyl group from carboxylated biotin to propionyl-CoA (Probable).
catalytic activity: propanoyl-CoA + hydrogencarbonate + ATP = (S)-methylmalonyl- CoA + ADP + phosphate + H(+) (RHEA:23720)
cofactor: Mg(2+) Mn(2+) (Binds 2 magnesium or manganese ions per subunit.)
cofactor: biotin
subunit: The holoenzyme is a dodecamer composed of 6 PccA/alpha subunits and 6 PccB/beta subunits. - 3-methylcrotonyl-CoA carboxylase deficiency: clinical, biochemical, enzymatic and molecular studies in 88 individuals
Grünert, Orphanet journal of rare diseases 2012 - “...as well as the structurally characterized P. aeruginosa MCCC1 (paMCCC1, Q9I299), Ruegeria pomeroyi PCC (bPCCA, Q5LUF3), human ACC1 (hACC1, Q13085) and ACC2 (hACC2, O00763). Novel MCCC1 missense mutations are asterisked. The electrostatic interaction between Glu288 and Arg444 in MCCC1 is highlighted in green. Click here for...”
Dshi_0723 Propionyl-CoA carboxylase biotin-containing subunit (EC 6.4.1.3) from Dinoroseobacter shibae DFL-12
53% identity, 92% coverage
- mutant phenotype: Specifically important for utilizing Sodium propionate. Automated validation from mutant phenotype: the predicted function (PROPIONYL-COA-CARBOXY-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
pccA / Q3J4D9 propionyl-CoA carboxylase α subunit (EC 6.4.1.3) from Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) (see paper)
53% identity, 92% coverage
Q2RYD8 propionyl-CoA carboxylase from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Rru_A0052 Biotin carboxylase from Rhodospirillum rubrum ATCC 11170
54% identity, 92% coverage
- Study of the Production of Poly(Hydroxybutyrate-co-Hydroxyhexanoate) and Poly(Hydroxybutyrate-co-Hydroxyvalerate-co-Hydroxyhexanoate) in Rhodospirillum rubrum
Cabecas, Applied and environmental microbiology 2022 (secret) - Genetic Plasticity and Ethylmalonyl Coenzyme A Pathway during Acetate Assimilation in Rhodospirillum rubrum S1H under Photoheterotrophic Conditions
De, Applied and environmental microbiology 2018 - “...5 6 3 Q2RPT8 Q2RPT6 Q2RV43 Q2RXX3 Q2RV44 Q2RYD8 Q2RYD7 Q2RRG6 Rru_A3062 Rru_A3064 Rru_A1201 Rru_A0217 Rru_A1200 Rru_A0052 Rru_A0053 Rru_A2479 1.4e3 3.4e4 2.1e4...”
- The metabolic pathways of carbon assimilation and polyhydroxyalkanoate production by Rhodospirillum rubrum in response to different atmospheric fermentation
Tang, PloS one 2024 - “...1.11E-11 2.518 Calvin-Benson-Bassham cycle Rru_A2400 Ribulose bisphosphate carboxylase 0.015 1.137 ND ND methylmalonyl-CoA (MMC) pathway Rru_A0052 Biotin carboxylase ND ND 1.18E-90 2.350 Rru_A0053 Carboxyl transferase ND ND 2.41E-83 2.305 Rru_A2318 2-methylcitrate dehydratase 1.72E-49 5.708 4.62E-28 3.536 Rru_A2320 Phosphoenolpyruvate phosphomutase 6.41E-28 4.305 6.84E-11 1.857 Rru_A2319 2-methylcitrate synthase/Citrate...”
- Effects of Mixing Volatile Fatty Acids as Carbon Sources on Rhodospirillum rubrum Carbon Metabolism and Redox Balance Mechanisms
Cabecas, Microorganisms 2021 - “...Figure 3 ), confirming the previous reports [ 18 ]. This pathway requires five enzymes (Rru_A0052, Rru_A0053, Rru_A1572, Rru_A2480, Rru_A1927), among which three were significantly more abundant in propionate conditions than in butyrate conditions: the biotin carboxylase (Rru_A0052, fold change: 0.63), the methylmalonyl-CoA mutase (Rru_A2480, fold...”
- “...Change (Mix Butyrate/Mix Propionate) ** P-Value No. of Identified Peptides *** Description Methylmalonyl-CoA pathway tr|Q2RYD8 Rru_A0052 0.63 3.41 10 2 1.81 9.50 10 3 5 Biotin carboxylase tr|Q2RYD7 Rru_A0053 0.83 8.70 10 2 1.81 4.95 10 2 6 Carboxyl transferase tr|Q2RU23 Rru_A1572 1.30 3.49 10 1...”
- Photoheterotrophic Assimilation of Valerate and Associated Polyhydroxyalkanoate Production by Rhodospirillum rubrum
Bayon-Vicente, Applied and environmental microbiology 2020 (secret) - New perspectives on butyrate assimilation in Rhodospirillum rubrum S1H under photoheterotrophic conditions
De, BMC microbiology 2020 - “...Rru_A1200 Malyl-CoA thioesterase 1.3 2e-02 6 0.8 2e-03 1.0 8e-01 1.1 9e-02 1.1 3e-02 6 Rru_A0052 Biotin carboxylase 1.2 7e-02 6 0.8 3e-05 0.9 4e-02 1.0 1e-01 1.1 1e-02 6 Rru_A0053 Carboxyl transferase 1.2 8e-03 6 0.8 8e-05 0.9 2e-02 1.0 1e-01 1.1 9e-03 6 Rru_A2479...”
- “...3.42 2e-07 Rru_A0217 L-Malyl-CoA/b-methylmalyl-CoA lyase 0.05 3.11 1e-05 Rru_A1200 b Malyl-CoA thioesterase n.a. n.a. n.a. Rru_A0052 Biotin carboxylase 0.03 1.83 2e-05 Rru_A0053 Carboxyl transferase 0.09 1.77 2e-04 Rru_A2479 Methylmalonyl-CoA mutase 0.12 0.53 1e-02 Rru_A1927 Acetyl-CoA hydrolase 0.01 0.1 3e-01 Rru_A2129 Fumarate hydratase class II 0.15 0.03...”
- Genetic Plasticity and Ethylmalonyl Coenzyme A Pathway during Acetate Assimilation in Rhodospirillum rubrum S1H under Photoheterotrophic Conditions
De, Applied and environmental microbiology 2018 - “...Rru_A3062 Rru_A3064 Rru_A1201 Rru_A0217 Rru_A1200b Rru_A0052 Rru_A0053 Rru_A2479 Locus Ethylmalonyl-CoA pathway Rru_A1927 Rru_A2964 Rru_A3063 Rru_A1572a...”
- “...Q2RYD7 Q2RRG6 Rru_A3062 Rru_A3064 Rru_A1201 Rru_A0217 Rru_A1200 Rru_A0052 Rru_A0053 Rru_A2479 1.4e3 3.4e4 2.1e4 3.3e4 5.1e4 1.2e6 4.4e6 3.4e1 7.89 6.37 1.34...”
RSP_2191 Propionyl-CoA carboxylase alpha subunit from Rhodobacter sphaeroides 2.4.1
53% identity, 92% coverage
3n6rG / Q5LUF3 Crystal structure of the holoenzyme of propionyl-coa carboxylase (pcc) (see paper)
52% identity, 92% coverage
- Ligand: 5-(hexahydro-2-oxo-1h-thieno[3,4-d]imidazol-6-yl)pentanal (3n6rG)
BLJAPNOD_06206 acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha from Ensifer sp. M14
53% identity, 92% coverage
Pnuc_0913 acetyl-CoA carboxylase, biotin carboxylase from Polynucleobacter sp. QLW-P1DMWA-1
51% identity, 92% coverage
DDB_G0275355 propanoyl-CoA:carbon dioxide ligase alpha subunit from Dictyostelium discoideum AX4
53% identity, 92% coverage
A4HRC6 propionyl-CoA carboxylase from Leishmania infantum
51% identity, 92% coverage
8sgxX / A0A640KC69 Leishmania tarentolae propionyl-coa carboxylase (alpha-4-beta-6) (see paper)
51% identity, 92% coverage
- Ligand: 5-(hexahydro-2-oxo-1h-thieno[3,4-d]imidazol-6-yl)pentanal (8sgxX)
Dsui_0516 Propionyl-CoA carboxylase biotin-containing subunit (EC 6.4.1.3) from Dechlorosoma suillum PS
51% identity, 92% coverage
- mutant phenotype: Specifically important for utilizing Sodium propionate. Automated validation from mutant phenotype: the predicted function (PROPIONYL-COA-CARBOXY-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
WD0433 propionyl-CoA carboxylase, alpha subunit from Wolbachia endosymbiont of Drosophila melanogaster
42% identity, 92% coverage
Q5GSI1 Propionyl-CoA carboxylase alpha chain, mitochondrial from Wolbachia sp. subsp. Brugia malayi (strain TRS)
43% identity, 92% coverage
MCCA_ARATH / Q42523 Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial; MCCase subunit alpha; 3-methylcrotonyl-CoA carboxylase 1; 3-methylcrotonyl-CoA:carbon dioxide ligase subunit alpha; EC 6.4.1.4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
Q42523 methylcrotonoyl-CoA carboxylase (EC 6.4.1.4) from Arabidopsis thaliana (see 2 papers)
NP_849583 methylcrotonyl-CoA carboxylase alpha chain from Arabidopsis thaliana
AT1G03090 MCCA; methylcrotonoyl-CoA carboxylase from Arabidopsis thaliana
41% identity, 92% coverage
- function: Biotin-attachment subunit of the 3-methylcrotonyl-CoA carboxylase, an enzyme that catalyzes the conversion of 3- methylcrotonyl-CoA to 3-methylglutaconyl-CoA, a critical step for leucine and isovaleric acid catabolism.
catalytic activity: 3-methyl-(2E)-butenoyl-CoA + hydrogencarbonate + ATP = 3- methyl-(2E)-glutaconyl-CoA + ADP + phosphate + H(+) (RHEA:13589)
cofactor: biotin
cofactor: Mn(2+) (Binds 2 manganese ions per subunit.)
subunit: Probably a heterodimer composed of biotin-containing alpha subunits and beta subunits. - Genetic dissection of methylcrotonyl CoA carboxylase indicates a complex role for mitochondrial leucine catabolism during seed development and germination.
Ding, The Plant journal : for cell and molecular biology 2012 (PubMed)- GeneRIF: Studies indicate that mutations in either 3-methylcrotonyl CoA carboxylase MCCA (At1g03090) or MCCB (At4g34030) block mitochondrial Leu catabolism, as inferred from the increased accumulation of Leu.
- Changes in annual transcriptome dynamics of a clone of Japanese cedar (Cryptomeria japonica D. Don) planted under different climate conditions
Nose, PloS one 2023 - “...- - - Uncharacterised conserved protein (UCP012943) temp-30d -0.76 1.14E-15 CUST_6388_PI429951308 reCj20995:-SWR:isotig20847 8.75E-17 4.82E-14 2.61E-17 AT1G03090 0.0 MCCA methylcrotonyl-CoA carboxylase alpha chain, mitochondrial / 3-methylcrotonyl-CoA carboxylase 1 temp-0h -0.76 1.15E-15 CUST_3521_PI429951308 reCj18106:--WR:isotig17958 1.90E-15 3.21E-14 3.30E-16 AT5G45140 0.0 NRPC2 nuclear RNA polymerase C2 temp-0h -0.76 1.34E-15 CUST_11766_PI429951308...”
- Cadaverine regulates biotin synthesis to modulate primary root growth in Arabidopsis
Gibbs, The Plant journal : for cell and molecular biology 2021 - “...in the EMBL/GenBank data libraries under accession numbers: BIO3BIO1 (AT5G57590), BIO2 (AT2G43360), BIO4 (AT5G04620), MCCA (AT1G03090), BCCP1 (AT5G16390), PAO4 (AT1G65840), OCT1 (AT1G73220), PP2A (AT1G69960), and RPT4A (AT5G43010). AUTHOR CONTRIBUTIONS NMG, HAM, and PHM designed the research; NMG, SHS, SLN, SM, and CA performed the research; NMG,...”
- Network Topological Analysis for the Identification of Novel Hubs in Plant Nutrition
Di, Frontiers in plant science 2021 - “...helicase A0A0A0L0B9 Csa_4G082380 MBL1 (AT1G78850) 50% 434 3,9 2,1E-02 39 Mannose-binding lectin A0A0A0K5L0 Csa_7G387180 MCCA (AT1G03090) 69% 1023 38 4 3 10 Methyl crotonyl-CoA carboxylase subunit alpha A0A0A0KJ29 Csa_6G526470 AT3G58140 74% 657 36 Phenylalanyl-tRNA synthetase A0A0A0KCX8 Csa_6G077980 ARGAH1 (AT4G08900) 85% 590 34 1 0 4 Arginase...”
- The function of glutaredoxin GRXS15 is required for lipoyl-dependent dehydrogenases in mitochondria
Moseler, Plant physiology 2021 - “...replicates using the program GraphPad Prism version 6. Accession numbers GRXS15 (At3g15660), BIO2 (At2g43360), MCCA (At1g03090), ATM3 (At5g58270), CNX2 (At2g31955), CNX3 (At1g01290), NR1 (At1g77760), NR2 (At1g37130), AAO1 (At5g20960), AAO2 (At3g43600), AAO3 (At2g27150), XDH1 (At4g34890) XDH2 (At4g34900), ACO1 (At4g35830), ACO2 (At4g26970), ACO3 (At2g05710), mLIP1 (At2g20860), IVDH (At3g45300),...”
- What Antarctic Plants Can Tell Us about Climate Changes: Temperature as a Driver for Metabolic Reprogramming
Bertini, Biomolecules 2021 - “...AMINOPEPTIDASE 1) 9.74 10 4 1.60 AT5G58070 ATTIL, TIL, temperature-induced lipocalin 5.70 10 3 1.40 AT1G03090 MCCA, methylcrotonyl-CoA carboxylase alpha chain, mitochondrial/3-methylcrotonyl-CoA carboxylase 1 (MCCA) 7.70 10 3 1.28 AT1G54050 HSP20-like chaperones superfamily protein 2.25 10 3 0.94 AT2G22780 PMDH1, peroxisomal NAD-malate dehydrogenase 1 6.05 10...”
- Identification of QTNs and Their Candidate Genes for 100-Seed Weight in Soybean (Glycine max L.) Using Multi-Locus Genome-Wide Association Studies
Ikram, Genes 2020 - “...Glyma10g36070 underlying the stable QTNs qcHSW-10-1 and qcHSW-10-4 were homologous to, respectively, the Arabidopsis genes AT1G03090 ( MCCA ) and AT1G35680 ( RPL21 ), which are related to seed weight or development ( Table 5 ; Figure 4 and Figure 5 ). 4. Discussion To dissect...”
- “...BR-signaling kinase 3 Plant hormone signal transduction [ 67 ] qcHSW-10-1 Gm10_2563422-2566365 Glyma10g03440 Gm10:2482369-2489108 MCCA AT1G03090 methylcrotonyl-CoA carboxylase alpha chain Metabolic pathways [ 68 ] qcHSW-10-4 Gm10_44349893-44469282 Glyma10g36070 Gm10:44258213-44261525 RPL21 AT1G35680 Ribosomal protein L21 Ribosome [ 69 ] The bold text candidate genes were previously reported...”
- Identification of small RNAs during cold acclimation in Arabidopsis thaliana
Tiwari, BMC plant biology 2020 - “...Plant Tudor-like RNA-binding protein 2.17 AT3G11830 TCP-1/cpn60 chaperonin family protein 2.86 AT3G11840 Plant U-box24 2.9 AT1G03090 Methylcrotonyl-CoA carboxylase alpha chain, mitochondrial / 3-methylcrotonyl-CoA carboxylase 1 (MCCA) 2.5 AT1G03100 Pentatricopeptide repeat (PPR) superfamily protein 2.47 AT1G72030 Acyl-CoA N-acyltransferases (NAT) superfamily protein 2.3 AT1G72040 Deoxyribonucleoside kinase 2.44 AT2G40420...”
- “...family protein (AT3G11830) and plant U-box24 (AT3G11840) and PPR (AT1G03100) pairing with mitochondrial/3-methylcrotonyl-CoA carboxylase 1 (AT1G03090). The inverse expression pattern of these pairing transcripts was accompanied by the induction of cis -nat-siRNAs in cold treatment. An ideal example is represented by the cold responsive upregulation of...”
- Transcript and metabolite changes during the early phase of abscisic acid-mediated induction of crassulacean acid metabolism in Talinum triangulare
Maleckova, Journal of experimental botany 2019 - “...CARB 1.06 5 KMT12470 AT1G64660 MGL 2.67 5 KMT14300 AT1G55510 BCDH BETA1 1.50 6 KMT10213 AT1G03090 MCCA 1.57 6 KMT12470 AT1G64660 MGL 2.67 5 KMS98028 AT1G08630 THA1 1.49 5 Solute transport KMT02985 AT2G26900 BASS2 1.05 6 KMT13799 AT1G08960 CAX11 1.02 6 KMT03912 AT1G30360 ERD4 1.60 5...”
- More
VPA1128 putative acyl-CoA carboxylase alpha chain from Vibrio parahaemolyticus RIMD 2210633
43% identity, 92% coverage
- Bacteriostatic effects of benzyl isothiocyanate on Vibrio parahaemolyticus: Transcriptomic analysis and morphological verification
Liu, BMC biotechnology 2021 - “...subunit, hypothetical protein and hypothetical protein, respectively (see Additional file 4 ). Three genes VP0295, VPA1128, and VPA1735 were upregulated, while eight genes VP1092, VP1256, VP1741, nhaB, VP2351, VP2545, VP2778, and VP2826 were downregulated in sodium ion transport of biological processes. They regulated multiple proteins related...”
atuF / Q9HZV6 cis-geranyl-CoA carboxylase α-subunit (EC 6.4.1.5) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
PA2891 probable biotin carboxylase/biotin carboxyl carrier protein from Pseudomonas aeruginosa PAO1
40% identity, 92% coverage
- The opportunistic pathogen Pseudomonas aeruginosa exploits bacterial biotin synthesis pathway to benefit its infectivity
Shi, PLoS pathogens 2023 - “.... Genome-wide mining of P . aeruginosa reveals five putative biotinylated enzymes, namely PA1400, PA2012, PA2891, PA4847, and PA5435 ( S1 Table ). D. Streptavidin blot analyses for crude extracts of E . coli and P . aeruginosa . Unlike E . coli displaying a well-known...”
- “...of multiple biotinylated proteins. E. SDS-PAGE (12%) profile for three biotinylated enzymes (PA1400, PA2012, and PA2891). Three of five predictive biotinylated enzymes were overexpressed, purified, and judged with SDS-PAGE (12%). F. Western blot analysis of the three recombinant proteins (PA1400, PA2012, and PA2891) using anti-6x His...”
- The Pseudomonas aeruginosa Isohexenyl Glutaconyl Coenzyme A Hydratase (AtuE) Is Upregulated in Citronellate-Grown Cells and Belongs to the Crotonase Family
Poudel, Applied and environmental microbiology 2015 - “...PA2014 PA2015 PA2886 PA2887 PA2888 PA2889 PA2890 PA2891 PA2892 PA4330 Gene Structure-Function of Pseudomonas aeruginosa AtuE corresponding to rat ECH catalytic...”
- Swarming of Pseudomonas aeruginosa is controlled by a broad spectrum of transcriptional regulators, including MetR
Yeung, Journal of bacteriology 2009 - “...revealed PA1843 (metH), PA2399 (pvdD), PA2413 (pvdH), PA2891, PA4144, and PA4223. Conversely, PA0633, PA0848, and PA5125 (ntrC) were negatively regulated by...”
- The atu and liu clusters are involved in the catabolic pathways for acyclic monoterpenes and leucine in Pseudomonas aeruginosa
Aguilar, Applied and environmental microbiology 2006 - “...PAO1::ISlacZ/hah (ID 10788), transposon insertion in ORF PA2891 PAO1::ISlacZ/hah (ID 8377), transposon insertion in ORF PA2893 PAO1::ISlacZ/hah (ID 11254),...”
- “...PAO1SM mutant obtained by Himar1::Gmr transposition in ORF PA2891, unable to grow on citronellol PAO1SM mutant obtained by Himar1::Gmr transposition in ORF...”
- Methylcrotonyl-CoA and geranyl-CoA carboxylases are involved in leucine/isovalerate utilization (Liu) and acyclic terpene utilization (Atu), and are encoded by liuB/liuD and atuC/atuF, in Pseudomonas aeruginosa
Höschle, Microbiology (Reading, England) 2005 (PubMed)- “...at 37 uC. Insertion mutagenesis. Disruption of atuF (PA2891) in P. aerugi- nosa was carried out using pKnockout-G for rapid gene inactivation (Windgassen et...”
- “...gene products of liuD (PA2012; 74 kDa) and atuF (PA2891; 71 kDa), respectively (Figs 2 and 3). The three non-biotin-containing polypeptides (band nos 4/5 and 6,...”
- The gnyRDBHAL cluster is involved in acyclic isoprenoid degradation in Pseudomonas aeruginosa
Díaz-Pérez, Applied and environmental microbiology 2004 - “...the GnyA protein (left). crotonoyl-CoA carboxylase, ORF PA2891) biotinylated subunits of their respective carboxylases. In agreement with data from the RT-PCR...”
N646_4047 acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha from Vibrio alginolyticus NBRC 15630 = ATCC 17749
43% identity, 92% coverage
D2VDR3 Methylcrotonyl-CoA carboxylase from Naegleria gruberi
43% identity, 92% coverage
F1LP30 Methylcrotonyl-CoA carboxylase subunit 1 from Rattus norvegicus
39% identity, 88% coverage
- Proximity labelling reveals effects of disease-causing mutation on the DNAJC5/cysteine string protein α interactome
Barker, The Biochemical journal 2024 - “...(Q5U2P5) Hspa1a (P0DMW1) Acaca * (P11497) Sidt2* (D3ZEH5) Snap25* (P60881-2) Snx3* (Q5U211) Myh11 (E9PTU4) Mccc1 (F1LP30) Vamp2* (P63045) Agfg1* (Q4KLH5) Arhgdia (Q5XI73) Sidt2* (D3ZEH5) Tuba1b (Q6P9V9) Arhgdia* (Q5XI73) Csrp1* (P47875) Stx7* (O70257) Dnajc5 (A0A0G2JX56) Nefm (P12839) Snx3* (Q5U211) Scamp1* (P56603) Baiap2* (Q6GMN2) Nudcd2 (Q5M823) Map1b (P15205)...”
- Chronic Cerebral Hypoperfusion-Induced Disturbed Proteostasis of Mitochondria and MAM Is Reflected in the CSF of Rats by Proteomic Analysis
Tukacs, Molecular neurobiology 2023 - “...S12 Protein synthesis ER, Cytoplasm P60901 Psma6 1.55 Proteasome subunit alpha type-6 Protein degradation Cytoplasm F1LP30 Mccc1 1.67 Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial Leucine catabolism Mitochondria P09606 Glul 1.31 Glutamine synthetase Glutamine metabolism Mitochondria, ER Cytoskeletal proteins Q6P9V9 Tuba1b 1.69 Tubulin alpha-1B chain Cytoskeletal protein Cytoskeleton...”
- Targeted proteomic analysis reveals that crocodile oil from Crocodylus siamensis may enhance hepatic energy metabolism in rats.
Fungfuang, Experimental animals 2023 - “...catabolic process to acetyl-CoA B5LSW7 Cysteine sulfinic acid decarboxylase Csad FVNVCFWFVPPSLRGKK Carboxylic acid metabolic process F1LP30 Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial Mccc1, Mcca EHAGKIGYPVMIKAIR Leucine catabolic process F1LU71 Methylglutaconyl-CoA hydratase, mitochondrial Auh AYGKNSLSKNLLK Fatty acid beta-oxidation D4ACE9 Alpha-aminoadipic semialdehyde synthase, mitochondrial Aass APLAPKHIKGITK L-lysine catabolic process...”
- The mitochondrial proteomic changes of rat hippocampus induced by 28-day simulated microgravity.
Ji, PloS one 2022 - “...[ADP/GDP-forming] subunit alpha, mitochondrial 1.57 0.005037 D4A830_RAT D4A830 Ppa2 Pyrophosphatase (inorganic) 2 1.57 0.006482 F1LP30_RAT F1LP30 Mccc1 Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial 1.56 0.01137 D3ZTR1_RAT D3ZTR1 Mrps17 Mitochondrial ribosomal protein S17 1.56 0.004775 Q5RJR9_RAT Q5RJR9 Serpinh1 Serine (Or cysteine) proteinase inhibitor, clade H, member 1, isoform...”
Q5I0C3 Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial from Rattus norvegicus
39% identity, 92% coverage
PST_3216 acetyl-CoA carboxylase, biotin carboxylase, putative from Pseudomonas stutzeri A1501
41% identity, 92% coverage
- Poly-3-hydroxybutyrate production from acetate by recombinant Pseudomonas stutzeri with blocked L-leucine catabolism and enhanced growth in acetate
Zhu, Frontiers in bioengineering and biotechnology 2023 - “...Isovaleryl-CoA is eventually transformed into acetyl-CoA and acetoacetate via pst_3213 , pst_3214 , pst_3215 , pst_3216 , and pst_3217 , while acetoacetate is catabolized into acetoacetyl-CoA by pst_3218 and pst_3219 and finally degraded to acetyl-CoA. Besides pst_3217 , other genes involved in isovaleryl-CoA catabolism including pst_3213,...”
- “...-leucine in P. stutzeri A1501. PST_3213, isovaleryl-CoA dehydrogenase; PST_3214, methylcrotonyl-CoA carboxylase, subunit; PST_3215, -methylglutaconyl-CoA hydratase; PST_3216, methylcrotonyl-CoA carboxylase, subunit; PST_3217, hydroxymethylglutaryl-CoA lyase; PST_3218, CoA transferase, subunit A; PST_3219, CoA transferase, subunit B. (C) The growth of different strains in AB minimal medium with 40mM acetate. (D)...”
PYCA_METJA / Q58626 Pyruvate carboxylase subunit A; Pyruvic carboxylase A; EC 6.4.1.1 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
55% identity, 61% coverage
E1BGC1 Methylcrotonyl-CoA carboxylase subunit 1 from Bos taurus
38% identity, 97% coverage
MSMEG_4716 acetyl-/propionyl-coenzyme A carboxylase alpha chain from Mycobacterium smegmatis str. MC2 155
43% identity, 92% coverage
VT47_11875 acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha from Pseudomonas syringae pv. syringae
41% identity, 92% coverage
- Identification of the Genes of the Plant Pathogen Pseudomonas syringae MB03 Required for the Nematicidal Activity Against Caenorhabditis elegans Through an Integrated Approach
Ali, Frontiers in microbiology 2022 - “...stationary phase interaction: lysR transcriptional regulator (VT47_13020), isovaleryl-CoA dehydrogenase (VT47_11890), putative acyl-CoA carboxylase alpha chain (VT47_11875), acyl-CoA carboxyltransferase beta chain (VT47_11885), prpC (VT47_09990), and PrpB (VT47_09985). On the other hand, crfX (VT47_10030), (VT47_19750) and hypothetical protein (VT47_10035) were down regulated ( Table 2 ). Regarding nematicidal...”
- “...h VT47_13020 Yes Unchanged Up LysR family transcriptional regulator |VT47_11890 Yes Unchanged Up Isovaleryl-CoA dehydrogenase VT47_11875 Yes Unchanged Up 3-Methylcrotonyl-CoA carboxylase alpha subunit VT47_11885 Yes Unchanged Up Propionyl-CoA carboxylase prpC VT47_09990 Yes Unchanged Up 2-Methylcitrate synthase prpB VT47_09985 Yes Unchanged Up 2-Methylisocitrate lyase cmpX VT47_10035 Yes...”
Pfl01_3659 3-methylcrotonoyl-CoA carboxylase, alpha subunit from Pseudomonas fluorescens Pf0-1
42% identity, 92% coverage
D7DR99 Acetyl-CoA carboxylase, biotin carboxylase from Methanococcus voltae (strain ATCC BAA-1334 / A3)
52% identity, 61% coverage
W5QHK3 Methylcrotonoyl-CoA carboxylase 1 from Ovis aries
40% identity, 92% coverage
D0N1Q9 Methylcrotonoyl-CoA carboxylase subunit alpha, putative from Phytophthora infestans (strain T30-4)
41% identity, 94% coverage
- Cinnamaldehyde inhibits the growth of Phytophthora capsici through disturbing metabolic homoeostasis
Wang, PeerJ 2021 - “...Down/0.48 H3GJ13 1,3-beta-glucanosyltransferase Down/0.81 H6U2P7 Cellulose synthase 3 Down/0.70 Leucine metabolism A0A0W8CX17 Isovaleryl-CoA dehydrogenase Down/0.63 D0N1Q9 Methylcrotonoyl-CoA carboxylase 1 Down/0.77 Discussion There are few reports on the mechanism of action of CA on fungi and oomycetes. OuYang et al. (2019) found that after CA treatment, the...”
- “...metabolic W2NUF9 CAMK/CAMK1 protein kinase Down/0.319 D0NCV1 Glucan 1,3-beta-glucosidase Down/0.408 H3GJ13 1,3-beta-glucanosyltransferase Down/0.491 Leucine metabolism D0N1Q9 Methylcrotonoyl-CoA carboxylase subunit alpha, putative Down/0.453 A0A0W8CX17 Isovaleryl-CoA dehydrogenase Down/0.345 Internal reference protein A0A0W8DRZ2 40S ribosomal protein S13 Q2M3Z6 Ribosomal protein L23 10.7717/peerj.11339/fig-8 Figure 8 Relative expression of mRNAs from...”
PP4067, PP_4067 acetyl-CoA carboxylase, biotin carboxylase, putative from Pseudomonas putida KT2440
41% identity, 91% coverage
AO356_01595 3-methylcrotonyl-CoA carboxylase, alpha (biotin-containing) subunit (EC 6.4.1.4) from Pseudomonas fluorescens FW300-N2C3
41% identity, 92% coverage
- mutant phenotype: Specifically important for utilizing L-Leucine.
MCCA_MOUSE / Q99MR8 Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial; MCCase subunit alpha; 3-methylcrotonyl-CoA carboxylase 1; 3-methylcrotonyl-CoA carboxylase biotin-containing subunit; 3-methylcrotonyl-CoA:carbon dioxide ligase subunit alpha; EC 6.4.1.4 from Mus musculus (Mouse) (see paper)
40% identity, 92% coverage
- function: Biotin-attachment subunit of the 3-methylcrotonyl-CoA carboxylase, an enzyme that catalyzes the conversion of 3- methylcrotonyl-CoA to 3-methylglutaconyl-CoA, a critical step for leucine and isovaleric acid catabolism.
catalytic activity: 3-methyl-(2E)-butenoyl-CoA + hydrogencarbonate + ATP = 3- methyl-(2E)-glutaconyl-CoA + ADP + phosphate + H(+) (RHEA:13589)
cofactor: biotin
subunit: Probably a dodecamer composed of six biotin-containing alpha subunits (MCCC1) and six beta (MCCC2) subunits (By similarity). Interacts (via the biotin carboxylation domain) with SIRT4 (PubMed:23438705). - In-Depth Proteomic Analysis of De Novo Proteome in a Mouse Model of Alzheimer's Disease.
Wang, Journal of Alzheimer's disease : JAD 2023 - “...domain-containing protein 3 Q3UHB1 1.47 Synaptosomal-associated protein 25 P60879 1.35 Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial Q99MR8 1.26 Table 2 List of downregulated proteins in hippocampus of Tg19959 AD model mice Protein name Accession ID Fold change Phospholipid transfer protein C2CD2L Q80X80 Undetected in Tg WD repeat...”
- Effects of an exogenous ketone ester using multi-omics in skeletal muscle of aging C57BL/6J male mice
Roberts, Frontiers in nutrition 2022 - “...P35293 19330 2.1 1.3 0.043 0.62 1.53 Methylcrotonoyl-CoA carboxylase methylcrotonoyl-Coenzyme A carboxylase 1 (alpha) (Mccc1) Q99MR8 72039 2.3 1.5 0.023 0.81 1.51 Profilin profilin 1 (Pfn1) Q8CEH8 18643 12.1 8.0 0.026 0.67 1.51 O-acetyl-ADP-ribose deacetylase MACRO domain containing 1 (Macrod1) Q922B1 107227 5.2 3.4 0.030 0.64...”
- Extensive mitochondrial proteome disturbance occurs during the early stages of acute myocardial ischemia.
Wang, Experimental and therapeutic medicine 2022 - “...0.031 a Up Q9CZ13 UQCRC1 Cytochrome b-c1 complex subunit 1, mitochondrial 1.479 0.048 a Up Q99MR8 MCCC1 Methylcrotonoyl-CoA carboxylase subunit , mitochondrial 1.496 0.043 a Up Q8R5L1 C1QBP Complement component 1 Q subcomponent-binding protein, mitochondrial 1.591 0.027a Up Q3ULD5 MCCC2 Methylcrotonoyl-CoA carboxylase chain, mitochondrial 1.612 0.013...”
- A peptide of the amino-terminus of GRK2 induces hypertrophy and yet elicits cardioprotection after pressure overload.
Bledzka, Journal of molecular and cellular cardiology 2021 - “...protein 13 P59017 Bcl2l13 2 0 11 Ln4 only 9 Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial Q99MR8 Mccc1 3 19 87 4.6 10 NADH-cytochrome b5 reductase 1 Q9DB73 Cyb5r1 4 4 13 3.3 11 ADP/ATP translocase 1 P48962 Slc25a4 5 0 20 Ln4 only 12 Caveolae-associated protein...”
- Does reversible cysteine oxidation link the Western diet to cardiac dysfunction?
Behring, FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2014 - CypD(-/-) hearts have altered levels of proteins involved in Krebs cycle, branch chain amino acid degradation and pyruvate metabolism
Menazza, Journal of molecular and cellular cardiology 2013 - “...1 beta subcomplex subunit 11, mitochondrial NDUBB_MOUSE 17.88 3 1.280 0.130 5.640 0.304 <0.001 340 (Q99MR8) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial MCCA_MOUSE 7.11 5 1.080 0.080 1.915 0.091 <0.001 77 (Q99J99) 3-mercaptopyruvate sulfurtransferase THTM_MOUSE 7.74 2 1.242 0.108 1.967 0.129 0.005 58 (P56379) 6.8 kDa mitochondrial...”
- Comparative analyses of differentially induced T-cell receptor-mediated phosphorylation pathways in T lymphoma cells.
Ortiz, Experimental biology and medicine (Maywood, N.J.) 2010 - “...transduction <1.00E-14 MAPKAP P49138 mitogen-activated protein kinase-activated protein kinase 2 signal transduction <1.00E-14 MCCC1 K2 Q99MR8 methylcrotonoyl-Coenzyme A carboxylase 1 (alpha) metabolism <1.00E-14 NSUN2 Q1HFZ0 NOL1/NOP2/Sun domain family, member 2 transcription/translation <1.00E-14 SKAP1 Q3UUV5 src kinase associated phosphoprotein 1 signal transduction <1.00E-14 SKAP2 Q3UND0 src kinase...”
A1S_1373 putative acyl-CoA carboxylase alpha chain protein from Acinetobacter baumannii ATCC 17978
HKO16_06925 acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha from Acinetobacter baumannii ATCC 17978
42% identity, 92% coverage
- Mucin acts as a nutrient source and a signal for the differential expression of genes coding for cellular processes and virulence factors in Acinetobacter baumannii
Ohneck, PloS one 2018 - “...Betaine-aldehyde dehydrogenase A1S_0958 2.423328781 0.004294133 Acetolactate synthase large subunit A1S_1372 3.802051601 0.000345683 Hydroxymethylglutaryl-CoA lyase, MvaB A1S_1373 3.25732149 0.003228408 3-methylcrotonyl-CoA carboxylase subunit alpha A1S_1374 3.345393954 0.002883219 3-methylglutaconyl-CoA hydratase A1S_1375 3.012793835 0.01043401 3-methylcrotonyl-CoA carboxylase subunit beta A1S_1376 3.238990899 0.004131094 Isovaleryl-CoA dehydrogenase A1S_1610 2.081951258 2.45929E -05 Zn-dependent metalloendopeptidase A1S_1852...”
- A bacterial methyltransferase that initiates biotin synthesis, an attractive anti-ESKAPE druggable pathway
Su, Science advances 2024 - “...S2, C and D). To verify this observation, four of seven candidates [HKO16_10520 (AccB), HKO16_06425, HKO16_06925, and HKO16_15815] were selected for further analyses. All the four recombinant forms (AccB and HKO16_06425 in full length and HKO16_06925 plus HKO16_15815 in an EAMK-covering truncated version) were overexpressed and...”
- “...of homologous recombination, the four A. baumannii genes encoding putative biotinylated proteins [HKO16_10520 (AccB), HKO16_06425, HKO16_06925, and HKO16_15815] were obtained by PCR and introduced into pET28a via two restriction sites of Bam HI and Hind III (table S2). Third, the mobile colistin resistance determinant ( mcr-1...”
CPI83_20020 acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha from Rhodococcus sp. H-CA8f
42% identity, 91% coverage
PSPTO_2736 biotin carboxylase/biotin-containing subunit from Pseudomonas syringae pv. tomato str. DC3000
41% identity, 91% coverage
- A computational model of Pseudomonas syringae metabolism unveils a role for branched-chain amino acids in Arabidopsis leaf colonization
Tubergen, PLoS computational biology 2023 - “...in BCAAs biosynthesis. The leucine minimal medium rendered three additional genes predicted to be essential: PSPTO_2736, PSPTO_2738, and PSPTO_2739. The three genes show high sequence homology to the leucine catabolic genes liuD , liuB , and liuA , respectively. 10.1371/journal.pcbi.1011651.g003 Fig 3 iPst19 predicts genes of...”
- “...one iso-propyl-malate dehydrogenase (PSPTO_2175) were essential to metabolize glucose, three genes of the liu operon (PSPTO_2736, PSPTO_2738, and PSPTO_2739) were essential to use leucine as the sole carbon source. (C) Predicted gene essentiality changes with mixed carbon sources where iPst19 gene essentiality was simulated in conditions...”
8xl6A / Q96RQ3 Structure of human 3-methylcrotonyl-coa carboxylase at apo-state (mcc- apo)
40% identity, 92% coverage
Pf6N2E2_2194 3-methylcrotonyl-CoA carboxylase, alpha (biotin-containing) subunit (EC 6.4.1.4) from Pseudomonas fluorescens FW300-N2E2
41% identity, 92% coverage
- mutant phenotype: Specifically important for utilizing L-Leucine.
Q39WZ8 Biotin carboxylase from Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
51% identity, 61% coverage
MCCC1 / Q96RQ3 3-methylcrotonyl-CoA carboxylase α subunit (EC 6.4.1.4) from Homo sapiens (see 4 papers)
MCCA_HUMAN / Q96RQ3 Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial; MCCase subunit alpha; 3-methylcrotonyl-CoA carboxylase 1; 3-methylcrotonyl-CoA carboxylase biotin-containing subunit; 3-methylcrotonyl-CoA:carbon dioxide ligase subunit alpha; EC 6.4.1.4 from Homo sapiens (Human) (see 15 papers)
39% identity, 92% coverage
- function: Biotin-attachment subunit of the 3-methylcrotonyl-CoA carboxylase, an enzyme that catalyzes the conversion of 3- methylcrotonyl-CoA to 3-methylglutaconyl-CoA, a critical step for leucine and isovaleric acid catabolism.
catalytic activity: 3-methyl-(2E)-butenoyl-CoA + hydrogencarbonate + ATP = 3- methyl-(2E)-glutaconyl-CoA + ADP + phosphate + H(+) (RHEA:13589)
cofactor: biotin
subunit: Probably a dodecamer composed of six biotin-containing alpha subunits (MCCC1) and six beta (MCCC2) subunits (PubMed:17360195). Interacts (via the biotin carboxylation domain) with SIRT4 (PubMed:23438705). - Aqueous Extracts of Ocimum gratissimum Sensitize Hepatocellular Carcinoma Cells to Cisplatin through BRCA1 Inhibition.
Chen, International journal of molecular sciences 2024 - “...ITPRIPL2 Inositol 1,4,5-trisphosphate receptor-interacting protein-like 2 0.01 0.01 Q9BRS8 LARP6 La-related protein 6 0.01 0.01 Q96RQ3 MCCC1 Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial 0.01 0.01 Q99081 TCF12 Transcription factor 12 0.01 0.01 Q13796 SHROOM2 Protein Shroom2 0.01 0.01 Q69YH5 CDCA2 Cell division cycle-associated protein 2 0.01 0.01...”
- SAV-Pred: A Freely Available Web Application for the Prediction of Pathogenic Amino Acid Substitutions for Monogenic Hereditary Diseases Studied in Newborn Screening.
Zadorozhny, International journal of molecular sciences 2023 - “...5 58 208 271 21 15 0.703 0.707 HADHA Long-chain L-3 hydroxyacyl-CoA dehydrogenase deficiency 600890 Q96RQ3 12 9 476 497 9 11 0.813 0.808 HADHB Trifunctional protein deficiency 143450 P50747-1 2 14 309 325 17 5 0.961 0.961 HBB Hemoglobinopathies 141900 P68871 27 149 79 255...”
- Interactome Analysis of the ER Stress Sensor Perk Uncovers Key Components of ER-Mitochondria Contact Sites and Ca2+ Signalling
Sassano, Contact (Thousand Oaks (Ventura County, Calif.)) 2021 - “...27 17 100% 100% Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=MCCC1 PE=1 SV=3 Q96RQ3 MCCC1 80 kDa 50 25 40 19 100% 100% Lysine-rich nucleolar protein 1 OS=Homo sapiens OX=9606 GN=KNOP1 PE=1 SV=1 Q1ED39 KNOP1 52 kDa 61 33 42 23 100% 100% Arginine...”
- Inhibition of Mitochondrial Complex Function-The Hepatotoxicity Mechanism of Emodin Based on Quantitative Proteomic Analyses
Lin, Cells 2019 - “...Process GO:0005759 mitochondrial matrix 506 30 1.5 10 16 5.7 10 16 O76031, P48735, Q9BQC6, Q96RQ3, Q9UNQ2, Q07820, Q9NYK5, Q32P41, Q6NVY1, Q8N983, Q9BZE1, Q9H2W6, Q16822, Q13084, O95182, P30038, Q8IXM3, Q969S9, Q9Y291, P11498, Q5U5X0, Q8NFF5, P82932, O00217, P82675, P28331, O75306, P42704, Q96AG4, Q13057 Cellular Component GO:0005761 mitochondrial...”
- Quantitative proteomic analyses of CD4+ and CD8+ T cells reveal differentially expressed proteins in multiple sclerosis patients and healthy controls.
Berge, Clinical proteomics 2019 - “...0.87 P20645 Cation-dependent mannose-6-phosphate receptor M6PR 0.006115 0.1934 22.3302 0.22866 23.6924 0.17682 22 4 0.84 Q96RQ3 Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial MCCC1 0.007633 0.5028 21.2898 0.19278 23.5502 0.34081 16.4 7 0.83 P78417 Glutathione S-transferase omega-1 GSTO1 0.007795 0.2279 23.6102 0.09562 23.1469 0.19987 59.3 14 0.79 P24666...”
- Identification of proteins interacting with the mitochondrial small heat shock protein Hsp22 of Drosophila melanogaster: Implication in mitochondrial homeostasis
Dabbaghizadeh, PloS one 2018 - “...Phosphatidyl glycerophosphatase and protein-tyrosine phosphatase1 (Q8WUK0) 0.33 0.1 0 0 Methylcrotonyl-CoA carboxylase subunit alpha, mitochondrial (Q96RQ3) 0 0 0.34 0 Isoform 3 of Carbamoyl-phosphate synthase, mitochondrial (P31327) 0 0 0.74 0.04 Pyruvate carboxylase, mitochondrial (P11498) 0 0.04 1 0.1 0.06 Hydroxysteroid dehydrogenase-like protein 2 (Q6YN16) 0.16...”
- SAMHD1 Posttranscriptionally Controls the Expression of Foxp3 and Helios in Human T Regulatory Cells.
Kim, Journal of immunology (Baltimore, Md. : 1950) 2018 - “...MCCB_HUMAN 348.2093251 (Q9HCC0) Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial Mitochondrial enzymes with Biotin cofactor MCCA_HUMAN 249.9351293 (Q96RQ3) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial Mitochondrial enzymes with Biotin cofactor PCCA_HUMAN 93.580363 (P05165) Propionyl-CoA carboxylase alpha chain, mitochondrial Mitochondrial enzymes with Biotin cofactor DLDH_HUMAN 165.104467 (P09622) Dihydrolipoyldehydrogenase, mitochondrial Photo damage-related...”
- Mitochondrial O-GlcNAc Transferase (mOGT) Regulates Mitochondrial Structure, Function, and Survival in HeLa Cells.
Sacoman, The Journal of biological chemistry 2017 - More
MMAR_3848 acetyl-/propionyl-coenzyme A carboxylase alpha chain AccA1 from Mycobacterium marinum M
40% identity, 92% coverage
ABUW_2455 acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha from Acinetobacter baumannii
42% identity, 92% coverage
- Comparative Transcriptomic Profiling of Pellicle and Planktonic Cells from Carbapenem-Resistant Acinetobacter baumannii
Ng, Antibiotics (Basel, Switzerland) 2023 - “...to be upregulated: ABUW_2506 ( hmgL1 ), hcaD , ABUW_2453, ABUW_2456 ( hmgL2 ), and ABUW_2455. Additionally, one DEG, namely, ABUW_1150, was downregulated. Furthermore, the metabolism pathways of other amino acids including lysine, arginine, proline, glycine, serine, threonine, tyrosine, and tryptophan were also found to be...”
- “...ko00280 Valine, leucine, and isoleucine degradation 1.9510 0.0112 6 21 ABUW_2506, hcaD , ABUW_2453, ABUW_2456, ABUW_2455 ABUW_1150 ko00310 Lysine degradation 1.1016 0.0791 3 11 ABUW_1519 gabD2 , ABUW_1150 ko00330 Arginine and proline metabolism 0.7820 0.1652 3 15 astA2, ABUW_2807 ABUW_1150 ko00260 Glycine, serine, and threonine metabolism...”
BT1915 pyruvate carboxylase subunit A from Bacteroides thetaiotaomicron VPI-5482
53% identity, 61% coverage
- Gut Commensal Bacteroidetes Encode a Novel Class of Vitamin B12-Binding Proteins
Putnam, mBio 2022 - “...extracellular B 12 . Expression of the first gene downstream of a cobamide-dependent riboswitch ( bt1915 ) was assessed by qRT-PCR. Inactivation of cobamide transport locus 2 compromises B. thetaiotaomicron fitness in the mouse gut ( 5 , 12 ). In germfree Swiss Webster mice, parental...”
- “...of a predicted riboswitch decreases in the presence of B 12 . (A) The gene bt1915 is encoded immediately downstream from a predicted B 12 -responsive riboswitch. Using the B. thetaiotaomicron tdk strain, we assessed transcription of bt1915 in the presence of 0, 1, and 10...”
GSU2019 acetyl-CoA carboxylase, biotin carboxylase from Geobacter sulfurreducens PCA
50% identity, 61% coverage
- Evolution of electron transfer out of the cell: comparative genomics of six Geobacter genomes
Butler, BMC genomics 2010 - “...0.92 saccharopine dehydrogenase 39997914 GSU2821 0.91 nitrogenase iron protein 39998542 GSU3453 0.91 uroporphyrinogen decarboxylase 39997117 GSU2019 0.91 acetyl-CoA carboxylase 39997929 GSU2837 0.91 preprotein translocase SecY 39995209 GSU0098 0.91 MglB protein 39995271 GSU0160 0.91 dihydrodipicolinate reductase 39995450 GSU0341 0.91 NADH dehydrogenase I, D subunit 39995452 GSU0343 0.91...”
ACICU_01408 Acetyl/propionyl-CoA carboxylase, alpha subunit from Acinetobacter baumannii ACICU
A9801_RS14870 acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha from Acinetobacter baumannii
41% identity, 92% coverage
- Colistin Resistant A. baumannii: Genomic and Transcriptomic Traits Acquired Under Colistin Therapy
Cafiso, Frontiers in microbiology 2018 - “...ACICU_01767); Pyruvate metabolism (3 genes: ACICU_01735, ACICU_01737, ACICU_01767); Valine, leucine and isoleucine degradation (3 genes: ACICU_01408, ACICU_01342, ACICU_01767). Similarly, the enrichment analysis of the over-expressed DEGs annotated on A. baumannii ATCC 17978 showed 3 affected KEGG pathways including the Butanoate metabolism (5 genes: A1S_1729, A1S_1699, A1S_1341,...”
- Characterization and Transcriptome Studies of Autoinducer Synthase Gene from Multidrug Resistant Acinetobacter baumannii Strain 863
Ng, Genes 2019 - “...the abaI :Km strain. The genes (A9801_RS14885, liuA ; A9801_RS14880, liuB ; A9801_RS14875, liuC ; A9801_RS14870, liuD ; A9801_RS14865, liuE ) from the leucine/isovalerate utilization (Liu) operon were highly repressed in the mutant strain compared to the wild type. These genes had a Log 2 FC...”
- “...of Downregulated and Upregulated Genes in QS-Deficient Mutant. Locus tag Gene Log2 FC Down-regulated genes A9801_RS14870 3-methylcrotonyl-CoA carboxylase subunit alpha, liuD 9.61393 A9801_RS14965 NAD(P)-dependent oxidoreductase 9.42986 A9801_RS15335 phenylacetate-CoA ligase, paaK 9.37778 A9801_RS14955 hypothetical protein 9.30532 A9801_RS16540 aminoglycoside N-acetyltransferase AAC(3)-IId 9.20034 A9801_RS15345 protein paaH 9.18939 A9801_RS14890 TetR...”
Q54755 biotin carboxylase (EC 6.3.4.14) from Synechococcus sp. (see paper)
51% identity, 61% coverage
BA2548 acetyl-CoA carboxylase, biotin carboxylase, putative from Bacillus anthracis str. Ames
51% identity, 61% coverage
B6SKB7 Methylcrotonoyl-CoA carboxylase subunit alpha from Zea mays
39% identity, 89% coverage
- Leaf Proteomic Analysis in Seedlings of Two Maize Landraces with Different Tolerance to Boron Toxicity
Mamani-Huarcaya, Plants (Basel, Switzerland) 2023 - “...4 FC 3 p -Value 4 FCSA/ FCPA 5 Function/Biological Process 6 AMINO ACID METABOLISM B6SKB7 Zm00001d031013 Methylcrotonoyl-CoA carboxylase subunit 4.44 0.0022 3.56 0.0049 0.80 Leucine degradation A0A1D6K836 Zm00001d029848 Branched-chain amino-acid aminotransferase 2.35 0.0272 1.65 0.0241 0.70 Branched-chain amino acid biosynthesis B4G011 Zm00001d046923 d -3-phosphoglycerate dehydrogenase...”
- “...5 AMINO ACID AND PEPTIDE METABOLISMS Proteins very strongly induced by B toxicity in Pacha B6SKB7 Zm00001d031013 Methylcrotonoyl-CoA carboxylase subunit 4.44 0.0022 Leucine degradation Proteins very strongly repressed by B toxicity in Pacha A0A1D6ICL3 Zm00001d021596 Adenosine 5-phosphosulfate reductase-like1 0.29 0.0140 Cysteine biosynthetic process. Sulfate reduction B6TZD1...”
BAB1_0924 Acetyl-CoA carboxylase, biotin carboxylase:Carbamoyl-phosphate synthase L chain, ATP-binding:Carbamoyl-phosphate synthetase l... from Brucella melitensis biovar Abortus 2308
Q57DK3 Biotin carboxylase from Brucella abortus biovar 1 (strain 9-941)
53% identity, 61% coverage
BAB1_0018 Biotin/lipoyl attachment:Biotin-requiring enzyme, attachment site:Carbamoyl-phosphate synthase L chain, ATP-binding:Carbamoyl... from Brucella melitensis biovar Abortus 2308
43% identity, 93% coverage
- ClpP protease modulates bacterial growth, stress response, and bacterial virulence in Brucella abortus
Sun, Veterinary research 2023 - “...UbiG, BAB1_0241, SucC, BAB1_1964, and Bpt, while the top 10 down-regulated proteins were ClpS, BAB1_0115, BAB1_0018, BAB1_0296, BAB1_0875, BAB1_1435, BAB1_1357, BAB2_0019, BAB1_1214, and BAB2_0547. Integrated analysis revealed the global roles of ClpP in B. abortus 2308 According to the proteomic and transcriptomic profiles, clpP deletion extensively...”
Caur_2832 Carbamoyl-phosphate synthase L chain ATP-binding from Chloroflexus aurantiacus J-10-fl
41% identity, 92% coverage
sll0053 biotin carboxylase from Synechocystis sp. PCC 6803
50% identity, 61% coverage
BV82_2132 acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha from Pseudomonas donghuensis
42% identity, 92% coverage
BMEI1925 acetyl-CoA carboxylase alpha chain / propionyl-CoA carboxylase alpha chain from Brucella melitensis 16M
43% identity, 93% coverage
MUL_3779 acetyl-/propionyl-coenzyme a carboxylase alpha chain AccA1 from Mycobacterium ulcerans Agy99
40% identity, 92% coverage
MCCA_ORYSJ / Q2QMG2 Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial; MCCase subunit alpha; 3-methylcrotonyl-CoA carboxylase 1; 3-methylcrotonyl-CoA:carbon dioxide ligase subunit alpha; EC 6.4.1.4 from Oryza sativa subsp. japonica (Rice) (see paper)
40% identity, 90% coverage
- function: Biotin-attachment subunit of the 3-methylcrotonyl-CoA carboxylase, an enzyme that catalyzes the conversion of 3- methylcrotonyl-CoA to 3-methylglutaconyl-CoA, a critical step for leucine and isovaleric acid catabolism.
catalytic activity: 3-methyl-(2E)-butenoyl-CoA + hydrogencarbonate + ATP = 3- methyl-(2E)-glutaconyl-CoA + ADP + phosphate + H(+) (RHEA:13589)
cofactor: biotin
cofactor: Mn(2+) (Binds 2 manganese ions per subunit.)
subunit: Probably a heterodimer composed of biotin-containing alpha subunits and beta subunits.
Pf1N1B4_3984 3-methylcrotonyl-CoA carboxylase, alpha (biotin-containing) subunit (EC 6.4.1.4) from Pseudomonas fluorescens FW300-N1B4
41% identity, 92% coverage
- mutant phenotype: Specifically important for utilizing L-Leucine.
Q3A2P1 biotin carboxylase (EC 6.3.4.14) from Syntrophotalea carbinolica (see paper)
51% identity, 61% coverage
CVAR_2091 acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha from Corynebacterium variabile DSM 44702
40% identity, 91% coverage
PA14_38480 alpha subunit of geranoyl-CoA carboxylase, GnyA from Pseudomonas aeruginosa UCBPP-PA14
41% identity, 93% coverage
Mvan_4090 Carbamoyl-phosphate synthase L chain, ATP-binding from Mycobacterium vanbaalenii PYR-1
42% identity, 92% coverage
ACCA1_MYCTU / P9WPQ3 Biotin-dependent 3-methylcrotonyl-coenzyme A carboxylase alpha1 subunit; EC 6.3.4.14 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
CAA79609.1 biotin carboxyl carrier protein from Mycobacterium tuberculosis (see paper)
MT2576 acetyl/propionyl-CoA carboxylase, alpha subunit from Mycobacterium tuberculosis CDC1551
Rv2501c PROBABLE ACETYL-/PROPIONYL-COENZYME A CARBOXYLASE ALPHA CHAIN (ALPHA SUBUNIT) ACCA1: BIOTIN CARBOXYLASE + BIOTIN CARBOXYL CARRIER PROTEIN (BCCP) from Mycobacterium tuberculosis H37Rv
41% identity, 91% coverage
- function: Component of a biotin-dependent acyl-CoA carboxylase complex. This subunit catalyzes the ATP-dependent carboxylation of the biotin carried by the biotin carboxyl carrier (BCC) domain, resulting in the formation of carboxyl biotin (PubMed:25695631). When associated with the beta1 subunit AccD1, is involved in branched amino-acid catabolism with methylcrotonyl coenzyme A as the substrate (PubMed:25695631).
catalytic activity: N(6)-biotinyl-L-lysyl-[protein] + hydrogencarbonate + ATP = N(6)-carboxybiotinyl-L-lysyl-[protein] + ADP + phosphate + H(+) (RHEA:13501)
cofactor: Mg(2+) Mn(2+) (Binds 2 magnesium or manganese ions per subunit.)
cofactor: biotin
subunit: The biotin-dependent acyl-CoA carboxylase complex is composed of AccA1, which contains the biotin carboxylase (BC) and biotin carboxyl carrier protein (BCCP) domains, and AccD1, which contains the carboxyl transferase (CT) domain (PubMed:25695631). The AccA1/AccD1 complex forms a dodecamer (PubMed:25695631). - Fatty acid biosynthesis in Mycobacterium tuberculosis: lateral gene transfer, adaptive evolution, and gene duplication
Kinsella, Proceedings of the National Academy of Sciences of the United States of America 2003 - “...genes in the CDC1551 genome that perform this enzymatic function, MT2576 and MT3384. A diagram of this tree is too large to include here and is published as...”
- Comparative Proteomic Analysis of Cell Wall Proteins of Aminoglycosides Resistant and Sensitive Mycobacterium tuberculosis Clinical Isolates
Sharma, Current protein & peptide science 2024 (PubMed)- “...Rv1308 belonged to intermediary metabolism and respiration; Rv2115c to the cell wall and cell processes; Rv2501c, Rv2247 and Rv0295c to lipid metabolism; and Rv2416c to virulence, detoxification/adaptation. Notably, variations in these proteins support cell wall integrity, aiding mycobacteria's establishment and proliferation. Molecular docking study revealed that...”
- Polyphosphate kinase-1 regulates bacterial and host metabolic pathways involved in pathogenesis of Mycobacterium tuberculosis
Chugh, Proceedings of the National Academy of Sciences of the United States of America 2024 - “...identified polyP 700 interacting proteins belonged to the ACC family of enzymes. These included AccA1 (Rv2501c), AccD1 (Rv2502c), AccA2 (Rv0973c), AccD2 (Rv0974c), AccD4 (Rv3799c), AccD5 (Rv3280), and AccE5 (Rv3281) ( SI Appendix , Table S1 and Dataset S1 ). Since polyP has been demonstrated to replace...”
- Intrabacterial lipid inclusion-associated proteins: a core machinery conserved from saprophyte Actinobacteria to the human pathogen Mycobacterium tuberculosis
Dargham, FEBS open bio 2023 - “...MMAR_1153 MUL_0918 ML0862 RopRjos Rv0400c fadE7 AcylCoA dehydrogenase Nonessential MSMEG_2466 MAB_0822 MMAR_0698 MUL_2825 ML0737 RopRjos Rv2501c accA1 Acetyl/propionylcoenzyme A carboxylase alpha chain Nonessential MSMEG_4716 MAB_4539c MMAR_3848 MUL_3779 ML0726c RopRjos Rv0824c desA1 AcylACP desaturase Essential MSMEG_5773 MAB_0754c MMAR_4856 MUL_0445 ML2185 RopRjos Rv3130c tgs1 Triacylglycerol synthase Nonessential MSMEG_5242...”
- “...(FadB2), Rv3229c (DesA3), Rv0154c (FadE2), Rv2244 (AcpM), Rv3800c (Pks13), Rv2524c (Fas), Rv0400c (FadE7), Rv0824c (DesA1), Rv2501c (AccA1), and Rv2247 (AccD6). Three additional proteins, Rv1544, Rv3720, and Rv0437c, annotated as putative ketoacyl reductase, fattyacylphospholipid synthase, and phosphatidylserine decarboxylase, respectively, were also identified. A simplified representation of the...”
- Mycobacteriophage SWU1 gp39 can potentiate multiple antibiotics against Mycobacterium via altering the cell wall permeability
Li, Scientific reports 2016 - “...fatty acid metabolism MSMEG_6041 2.41 Rv3573c lipid degradation MSMEG_3465 2.18 Rv1925 lipid degradation MSMEG_4716 2.51 Rv2501c lipid metabolism MSMEG_5907 2.15 Rv3505 involved in lipid degradation MSMEG_5923 2.10 Rv3523 lipid carrier protein MSMEG_5922 2.18 Rv3522 lipid transfer protein...”
- Precision methylome characterization of Mycobacterium tuberculosis complex (MTBC) using PacBio single-molecule real-time (SMRT) technology
Zhu, Nucleic acids research 2016 - “...assembly protein SufB -/- -/- +/+ -/+ +/+ -/- NA NA -/- -/- +/+ -/- Rv2501c No-data acetyl-/propionyl-CoA carboxylase subunit alpha +/+ +/+ -/+ -/+ +/+ -/+ NA NA -/- -/- -/- -/+ Rv1917c Non-essential PPE family protein, PPE34 -/+ -/+ +/+ +/+ +/+ +/+ NA...”
- Characterization of the mycobacterial acyl-CoA carboxylase holo complexes reveals their functional expansion into amino acid catabolism
Ehebauer, PLoS pathogens 2015 - “...at least four different mycobacterial YCC holo complexes. From these identified assemblies, the AccD1 (Rv2502c)-AccA1 (Rv2501c) YCC complex was selected for functional and structural studies. We demonstrate that this complex encodes a 3-methylcrotonyl-CoA carboxylase (MCC) involved in leucine catabolism. Electron micrographs of the AccD1-AccA1 holo complex...”
- “...Remarkably, in addition to the conserved operon organization, the expression of most genes (Rv2495c to Rv2501c) of the citE-scoA operon and the pdhABC operon are strongly correlated (for further details see Operon Correlation Browser ( www.broadinstitute.org/annotation/tbdb/operon/ ), suggesting that the effects observed are coupled. This observation...”
- bkaR is a TetR-type repressor that controls an operon associated with branched-chain keto-acid metabolism in Mycobacteria
Balhana, FEMS microbiology letters 2013 - “...MSMEG_4717 9.0 * 3.7E-05 accD1 Rv2502c Acetyl/propionyl-coenzyme A carboxylase ( subunit) MSMEG_4716 15.0 1.5E-05 accA1 Rv2501c Acetyl/propionyl-coenzyme A carboxylase ( subunit) MSMEG_4715 13.7 5.8E-06 fadE19 Rv2500c Acyl-CoA dehydrogenase MSMEG_4714 9.5 1.1E-04 Rv2499c Rv2499c Hydratase MSMEG_4713 16.5 4.6E-06 citE Rv2498c HpcH/HpaI aldolase/citrate lyase family protein MSMEG_4712 8.4...”
- A chemical proteomics approach to profiling the ATP-binding proteome of Mycobacterium tuberculosis
Wolfe, Molecular & cellular proteomics : MCP 2013 - “...3 3.50 Aldehyde dehydrogenase Rv0458 55 kDa (0.0066) 19 2 3.25 Acetyl-/propionyl-CoA carboxylase subunit, AccA1 Rv2501c 71 kDa (0.0001) 45 5 3.17 Fatty-acid-CoA ligase, FadD7 Rv0119 55 kDa (0.0020) 27 3 3.17 Electron transfer flavoprotein subunit, FixA Rv3029c 28 kDa (0.0020) 27 3 3.17 Fatty-acid-CoA ligase,...”
- “...NSAF_ATPS a Avg. NSAF_ATP b Fold change Competitive Binders of Desthiobiotin-ATP Acetyl-/propionyl-CoA carboxylase subunit, AccA1 Rv2501c 71 kDa (0.0000) 1.00 15.67 15.67 Glutamyl-tRNA amidotransferase subunit B, GatB Rv3009c 55 kDa (0.0000) 2.33 28.33 12.14 Inosine-5-monophosphate dehydrogenase, GuaB3 Rv3410c 39 kDa (0.0000) 1.00 11.67 11.67 Transmembrane serine/threonine-protein...”
- More
SYNPCC7002_A2127 acetyl-CoA carboxylase, biotin carboxylase from Synechococcus sp. PCC 7002
51% identity, 61% coverage
- Genetic tools for advancement of Synechococcus sp. PCC 7002 as a cyanobacterial chassis
Ruffing, Microbial cell factories 2016 - “...(2.42E03) Constitutive (0.0533) 0.256 Synpcc7002_A2062 Elongation factor G 5.33E03 1.0380.00945* Constitutive (3.95E06) Constitutive (0.0392) 0.0315 Synpcc7002_A2127 Acetyl-CoA carboxylase biotin carboxylase subunit 3.62E04 1.0730.0576* Constitutive (1.64E06) Constitutive (0.0583) 0.457 Synpcc7002_A2165 Hypothetical protein 9.95E05 1.2050.129* Stationary phase (3.20E05) Constitutive (0.148) 0.960 Synpcc7002_A2210 C-phycocyanin subunit alpha 2.91E02 1.1290.191 Linear...”
HKO16_15815 acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha from Acinetobacter baumannii ATCC 17978
41% identity, 92% coverage
- A bacterial methyltransferase that initiates biotin synthesis, an attractive anti-ESKAPE druggable pathway
Su, Science advances 2024 - “...analyses. All the four recombinant forms (AccB and HKO16_06425 in full length and HKO16_06925 plus HKO16_15815 in an EAMK-covering truncated version) were overexpressed and purified to homogeneity (fig. S2E). Furthermore, streptavidin blot demonstrated that they are indeed biotin-modified forms (fig. S2F), which is quite similar to...”
- “...AbBioC. The remaining eight proteins consisted of four putative biotinylated enzymes (AccB, HKO16_06425, HKO16_06925, and HKO16_15815), two components for apo-ACP generation [AcpH ( 82 ) and AcpP ( 81 , 85 )], and two elements [Sfp ( 83 , 86 ) and Pfs/Mtn ( 76 ,...”
OA858_03000 acetyl-CoA carboxylase biotin carboxylase subunit from Pseudanabaena galeata CCNP1313
50% identity, 61% coverage
Q06862 Biotin carboxylase from Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
49% identity, 61% coverage
- Differential protein profiling of soil diazotroph Rhodococcus qingshengii S10107 towards low-temperature and nitrogen deficiency.
Suyal, Scientific reports 2019 - “...kinase, B8HVB6), ThyA (Thymidylate synthase, Q0SEI1), RpsF (30S ribosomal protein S6), Tkt, AccC (Biotin carboxylase, Q06862), PanD (Aspartate 1-decarboxylase, Q8YR79), HutI (Imidazolonepropionase, B2JCJ1), PckG, SucC, Eno , Urease accessory proteins, glmM (Phosphoglucosamine mutase, Q98F91), GlmS, DdlA, Dxr (1-deoxy-D-xylulose 5-phosphate reductoisomerase, B7K5G6), Mqo (Probable malate:uinine oxidoreductase, Q89XM4),...”
- “...Glutamine fructose-6-phosphate aminotransferase, P59362 ); Biotin metabolism ( ATP-dependent dethiobiotin synthetase, B7K5E6 and Biotin carboxylase, Q06862 ), Nitrogen metabolism (Urease enzyme complex) and Nucleotide metabolism ( dITP/XTP pyrophosphatase, Q98DN4 and Thymidylate synthase, Q0SEI1 ) while down-regulating the enzymes for Lipid biosynthesis ( Acyl-[acyl-carrier-protein] UDP-N-acetylglucosamine O-acyltransferase, A8I491...”
LOC21385626 methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial from Morus notabilis
39% identity, 90% coverage
- Genome-Wide Identification of Candidate Genes Associated with Heat Stress in Mulberry (Morus alba L.)
Jin, Current issues in molecular biology 2023 - “...dehydrogenase (LOC21408668), branched-chain amino acid aminotransferase 1 (LOC21390509), isovaleryl-CoA dehydrogenase (LOC21397545), methylcrotonoyl-CoA carboxylase subunit alpha (LOC21385626), probable enoyl-CoA hydratase 1 (LOC21392597), aldehyde dehydrogenase family 3 (LOC21396538) and alanine--glyoxylate aminotransferase (LOC21404820). In plants, the catabolism of amino acids is extremely important in metabolic stress (e.g., when there...”
pycA / O27939 pyruvate carboxylase subunit A (EC 6.4.1.1) from Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (see paper)
49% identity, 66% coverage
liuD / Q9I299 methylcrotonyl-CoA carboxylase α-subunit (EC 6.4.1.4) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
Q9I299 methylcrotonoyl-CoA carboxylase (subunit 2/2) (EC 6.4.1.4) from Pseudomonas aeruginosa (see 3 papers)
PA2012 alpha subunit of geranoyl-CoA carboxylase, GnyA from Pseudomonas aeruginosa PAO1
41% identity, 93% coverage
- Proteome-wide identification of druggable targets and inhibitors for multidrug-resistant <i>Pseudomonas aeruginosa</i> using an integrative subtractive proteomics and virtual screening approach
Vemula, Heliyon 2025 - 3-methylcrotonyl-CoA carboxylase deficiency: clinical, biochemical, enzymatic and molecular studies in 88 individuals
Grünert, Orphanet journal of rare diseases 2012 - “...human MCCC1 (hMCCC1, Uniprot Q96RQ3), as well as the structurally characterized P. aeruginosa MCCC1 (paMCCC1, Q9I299), Ruegeria pomeroyi PCC (bPCCA, Q5LUF3), human ACC1 (hACC1, Q13085) and ACC2 (hACC2, O00763). Novel MCCC1 missense mutations are asterisked. The electrostatic interaction between Glu288 and Arg444 in MCCC1 is highlighted...”
- The opportunistic pathogen Pseudomonas aeruginosa exploits bacterial biotin synthesis pathway to benefit its infectivity
Shi, PLoS pathogens 2023 - “...aeruginosa . Genome-wide mining of P . aeruginosa reveals five putative biotinylated enzymes, namely PA1400, PA2012, PA2891, PA4847, and PA5435 ( S1 Table ). D. Streptavidin blot analyses for crude extracts of E . coli and P . aeruginosa . Unlike E . coli displaying a...”
- “...the presence of multiple biotinylated proteins. E. SDS-PAGE (12%) profile for three biotinylated enzymes (PA1400, PA2012, and PA2891). Three of five predictive biotinylated enzymes were overexpressed, purified, and judged with SDS-PAGE (12%). F. Western blot analysis of the three recombinant proteins (PA1400, PA2012, and PA2891) using...”
- Small Colony Variants and Single Nucleotide Variations in Pf1 Region of PB1 Phage-Resistant Pseudomonas aeruginosa
Lim, Frontiers in microbiology 2016 - “...9.E-04 PA2000 Dehydrocarnitine CoA transferase, subunit B -1.6 5.E-02 PA2001 atoB Acetyl-CoA acetyltransferase -1.9 1.E-02 PA2012 gnyA Alpha subunit of geranoyl-CoA carboxylase -2.6 4.E-02 PA2013 gnyH Gamma-carboxygeranoyl-CoA hydratase -2.6 2.E-02 PA2014 gnyB Beta subunit of geranoyl-CoA carboxylase -2.3 2.E-02 PA2247 bkdA1 2-oxoisovalerate dehydrogenase (alpha subunit) -2.7...”
- The Pseudomonas aeruginosa Isohexenyl Glutaconyl Coenzyme A Hydratase (AtuE) Is Upregulated in Citronellate-Grown Cells and Belongs to the Crotonase Family
Poudel, Applied and environmental microbiology 2015 - “...of California, Berkeley PA1535 PA1982 PA1984 PA2011 PA2012 PA2013 PA2014 PA2015 PA2886 PA2887 PA2888 PA2889 PA2890 PA2891 PA2892 PA4330 Gene Structure-Function...”
- Pseudomonas aeruginosa twitching motility-mediated chemotaxis towards phospholipids and fatty acids: specificity and metabolic requirements
Miller, Journal of bacteriology 2008 - “...PA0796 PA0797 PA0887 PA1137 PA1288 PA1736 PA1737 PA2011 PA2012 PA2013 PA2014 PA2015 PA2142 PA2552 PA2553 PA2554 PA2555 PA2557 PA2634 PA2764 PA2862 PA2863 PA2887...”
- The atu and liu clusters are involved in the catabolic pathways for acyclic monoterpenes and leucine in Pseudomonas aeruginosa
Aguilar, Applied and environmental microbiology 2006 - “...PA2893 PAO1::ISlacZ/hah (ID 11254), transposon insertion in ORF PA2012 PAO1SM mutant obtained by Himar1::Gmr transposition in ORF PA2891, unable to grow on...”
- “...PAO1SM mutant obtained by Himar1::Gmr transposition in ORF PA2012, unable to grow on citronellol Double mutant strain derived from PAO atuF, mutated in liuD...”
- Methylcrotonyl-CoA and geranyl-CoA carboxylases are involved in leucine/isovalerate utilization (Liu) and acyclic terpene utilization (Atu), and are encoded by liuB/liuD and atuC/atuF, in Pseudomonas aeruginosa
Höschle, Microbiology (Reading, England) 2005 (PubMed)- “...unequivocally identified as the gene products of liuD (PA2012; 74 kDa) and atuF (PA2891; 71 kDa), respectively (Figs 2 and 3). The three non-biotin-containing...”
- Effect of anaerobiosis and nitrate on gene expression in Pseudomonas aeruginosa
Filiatrault, Infection and immunity 2005 - “...PA1556 PA1561 PA1673 PA1789 PA1806 PA1882 PA1883 PA1939 PA2012 PA2013 PA2014 PA2015 PA2016 PA2024 PA2026 PA2073 PA2110 PA2112 PA2113 hemF aroE 4.5 3.5 5.1...”
- “...PA1986 PA1987 PA1988 PA1989 PA1990 PA1999 PA2003 PA2011 PA2012 PA2013 PA2014 PA2024 PA2052 PA2066 PA2067 PA2068 PA2069 PA2110 PA2112 PA2114 PA2194 PA2250 PA2266...”
- The gnyRDBHAL cluster is involved in acyclic isoprenoid degradation in Pseudomonas aeruginosa
Díaz-Pérez, Applied and environmental microbiology 2004 - “...showed that transposon insertion had occurred in the PA2012 and PA2014 ORFs, respectively, from the PGP database (26). Identification of the gny cluster from...”
- “...gnyB, gnyA, and gnyL genes (ORFs PA2015, PA2014, PA2012, and PA2011, respectively) were constructed as described in Materials and Methods. PCR analysis of...”
8rthA / Q57YQ4 Trypanosoma brucei 3-methylcrotonyl-coa carboxylase (see paper)
40% identity, 92% coverage
- Ligand: 5-(hexahydro-2-oxo-1h-thieno[3,4-d]imidazol-6-yl)pentanal (8rthA)
Clocel_4136 acetyl-CoA carboxylase biotin carboxylase subunit from Clostridium cellulovorans 743B
50% identity, 61% coverage
- Clostridium cellulovorans Proteomic Responses to Butanol Stress
Costa, Frontiers in microbiology 2021 - “...chain amino acids) biosynthesis and proteins involved in cell envelope re-arrangement (e.g., the products of Clocel_4136, Clocel_4137, Clocel_4144, Clocel_4162 and Clocel_4352, involved in the biosynthesis of saturated fatty acids) and a redistribution of carbon flux through fermentative pathways (acetate and formate yields were increased and decreased,...”
- “...). In the present study, five proteins involved in the biosynthesis of saturated fatty acids (Clocel_4136, Clocel_4137, Clocel_4144, Clocel_4162, and Clocel_4352) and two enzymes likely involved in phospholipid biosynthesis (Clocel_1331, Clocel_1338) were identified among the proteins up-regulated by butanol. Curiously, one of the two acyl carrier...”
XNRR2_4211 acetyl-CoA carboxylase biotin carboxylase subunit from Streptomyces albidoflavus
42% identity, 91% coverage
SM_b21124 3-methylcrotonyl-CoA carboxylase, alpha (biotin-containing) subunit (EC 6.4.1.4) from Sinorhizobium meliloti 1021
SMb21124 putative methylcrotonoyl-CoA carboxylase biotinylated subunit protein from Sinorhizobium meliloti 1021
41% identity, 92% coverage
Ngar_c01880 acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha from Candidatus Nitrososphaera gargensis Ga9.2
49% identity, 61% coverage
Q10YA8 biotin carboxylase (EC 6.3.4.14) from Trichodesmium erythraeum (see paper)
50% identity, 61% coverage
SCO2777 acetyl/propionyl CoA carboxylase alpha subunit from Streptomyces coelicolor A3(2)
42% identity, 91% coverage
- Origin of the 3-methylglutaryl moiety in caprazamycin biosynthesis
Bär, Microbial cell factories 2022 - “...M1154 revealed genes homologue to liuA ( sco2779 ), liuB ( sco2776 ), liuD ( sco2777 ) and liuE ( sco2778 ) (Additional file 1 : Fig. S6). No homologue was found for liuC in this cluster though, raising the question if this gene is located...”
- “...is hijacked for caprazamycin biosynthesis, we next generated mutants with single deletions of sco2776 , sco2777 , sco2778 or sco2779 resulting in S. coelicolor M1154 sco2776, S. coelicolor M1154 sco2777, S. coelicolor M1154 sco2778 and S. coelicolor M1154 sco2779 . Successful deletion and absence of wildtype...”
- Comparative Proteomic Analysis of Transcriptional and Regulatory Proteins Abundances in S. lividans and S. coelicolor Suggests a Link between Various Stresses and Antibiotic Production
Clara, International journal of molecular sciences 2022 - “...the biosynthesis of malonyl or methyl-malonylCoA, possibly used for fatty acids and/or polyketide (ACT) biosynthesis. SCO2777 and SCO2776 were highly abundant in SC but poorly abundant in SL , in both Pi conditions (Figure S2A of [ 9 ]), suggesting that SCO2775 represses the expression of...”
- AccR, a TetR Family Transcriptional Repressor, Coordinates Short-Chain Acyl Coenzyme A Homeostasis in Streptomyces avermitilis
Lyu, Applied and environmental microbiology 2020 (secret) - Iron competition triggers antibiotic biosynthesis in Streptomyces coelicolor during coculture with Myxococcus xanthus
Lee, The ISME journal 2020 - “...acetyl-CoA; (ii) the acetyl-CoA synthetase (SCO6195) converted acetate to acetyl-CoA; and (iii) acetyl-CoA carboxylases (SCO2776, SCO2777, and SCO4921) converted acetyl-CoA to malonyl-CoA (Fig. 1e ). Considering that the transcription levels of genes involved in other acetyl-CoA-associated pathways, such as glycolysis and the citrate cycle, showed no...”
- A Novel Two-Component System, Encoded by the sco5282/sco5283 Genes, Affects Streptomyces coelicolor Morphology in Liquid Culture
Arroyo-Pérez, Frontiers in microbiology 2019 - “...degradation I 8.90E-09 1.41E-04 4.44E-16 SCO2776 Carboxylase 2.11 Amino acid degradation I 3.14E-15 1.33E-01 3.77E-15 SCO2777 Carboxylase 2.12 Amino acid degradation I 1.85E-15 1.16E-01 0.00E+00 SCO2778 Hydroxymethylglutaryl-CoA lyase 1.96 Amino acid degradation I 2.54E-13 2.75E-01 1.06E-03 SCO2779 Acyl-CoA dehydrogenase 2.08 Amino acid degradation I 6.17E-15 1.50E-01...”
pycA / Q6M0D0 pyruvate carboxylase subunit A (EC 6.4.1.1) from Methanococcus maripaludis (strain S2 / LL) (see paper)
MMP0341 pyruvate carboxylase subunit A from Methanococcus maripaludis S2
51% identity, 61% coverage
- The Sac10b homolog in Methanococcus maripaludis binds DNA at specific sites
Liu, Journal of bacteriology 2009 - “...0.11 MMP0092 2 1.66 0.10 MMP0148 3 1.36 0.12 MMP0276 MMP0341 MMP0414 MMP0594 2 4 6 2 1.57 1.26 1.51 1.53 0.06 0.07 0.03 0.11 MMP0684 MMP0872 MMP0971 MMP1157...”
- “...oxidoreductase subunit (Mmp0003), pyruvate carboxylase subunit A (Mmp0341), and acetyl-CoA synthetase (Mmp0148). While the differences in protein levels were...”
P49787 Biotin carboxylase 1 from Bacillus subtilis (strain 168)
BSU24340 acetyl-CoA carboxylase biotin carboxylase subunit from Bacillus subtilis subsp. subtilis str. 168
52% identity, 61% coverage
SVEN_2566 acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha from Streptomyces venezuelae ATCC 10712
51% identity, 61% coverage
PXO_RS01865 acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha from Xanthomonas oryzae pv. oryzae PXO99A
40% identity, 92% coverage
- Melatonin Treatment Inhibits the Growth of Xanthomonas oryzae pv. oryzae
Chen, Frontiers in microbiology 2018 - “...-2.11 Acetyl-CoA acetyltransferase 22 PXO_RS11725 -2.01 Acetyl-CoA acetyltransferase 23 PXO_RS22370 -2.39 3-Oxoadipate:succinyl-CoA transferase, partial 24 PXO_RS01865 2.03 3-Methylcrotonyl-CoA carboxylase subunit alpha 25 PXO_RS11720 -2.07 3-Hydroxyacyl-CoA dehydrogenase 26 PXO_RS12650 -2.07 3-Hydroxyacyl-CoA dehydrogenase 27 PXO_RS20635 -1.90 2-Methylisocitrate lyase 28 PXO_RS20105 -2.20 Malate dehydrogenase 29 PXO_RS02070 -2.19 NADH-dependent FMN...”
G9LQ56 Acetyl-CoA carboxylase biotin carboxylase subunit from Bacillus subtilis subsp. subtilis
49% identity, 61% coverage
CNC01910 methylcrotonoyl-Coenzyme A carboxylase 1 from Cryptococcus neoformans var. neoformans JEC21
40% identity, 91% coverage
BLJAPNOD_03269 acetyl-CoA carboxylase biotin carboxylase subunit from Ensifer sp. M14
51% identity, 61% coverage
Sama_1359 3-methylcrotonyl-CoA carboxylase, alpha (biotin-containing) subunit (EC 6.4.1.4) from Shewanella amazonensis SB2B
41% identity, 92% coverage
- mutant phenotype: Specifically important for utilizing L-Leucine.
A9HEX0 Biotin carboxylase from Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
50% identity, 61% coverage
- Arabidopsis thaliana exudates induce growth and proteomic changes in Gluconacetobacter diazotrophicus
Dos, PeerJ 2020 - “...insertional mutants of G. diazotrophicus PAl5, defective in production of the proteins EttA (A9H4G2), AccC (A9HEX0), and Zwf (A9H326) were obtained from the G. diazotrophicus PAl5 mutant library of the Laboratrio de BiotecnologiaUENF ( Intorne et al., 2009 ). Such a mutant library was obtained by...”
- “...4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) ispG 6.00 1,571.93 3.00 A9GZU8 Conserved protein GDI0061 7.00 1,962.62 3.04 A9HEX0 acetyl-CoA carboxylase biotin carboxylase subunit accC 13.00 4,423.06 3.52 A9HS02 Elongation factor G fusA 31.00 10,183.21 3.93 A9H932 TonB-dependent receptor GDI0667 14.00 2,074.37 4.10 ILVC Ketol-acid reductoisomerase (NADP(+)) ilvC 5.00...”
A4APF1 biotin carboxylase (EC 6.3.4.14) from Maribacter sp. HTCC2170 (see paper)
50% identity, 61% coverage
BCAM2430 putative biotin carboxylase from Burkholderia cenocepacia J2315
42% identity, 92% coverage
F502_10483 acetyl-CoA carboxylase biotin carboxylase subunit from Clostridium pasteurianum DSM 525 = ATCC 6013
52% identity, 61% coverage
IUJ47_RS01520 acetyl-CoA carboxylase biotin carboxylase subunit from Enterococcus faecalis
49% identity, 62% coverage
- Antibacterial Components and Modes of the Methanol-Phase Extract from Commelina communis Linn
Liu, Plants (Basel, Switzerland) 2023 - “...IUJ47_RS01530 0.109 Acetyl-CoA carboxylase IUJ47_RS01515 0.158 Acetyl-CoA carboxylase carboxyltransferase subunit beta IUJ47_RS12350 0.183 Acetate kinase IUJ47_RS01520 0.262 Acetyl-CoA carboxylase biotin carboxylase subunit IUJ47_RS01510 0.294 Acetyl-CoA carboxylase carboxyl transferase subunit alpha IUJ47_RS07835 0.325 Bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase IUJ47_RS07670 0.397 Phosphate acetyltransferase IUJ47_RS08070 0.425 Pyruvate phosphate dikinase IUJ47_RS11250...”
EF2877 acetyl-CoA carboxylase, biotin carboxylase from Enterococcus faecalis V583
49% identity, 62% coverage
- Transcriptomic and functional analysis of NaCl-induced stress in Enterococcus faecalis
Solheim, PloS one 2014 - “...phospholipid metabolism EF2876 0,03 2,58 2,72 Acetyl-CoA carboxylase, biotin carboxylase Fatty acid and phospholipid metabolism EF2877 0,10 2,51 2,34 (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase Fatty acid and phospholipid metabolism EF2878 0,18 2,31 1,97 Acetyl-CoA carboxylase, biotin carboxyl carrier protein Fatty acid and phospholipid metabolism EF2879 0,28 2,24 1,80 3-oxoacyl-(acyl-carrier-protein)...”
Q0KA96 Acetyl/propionyl-CoA carboxylase, alpha subunit from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
42% identity, 92% coverage
jk1550 acyl-CoA carboxylase, alpha subunit from Corynebacterium jeikeium K411
49% identity, 61% coverage
SO1894 acetyl-CoA carboxylase, biotin carboxylase, putative from Shewanella oneidensis MR-1
41% identity, 92% coverage
A4JJM7 3-methylcrotonoyl-CoA carboxylase, alpha subunit from Burkholderia vietnamiensis (strain G4 / LMG 22486)
Bcep1808_3492 3-methylcrotonoyl-CoA carboxylase, alpha subunit from Burkholderia vietnamiensis G4
42% identity, 92% coverage
- Differential Expression and PAH Degradation: What Burkholderia vietnamiensis G4 Can Tell Us?
Cauduro, International journal of microbiology 2020 - “...894 prpB 2-Methylisocitrate lyase Yes A4JAP4 Bcep1808_0334 378768..379043(+) 276 rpsS 30S ribosomal protein S19 Yes A4JJM7 Bcep1808_3492 203642..205642() 2001 3-Methylcrotonoyl-CoA carboxylase subunit alpha Yes A4JDT5 Bcep1808_1430 1537771..1538475(+) 705 3-Oxoacid CoA-transferase subunit A Yes A4JAL3 Bcep1808_0303 336630..337727() 1098 hppD 4-Hydroxyphenylpyruvate dioxygenase Yes A4JBB7 Bcep1808_0558 614619..614882(+) 264 rpmA...”
- Differential Expression and PAH Degradation: What Burkholderia vietnamiensis G4 Can Tell Us?
Cauduro, International journal of microbiology 2020 - “...prpB 2-Methylisocitrate lyase Yes A4JAP4 Bcep1808_0334 378768..379043(+) 276 rpsS 30S ribosomal protein S19 Yes A4JJM7 Bcep1808_3492 203642..205642() 2001 3-Methylcrotonoyl-CoA carboxylase subunit alpha Yes A4JDT5 Bcep1808_1430 1537771..1538475(+) 705 3-Oxoacid CoA-transferase subunit A Yes A4JAL3 Bcep1808_0303 336630..337727() 1098 hppD 4-Hydroxyphenylpyruvate dioxygenase Yes A4JBB7 Bcep1808_0558 614619..614882(+) 264 rpmA 50S...”
7kctA / D3DJ42 Crystal structure of the hydrogenobacter thermophilus 2-oxoglutarate carboxylase (ogc) biotin carboxylase (bc) domain dimer in complex with adenosine 5'-diphosphate magnesium salt (mgadp), adenosine 5'- diphosphate (adp, and bicarbonate anion (hydrogen carbonate/hco3-) (see paper)
50% identity, 62% coverage
- Ligands: adenosine-5'-diphosphate; magnesium ion; bicarbonate ion (7kctA)
CPE1074 acetyl-CoA carboxylase from Clostridium perfringens str. 13
49% identity, 61% coverage
2OCS_HYDTT / D3DJ42 2-oxoglutarate carboxylase small subunit; 2-oxoglutarate carboxylase beta subunit; EC 6.4.1.7 from Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) (see 2 papers)
51% identity, 61% coverage
- catalytic activity: hydrogencarbonate + 2-oxoglutarate + ATP = (S)-oxalosuccinate + ADP + phosphate + H(+) (RHEA:20425)
cofactor: Mg(2+) Mn(2+) Co(2+)
subunit: Heterohexadecamer of 8 large subunits and 8 small subunits.
D174_19730 acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha from Mycolicibacterium neoaurum VKM Ac-1815D
40% identity, 92% coverage
SMc01345 acetyl-CoA carboxylase biotin carboxylase subunit from Sinorhizobium meliloti 1021
Q92QK1 Biotin carboxylase from Rhizobium meliloti (strain 1021)
51% identity, 61% coverage
CPF_1330 acetyl-CoA carboxylase, biotin carboxylase from Clostridium perfringens ATCC 13124
49% identity, 61% coverage
Smed_0952 acetyl-CoA carboxylase biotin carboxylase subunit from Sinorhizobium medicae WSM419
51% identity, 61% coverage
G7LIV6 Biotin carboxylase from Medicago truncatula
48% identity, 61% coverage
D8UF54 Biotin carboxylase from Volvox carteri f. nagariensis
49% identity, 61% coverage
Rru_A2435 Acetyl-CoA carboxylase, biotin carboxylase from Rhodospirillum rubrum ATCC 11170
Q2RRL0 Biotin carboxylase from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
48% identity, 61% coverage
3n6rA / Q5LUF3 Crystal structure of the holoenzyme of propionyl-coa carboxylase (pcc) (see paper)
48% identity, 64% coverage
- Ligand: 5-(hexahydro-2-oxo-1h-thieno[3,4-d]imidazol-6-yl)pentanal (3n6rA)
O23960 Biotin carboxylase from Glycine max
49% identity, 61% coverage
- Redox Conformation-Specific Protein-Protein Interactions of the 2-Cysteine Peroxiredoxin in Arabidopsis
Liebthal, Antioxidants (Basel, Switzerland) 2020 - “...chain 2 Q43832 * Malate dehydrogenase [NADP] P52426 * Glutamate--ammonia ligase Q9LVI8 * Biotin carboxylase O23960 2Cys-peroxiredoxin Q9SQJ4...”
- Proteomics gives insight into the regulatory function of chloroplast thioredoxins
Balmer, Proceedings of the National Academy of Sciences of the United States of America 2003 - “...are O20252, P09559, P12860, P10871, Q43832, P52426, Q9LVI8, O23960, and Q9SQJ4. *See Table 2 for definition of numbers. eluant from the thioredoxin columns....”
GBAA4408 acetyl-CoA carboxylase, biotin carboxylase from Bacillus anthracis str. 'Ames Ancestor'
49% identity, 61% coverage
RHECIAT_CH0001955 acetyl-CoA carboxylase, biotin carboxylase protein from Rhizobium etli CIAT 652
49% identity, 61% coverage
aq_1517 pyruvate carboxylase n-terminal domain from Aquifex aeolicus VF5
O67483 Pyruvate carboxylase n-terminal domain from Aquifex aeolicus (strain VF5)
50% identity, 62% coverage
BSU18240 acetyl-CoA carboxylase biotin carboxylase subunit from Bacillus subtilis subsp. subtilis str. 168
49% identity, 61% coverage
- The program of gene transcription for a single differentiating cell type during sporulation in Bacillus subtilis
Eichenberger, PLoS biology 2004 - “...ykvI (BSU13710), ykvU (BSU13830), ylbJ (BSU15030), ylbO/gerR (BSU15090), yngE (BSU18210), yngF (BSU18220), yngG (BSU18230), yngH (BSU18240), yngI (BSU18250), yngJ (BSU18260), yoaB (BSU18540), yoaD (BSU18560), yodU (BSU19810), ypqA (BSU22240), ypqP (BSU21670), yqfT (BSU25120), yqhV (BSU24440), yrdK (BSU26680), yydB (BSU40220), yydC (BSU40210), yydD (BSU40200), yydG (BSU40170), yydH (BSU40160),...”
A4I7C0 Methylcrotonoyl-coa carboxylase biotinylated subunitprotein-like protein from Leishmania infantum
38% identity, 92% coverage
XAC0263 biotin carboxylase from Xanthomonas axonopodis pv. citri str. 306
41% identity, 92% coverage
- 3-methylcrotonyl Coenzyme A (CoA) carboxylase complex is involved in the Xanthomonas citri subsp. citri lifestyle during citrus infection
Tomassetti, PloS one 2018 - “...acyl-CoA carboxylases (ACCase) enzymes dependent of biotin. In this work, we have identified two ORFs (XAC0263 and XAC0264) encoding for the and subunits of an acyl-CoA carboxylase complex from Xanthomonas and demonstrated that this enzyme has MCC activity both in vitro and in vivo . We...”
- “...Table ) and Mycobacterium [ 44 , 45 ]. Particularly Xcc has two ORFs, named XAC0263 and XAC0264, encoding for the putative and subunits of an ACCase complex in this bacterium, respectively. The subunit displays four highly conserved domains present in the subunits of several ACCases...”
F2WMV4 biotin carboxylase (EC 6.3.4.14) from Jatropha curcas (see paper)
49% identity, 61% coverage
Q1D0B9 Biotin carboxylase from Myxococcus xanthus (strain DK1622)
50% identity, 61% coverage
- Proteome Analyses of Soil Bacteria Grown in the Presence of Potato Suberin, a Recalcitrant Biopolymer
Sidibé, Microbes and environments 2016 - “...did not provide sufficient energy for bacterial proliferation. The presence of several carboxylases (Q1CYB4, Q1DDA0, Q1D0B9, Q1DOT9, Q1D555, Q1DDA2, and Q1D8V2) in the Myxococcus proteome also supports this hypothesis. Carboxylation represents a cellular biosynthetic mechanism to replenish tricarboxylic acid cycle intermediates used in biosynthetic pathways (...”
- “...synthetase 0.06 I Q1DDA0 propionyl-CoA carboxylase 0.07 0.02 I Q1DFT0 3-oxoacyl-[acyl-carrier protein] reductase 0.21 I Q1D0B9 acetyl-CoA carboxylase 0.10 I Q1D340 malonyl CoA-acyl carrier protein transacylase 0.11 I Q1D5U1 3-hydroxyacyl-CoA dehydrogenase 0.18 I Q1D5U2 enoyl CoA dehydratase 0.13 I Q1D4E4 acyl-CoA dehydrogenase 0.07 I Q1D0T9 acetyl...”
A4SVB6 biotin carboxylase (EC 6.3.4.14) from Polynucleobacter asymbioticus QLW-P1DMWA-1 (see paper)
48% identity, 61% coverage
lmo1357 acetyl-CoA carboxylase subunit (biotin carboxylase subunit) from Listeria monocytogenes EGD-e
LM6179_2100 acetyl-CoA carboxylase biotin carboxylase subunit from Listeria monocytogenes 6179
50% identity, 61% coverage
- SecA2 Associates with Translating Ribosomes and Contributes to the Secretion of Potent IFN-β Inducing RNAs
Teubner, International journal of molecular sciences 2022 - “...metabolism 0.09 0.13 lmo2206 clpB Chaperone protein ClpB Posttranslational modification. protein turnover. chaperones 0.12 0.13 lmo1357 acetyl-CoA carboxylase biotin carboxylase subunit Lipid transport and metabolism 0.12 0.11 lmo1217 Putative aminopeptidase. M42 family Carbohydrate transport and metabolism 0.09 0.11 lmo1928 aroF Chorismate synthase Amino acid transport and...”
- Prebiotic Oligosaccharides Potentiate Host Protective Responses against L. Monocytogenes Infection
Chen, Pathogens (Basel, Switzerland) 2017 - “...0.008 lmo1164, lmo1181 Adenosylcobalamin salvage from cobalamin 0.008 Biotin-carboxyl carrier protein assembly 0.022 accD , lmo1357 Vitamin B 6 Biosynthesis 0.022 serC , lmo2101 Amino acid metabolism Amino Acids Degradation 0.006 gltD, aspB, lmo2836, lmo2363, lmo0383, lmo1182, lmo2101, lmo2749, lmo1915 Proteinogenic Amino Acids Degradation 0.006 L-aspartate...”
- Listeria monocytogenes {sigma}B has a small core regulon and a conserved role in virulence but makes differential contributions to stress tolerance across a diverse collection of strains
Oliver, Applied and environmental microbiology 2010 - “...lmo0958 lmo0959 lmo1076 lmo1237 lmo1255 lmo1293 lmo1348 lmo1357 lmo1389 lmo1390 lmo1391 lmo1538 lmo1539 lmo1542 lmo1570 lmo1658 lmo1849 lmo1956 lmo1998 lmo2000...”
- Transcriptome analysis of Listeria monocytogenes exposed to biocide stress reveals a multi-system response involving cell wall synthesis, sugar uptake, and motility
Casey, Frontiers in microbiology 2014 - “...carboxylase (carboxyltransferase alpha subunit) 2.37 LM6179_2099 accB Acetyl-CoA carboxylase subunit (biotin carboxyl carrier subunit) 1.79 LM6179_2100 accC Acetyl-CoA carboxylase subunit (biotin carboxylase subunit) 3.52 LM6179_2324 accD Acetyl-CoA carboxylase (carboxyltransferase beta subunit) 2.02 LM6179_2580 fapR Transcription factor controlling fatty acid and phospholipid metabolism 3.89 A gene is...”
FRAAL3159 Acetyl-/propionyl-coenzyme A carboxylase alpha chain [Includes: Biotin carboxylase and Biotin carboxyl carrier protein (BCCP)] from Frankia alni ACN14a
40% identity, 90% coverage
- The Proteogenome of Symbiotic Frankia alni in Alnus glutinosa Nodules
Pujic, Microorganisms 2022 - “...acyl-dehydrogenases (FRAAL1659-FRAAL1670) were not identified. Almost all carboxylases were underabundant such as three acetyl-CoA carboxylases (FRAAL3159, FC = 0.55; FRAAL1213, FC = 0.43; FRAAL3158, FC = 0.23), a methyl-crotonoyl-CoA carboxylase (FRAAL2343, FC = 0.15) and two propionyl-CoA carboxylases (FRAAL5672, FC = 0.05; FRAAL1210, FC = 0.68)....”
V6Z187 Biotin carboxylase from Streptococcus agalactiae LMG 14747
48% identity, 63% coverage
A1S_3005 putative geranyl-CoA carboxylase alpha subunit from Acinetobacter baumannii ATCC 17978
40% identity, 89% coverage
- Molecular mechanisms of ethanol-induced pathogenesis revealed by RNA-sequencing
Camarena, PLoS pathogens 2010 - “...Outer membrane protein 5 A1S_2499 2.6 Hypothetical protein A1S_2395 3.4 Hypothetical protein, COG1741 Pirin-related protein A1S_3005 4.7 COG4770 Acetyl-Co carboxylase, alpha-sub. A1S_2120 2.1 Pseudouridine synthase A1S_1642 2.6 Putative acyl-CoA dehydrogenase A1S_1950 2.2 Universal stress protein A1S_3300 4.6 Acetate permease A1S_3362 3 Hypothetical protein. Haloacid dehalogenase-like superfamily...”
APL_1865 Biotin carboxylase from Actinobacillus pleuropneumoniae L20
49% identity, 61% coverage
FXV78_RS03210 acetyl-CoA carboxylase biotin carboxylase subunit from Mediterraneibacter gnavus ATCC 29149
48% identity, 61% coverage
MSMEG_0334 acetyl-/propionyl-coenzyme A carboxylase alpha chain from Mycobacterium smegmatis str. MC2 155
40% identity, 91% coverage
- Control of biotin biosynthesis in mycobacteria by a pyruvate carboxylase dependent metabolic signal
Lazar, Molecular microbiology 2017 - “...M. smegmatis identified the pyruvate carboxylases MSMEG_2412 and MSMEG_6648, as well as the acetyl/propionyl-CoA carboxylases MSMEG_0334, 1807, 5943, and 4716. Each of these acetyl/propionyl-CoA carboxylases are predicted to have a molecular weight between 60 and 75 kDa. The biotinylated proteins we detected with molecular weights of...”
- “...of another biotin-utilizing enzyme in trans , such as the acetyl/propionyl-CoA carboxylase alpha chain enzymes MSMEG_0334 or MSMEG_1807. Each of these proteins contains a BC and BCCP domain, but lacks a CT domain, which is present in the beta chain present on a separate polypeptide. In...”
2vpqB / A0A0H3JRR2 Crystal structure of biotin carboxylase from s. Aureus complexed with amppnp (see paper)
51% identity, 61% coverage
- Ligands: phosphoaminophosphonic acid-adenylate ester; magnesium ion (2vpqB)
BCAL3421 biotin carboxylase from Burkholderia cenocepacia J2315
49% identity, 61% coverage
- Exploring the metabolic network of the epidemic pathogen Burkholderia cenocepacia J2315 via genome-scale reconstruction
Fang, BMC systems biology 2011 - “...analysis, the genome-scale metabolic model of B. cenocepacia was further refined. For example, BCAL0660 and BCAL3421, which were homologous genes encoding protein AccC according to their annotation, were originally both included in the model with the gene-protein-reaction (GPR) relationship of "BCAL0660 or BCAL3421". Through in silico...”
- “...are cotranscribed and form an operon together [ 73 , 74 ]. Furthermore, BCAL3420 and BCAL3421 shows greater than 2-fold expression for J2315 under CF conditions versus soil conditions, yet BCAL0660 shows an opposite result [ 75 ]. Taken together, BCAL0660 was excluded from model i...”
SACOL1571 acetyl-CoA carboxylase, biotin carboxylase from Staphylococcus aureus subsp. aureus COL
SA1357 acetyl-CoA carboxylase from Staphylococcus aureus subsp. aureus N315
NWMN_1431 acetyl-CoA carboxylase biotin carboxylase subunit from Staphylococcus aureus subsp. aureus str. Newman
B7H15_08395, EKM74_RS01000 acetyl-CoA carboxylase biotin carboxylase subunit from Staphylococcus aureus
51% identity, 61% coverage
- Complete and SOS-mediated response of Staphylococcus aureus to the antibiotic ciprofloxacin
Cirz, Journal of bacteriology 2007 - “...SACOL0987 SACOL0988 SACOL1243 SACOL1244 SACOL1245 SACOL1571 SACOL1572 SACOL2079 Toxin production/resistance and pathogenesis Down-regulated ORFs SACOL1173...”
- Characterizing the effects of inorganic acid and alkaline shock on the Staphylococcus aureus transcriptome and messenger RNA turnover
Anderson, FEMS immunology and medical microbiology 2010 - “...sa_c1344s1117_a_at * 4.1 2.5 2.5 SA1266 putative DNA processing protein sa_c1643s1381_at * 3.4 2.5 2.5 SA1357 thermonuclease sa_c3053s2604_a_at * 2.4 2.5 30 SA1732 replication initiation and membrane attachment protein Signal transduction sa_c1996s1713_a_at 2.9 2.5 15 arlS SA1450 sensor histidine kinase sa_c6155s5336_a_at * 4.4 2.5 2.5 lytS...”
- “...protein DprA sa_c1522s1300_a_at 3.7 2.5 2.5 SA1326 putative GTP-binding protein sa_c1643s1381_at * 6.3 2.5 ND SA1357 thermonuclease sa_c2640s2213_a_at 11.4 2.5 2.5 SA1615 ATP dependent DNA helicase sa_c2726s2297_a_at 3.6 2.5 2.5 SA1643 DNA polymerase III sa_c2861s2424_a_at 4.0 2.5 2.5 SA1682 recombination factor protein RarA sa_c2977s2534_a_at 2.3 2.5...”
- Insights on evolution of virulence and resistance from the complete genome analysis of an early methicillin-resistant Staphylococcus aureus strain and a biofilm-producing methicillin-resistant Staphylococcus epidermidis strain
Gill, Journal of bacteriology 2005 - “...SA2209 hlgB MW2344 hlgB SA2160 SA0762d SA2194 hysA SA1357 nuc SA0860 SA1264 lytN SA1281 SA0833 clpP SAV2170 SAV0919 SAV2202 SAV1324 SAV0815 SAV1247 SAV1262...”
- Comparative genomics of Staphylococcus aureus musculoskeletal isolates
Cassat, Journal of bacteriology 2005 - “...SA0209 SA0317 SA0712 SA0857 SA0860 SA1028 SA1056 SA1057 SA1357 SA1864 SA1865 SA1866 SA1867 SA1868 SA1869 SA1970 SA2194 SA2549 SA2659 SA2694 SA2003 JAMS1 UAMS601...”
- (p)ppGpp/GTP and Malonyl-CoA Modulate Staphylococcus aureus Adaptation to FASII Antibiotics and Provide a Basis for Synergistic Bi-Therapy
Pathania, mBio 2021 - “...the in vivo promoter fusion P accBC -lacZ to measure expression of accBC (NWMN_1432 and NWMN_1431), which encode subunits of acetyl-CoA carboxylase (ACC) required for malonyl-CoA synthesis ( Table S2 ). Stringent response induction by mupirocin led to decreases in malonyl-CoA pools (6-fold) and in P...”
- Staphylococcus aureus Stress Response to Bicarbonate Depletion
Liberini, International journal of molecular sciences 2024 - “...fatty acid binding protein 2 1 1 Carboxylating Enzymes B7H15_09750 PckA, PEP carboxylase 5 100 B7H15_08395 AccC, acetyl-coA carboxylase 1.2 2 () indicates a downregulation of gene expression in the mutant compared to the parent. nd, not determined....”
- Transcriptomic Analysis Revealed Antimicrobial Mechanisms of Lactobacillus rhamnosus SCB0119 against Escherichia coli and Staphylococcus aureus
Peng, International journal of molecular sciences 2022 - “...; alcohol dehydrogenase DNA replication EKM74_RS04795 85.2 44.94 39.85 1.91 1.09611 single-stranded DNA-binding protein Ribosome EKM74_RS01000 77.06 19.54 474.46 30.77 2.622215 accC ; acetyl-CoA carboxylase biotin carboxylase subunit EKM74_RS01125 36.7 12.69 642.43 184.29 4.129847 rpmG ; 50S ribosomal protein L33 EKM74_RS01310 21.83 0.96 168.95 53.18 2.951911...”
CAC2 / O04983 biotin carboxylase (EC 6.3.4.14) from Arabidopsis thaliana (see paper)
ACCC_ARATH / O04983 Biotin carboxylase, chloroplastic; Acetyl-coenzyme A carboxylase biotin carboxylase subunit A; EC 6.3.4.14 from Arabidopsis thaliana (Mouse-ear cress) (see 4 papers)
AT5G35360 CAC2; acetyl-CoA carboxylase/ biotin carboxylase from Arabidopsis thaliana
NP_198386 acetyl Co-enzyme a carboxylase biotin carboxylase subunit from Arabidopsis thaliana
47% identity, 64% coverage
- function: This protein is a component of the acetyl coenzyme A carboxylase complex; first, biotin carboxylase catalyzes the carboxylation of the carrier protein and then the transcarboxylase transfers the carboxyl group to form malonyl-CoA.
catalytic activity: N(6)-biotinyl-L-lysyl-[protein] + hydrogencarbonate + ATP = N(6)-carboxybiotinyl-L-lysyl-[protein] + ADP + phosphate + H(+) (RHEA:13501)
cofactor: Mg(2+) Mn(2+) (Binds 2 magnesium or manganese ions per subunit.)
subunit: Acetyl-CoA carboxylase is a heterohexamer composed of biotin carboxyl carrier protein, biotin carboxylase and two subunits each of ACCase subunit alpha and ACCase plastid-coded subunit beta (accD). - Bioinformatics Identification and Expression Analysis of Acetyl-CoA Carboxylase Reveal Its Role in Isoflavone Accumulation during Soybean Seed Development
Wu, International journal of molecular sciences 2024 - “...is a hetero-oligomer composed of four different subunits located in the plastids ( AT5G16390 , AT5G35360 , AT2G38040 , and ATCG00500 ), while the other two are homodimers, ACC1 ( AT1G36160 ) and ACC2 ( AT1G36180 ), located in the cytoplasm and chloroplasts [ 22 ]....”
- Circadian clock factors regulate the first condensation reaction of fatty acid synthesis in Arabidopsis
Kim, Cell reports 2023 - “...CCA1, At2g46830; TOC1, At5g61380; ACC1, At1g36160; ACC2, At1g36180; KASI, At5g46290; KASII, At1g74960; KASIII, At1g62640; BC, At5g35360; BCCP1, At5g16390; BCCP2, At5g15530; BADC1, At3g56130; BADC2, At1g52670; BADC3, At3g15690; a-CT, At2g38040; b-CT, Atcg00500; Ubiquitin10, At4g05320. QUANTIFICATION AND STATISTICAL ANALYSIS Statistical analyses were performed by two-tailed Students t-test using the...”
- Iron Availability Influences Protein Carbonylation in Arabidopsis thaliana Plants
Tola, International journal of molecular sciences 2023 - “...Chloroplast Signalling 23 Metacaspase-4 O64517 AT1G79340 45 2 Cytosol Plant defense 24 Biotin carboxylase F4JYE0 AT5G35360 61 9 Chloroplast Fatty acid metabolism 25 Formate dehydrogenase A0A1P8B9L1 AT5G14780 41 4 Mitochondria ijms-24-09732-t002_Table 2 Table 2 List of carbonylated proteins identified in the iron-deficient samples only. SN Protein...”
- An expanded role for the transcription factor WRINKLED1 in the biosynthesis of triacylglycerols during seed development
Kuczynski, Frontiers in plant science 2022 - “...Attachment Domain Containing, AT3G15690) 4 , 5 87/+73(+) 9.53.1 0.58 0.94 ** BC (Biotin Carboxylase, AT5G35360) 6 68/+62() 0.20.2 0.50 0.98 ** BCCP 1 (Biotin Carboxyl Carrier Protein 1, AT5G16390) 7 60/+43(+) 62.219.5 0.92 0.93 ** BCCP 2 (Biotin Carboxyl Carrier Protein 2, AT5G15530) 5 ,...”
- The Sunflower WRINKLED1 Transcription Factor Regulates Fatty Acid Biosynthesis Genes through an AW Box Binding Sequence with a Particular Base Bias
Sánchez, Plants (Basel, Switzerland) 2022 - “...Y HanXRQr2Chr15g0671211 -CT-15g 2 Plastid Y-5 D.N.S. -CT AtCg00500 HanXRQr2CPg0836391 0 Plastid Y-0.8 D.N.S. BC At5g35360 HanXRQr2Chr16g0770591 BC-16g 6 Plastid Y-35 D.N.S. HanXRQr2Chr17g0824731 0 Plastid Y-7 BCCP At5g15530 HanXRQr2Chr02g0061841 BCCP-2g 1 Plastid Y-18 D.N.S. HanXRQr2Chr05g0231761 0 Plastid Y-3 HanXRQr2Chr09g0408331 BCCP-9g 2 Plastid Y-85 HanXRQr2Chr16g0729021 BCCP-16g 6...”
- New Insights into the Chloroplast Outer Membrane Proteome and Associated Targeting Pathways
Fish, International journal of molecular sciences 2022 - “...Hsc70-1 At5g02580 * Argininosuccinate Lyase At5g16870 PTH2 Family Protein At5g20300 TOC90 At5g20410 MGD2 At5g23190 CYP86B1 At5g35360 CAC2/BC At5g42070 - At5g43070 WPP1 At5g53280 PDV1 At5g58140 PHOT2 At5g59840 RAB8A-Like Protein 1 Arabidopsis gene identifier (AGI) number, 2 Proteins without a name are marked with -, 3 N-Terminal transit...”
- Integrated Transcriptomic and Bioinformatics Analyses Reveal the Molecular Mechanisms for the Differences in Seed Oil and Starch Content Between Glycine max and Cicer arietinum
Cheng, Frontiers in plant science 2021 - “...BCCP1 Biotin Carboxyl Carrier Protein of Heteromeric ACCase Glyma.18G243500 Glyma.09G248900 Ca_06111 Klaus et al., 2004 AT5G35360 BC Biotin Carboxylase of Heteromeric ACCase Glyma.08G027600 Glyma.05G221100 Ca_05874 Roesler et al., 1997 AT5G46290 KASI Ketoacyl-ACP Synthase I Glyma.08G084300 Ca_05157 Yang et al., 2016 AT1G74960 KASII Ketoacyl-ACP Synthase II Glyma.17G047000...”
- Gel-based proteomic map of Arabidopsis thaliana root plastids and mitochondria
Grabsztunowicz, BMC plant biology 2020 - “...Biotin carboxyl carrier protein of acetyl-CoA carboxylase 1 86 Q42533, At5g16390 Biotin carboxylase 47 O04983, At5g35360 Enoyl-[acyl-carrier-protein] reductase [NADH] 82, 83 Q9SLA8, At2g05990 Pyruvate dehydrogenase E1 component subunit beta-3 79 O64688, At2g34590 ENERGETICS ATP synthesis ATP synthase subunit alpha 22, 30, 49, 86 P56757, AtCg00120 ATP...”
- “...- and -subunits of carboxyltransferase [ 50 ]. Indeed, three of these proteins (biotin carboxylase, At5g35360, spot 47; biotin carboxyl carrier protein, At5g16390, spot 86; carboxyl transferase subunit , AtCg00500, spots 47 and 59) were identified in our root plastid sample (Table 1 ). Then, another...”
- More
- Chloroplast acetyl-CoA carboxylase activity is 2-oxoglutarate-regulated by interaction of PII with the biotin carboxyl carrier subunit.
Feria, Proceedings of the National Academy of Sciences of the United States of America 2010 - GeneRIF: These data show that PII function has evolved between bacterial and plant systems to control the carbon metabolism pathway of fatty acid synthesis in plastids, through regulation of acetyl-CoA carboxylase activity.
- Gel-based proteomic map of Arabidopsis thaliana root plastids and mitochondria
Grabsztunowicz, BMC plant biology 2020 - “...AtCg00500 Biotin carboxyl carrier protein of acetyl-CoA carboxylase 1 86 Q42533, At5g16390 Biotin carboxylase 47 O04983, At5g35360 Enoyl-[acyl-carrier-protein] reductase [NADH] 82, 83 Q9SLA8, At2g05990 Pyruvate dehydrogenase E1 component subunit beta-3 79 O64688, At2g34590 ENERGETICS ATP synthesis ATP synthase subunit alpha 22, 30, 49, 86 P56757, AtCg00120...”
- Identification of the Candidate Proteins Related to Oleic Acid Accumulation during Peanut (Arachis hypogaea L.) Seed Development through Comparative Proteome Analysis
Liu, International journal of molecular sciences 2018 - “...1.23 Q9ZVQ3 GSTZ1 lipid oxidation Araip.10039882.1 1.17 Q8L9C4 KCR1 fatty acid biosynthetic process Araip.10034519.1 1.08 O04983 CAC2 fatty acid derivative biosynthetic process Araip.10005278.1 1.03 O04420 At2g26230 lipid oxidation Araip.10021913.1 1.01 Q9FMN0 SCP2 lipid oxidation Araip.10000513.1 1.04 Q38882 PLDALPHA1 fatty acid metabolic process Araip.10003126.1 1.04 O22898 LACS1...”
- “...Araip.10034912.1 1.25 Q9FLH8 At5g51830 lipid metabolic process Araip.10032969.1 1.23 Q9ZVQ3 GSTZ1 lipid oxidation Araip.10034519.1 1.13 O04983 CAC2 lipid biosynthetic process Araip.10000107.1 1.02 P56765 accD lipid biosynthetic process Araip.10036992.1 1 Q9CAP8 LACS9 fatty acid metabolic process Araip.10004872.1 1.04 O65202 ACX1 lipid oxidation Araip.10003126.1 1.11 O22898 LACS1 fatty...”
- dEMBF: A Comprehensive Database of Enzymes of Microalgal Biofuel Feedstock
Misra, PloS one 2016 - “...carboxylase alpha-carboxyltransferase alpha-CT 6.4.1.2 Q9LD43 Acetyl-CoA carboxylase beta-carboxyltransferase beta-CT 6.4.1.2 P56765 Biotin carboxylase BC 6.3.4.14 O04983 Biotin carboxyl carrier protein BCCP 6.4.1.2 Q9LLC1, Q42533 Malonyl-CoA-ACP Malonyltransacylase MCMT/MCAT/FabD 2.3.1.39 Q8RU07 beta-ketoacyl-ACP Synthase I KAS I/FabF 2.3.1.179 P52410 beta-ketoacyl-ACP Synthase II KAS II/FabF 2.3.1.179 Q9C9P4 beta-ketoacyl-ACP Synthase III...”
- Microgravity induces changes in microsome-associated proteins of Arabidopsis seedlings grown on board the international space station
Mazars, PloS one 2014 - “...Early nodulin-like protein 2 (Phytocyanin-like protein) Lipid metabolism F4HYI6 AT1G48600 0.56281 Putative phosphoethanolamine N-methyltransferase 2 O04983 AT5G35360 0.52901 Biotin carboxylase, chloroplastic (EC 6.3.4.14) (Acetyl-CoA carboxylase subunit A) (ACC) (EC 6.4.1.2) Q9LD43 AT2G38040 0.33612 Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, chloroplastic (ACCase subunit alpha) (EC 6.4.1.2)...”
- Phylogenomic study of lipid genes involved in microalgal biofuel production-candidate gene mining and metabolic pathway analyses
Misra, Evolutionary bioinformatics online 2012 - “...Q00ZG8 CMM188C 41 46 Heteromeric ACC biotin carboxylase subunit (BCC) 6.4.1.2/6.3.4.14 KOG0238 K01961 GO:0004075 GO:0003989 O04983, F4JYE1, F4JYE0 A8JGF4, A8JEW0 D8UF54 A4S140 , Q013U7 CMS299C ACC carboxyl-transferase -subunit (ACCCT ) 6.4.1.2 KOG0238 K01962 GO:0003989 Q9LD43 A8J646 D8TNY0 CMV056C ACC CT subunit (ACCCT ) 6.4.1.2 KOG0540 K01963...”
2vqdA / P37798 Crystal structure of biotin carboxylase from pseudomonas aeruginosa complexed with ampcp (see paper)
47% identity, 61% coverage
- Ligands: phosphomethylphosphonic acid adenosyl ester; magnesium ion (2vqdA)
PA4848 biotin carboxylase from Pseudomonas aeruginosa PAO1
PA14_64110 biotin carboxylase from Pseudomonas aeruginosa UCBPP-PA14
47% identity, 61% coverage
- The absence of SigX results in impaired carbon metabolism and membrane fluidity in Pseudomonas aeruginosa
Fléchard, Scientific reports 2018 - “...the carboxylation of the product of accB (PA4847) by a biotin carboxylase encoded by accC (PA4848). Another putative biotin carboxylase homolog sharing 55% identity with AccC is encoded by PA0494, a gene lying in the PA0493-PA0496 operon, whose transcript level is also strongly decreased (>6) in...”
- Protein complex formation during denitrification by Pseudomonas aeruginosa
Borrero-de, Microbial biotechnology 2017 - “...of pyruvate dehydrogenase (PA5015), pyruvate kinase (PA4329), phosphopyruvate hydratase (PA3035), acetylCoA carboxylase (PA3112, PA3639 and PA4848) and phosphoenolpyruvate synthase (PA1770) (Ornston, 1971 ; Meylan etal ., 2017 ) (Fig. 2 B). The denitrification supercomplex as a platform for corresponding transport and maturation factors The respirasome included...”
- Protein Network of the Pseudomonas aeruginosa Denitrification Apparatus
Borrero-de, Journal of bacteriology 2016 - “...hydratase (PA3035), acetylCoA carboxylase (PA3112, PA3639, and PA4848), and phosphoenolpyruvate synthase (PA1770) were also found to be bound. The...”
- Pseudomonas aeruginosa ceftolozane-tazobactam resistance development requires multiple mutations leading to overexpression and structural modification of AmpC
Cabot, Antimicrobial agents and chemotherapy 2014 - “...PA4673.1 Intergenic PA4745 PA4771 PA4783 PA4819 Intergenic PA4840 PA4846 PA4848 PA4856 gcpE acoR opmD pilB yfiT pilE nusA lldD yedA a 7, P1.2, TOL-TAZr 7,...”
- A systems-level approach for investigating Pseudomonas aeruginosa biofilm formation
Xu, PloS one 2013 - “...prs ), PA4729( panB ),PA4730( panC ),PA4749( glmM ),PA4750( folP ), PA4759( dapB ),PA4847( accB ),PA4848( accC ),PA4854( purH ), PA4920( nadE ),PA4938( purA ),PA4988( waaA ),PA4996( rfaE ), PA5009( waaP ),PA5010( waaG ),PA5011( waaC ),PA5012( waaF )PA5034( hemE ),PA5162( rmlD ),PA5163( rmlA ),PA5175( cysQ ),...”
- A systems biology approach to drug targets in Pseudomonas aeruginosa biofilm
Sigurdsson, PloS one 2012 - “...of cofactors, prosthetic groups and carriers, cell wall/ Lipopolysaccharide/ capsule UppS (PA3652) Biotin biosynthesis AccC (PA4848) Branched chain amino acid biosynthesis IlvC (PA4694), IlvD (PA0353) Cell envelope biosynthesis GlmU (PA5552), GlmS (PA5549), MurI (PA4662), MraY (PA4415), MurE (PA4417), MurC (PA4411), MurB (PA2977) DdlB (PA4410), DdlA (PA4201),...”
- “...RmlB (PA5161) Citrate acid cycle SdhC (PA1581), SdhD (PA1582) Coenzyme A biosynthesis CoaE (PA4529), Dfp (PA4848) PanE (PA4397) PanB (PA4729) PanC (PA4730) Cysteine metabolism CysC (PA1393) CysH (PA1756) Fatty acid biosynthesis FabB (PA1609) Folate metabolism FolB (PA0582), FolP (PA4750) FolK (PA4728) PhoA (PA3296) Fructose and mannose...”
- Transcriptional and proteomic responses of Pseudomonas aeruginosa PAO1 to spaceflight conditions involve Hfq regulation and reveal a role for oxygen
Crabbé, Applied and environmental microbiology 2011 - “...PA4633 PA4671 PA4692 PA4702 PA4739 PA4740 PA4743 PA4847 PA4848 PA4880 PA4935 PA4944 PA5049 PA5054 PA5067 PA5069 PA5078 PA5117 PA5128 PA5276 PA5316 PA5355 PA5460...”
- Molecular mechanisms of chlorhexidine tolerance in Burkholderia cenocepacia biofilms
Coenye, Antimicrobial agents and chemotherapy 2011 - “...involved in biotin metabolism (PA4847 [homolog, BCAL3420] and PA4848 [BCAL3421]) and PA5557 and PA5558, encoding - and -subunits of the F0F1 ATP synthase...”
- More
- Identification of the alternative sigma factor SigX regulon and its implications for Pseudomonas aeruginosa pathogenicity
Blanka, Journal of bacteriology 2014 - “...PA14_42350 PA14_42380 PA14_42400 PA14_42430 PA14_42440 PA14_43690 PA14_49160 PA14_64110 PA14_68360 Gene name PA14 sigX::Gmr vs WT PA14b a SigX Regulon in...”
8j78I / Q96RQ3 Human 3-methylcrotonyl-coa carboxylase in bccp-h2 state
38% identity, 92% coverage
- Ligand: 5-(hexahydro-2-oxo-1h-thieno[3,4-d]imidazol-6-yl)pentanal (8j78I)
F4JYE0 Biotin carboxylase from Arabidopsis thaliana
49% identity, 61% coverage
FTT_0473 Acetyl-CoA carboxylase, biotin carboxylase subunit from Francisella tularensis subsp. tularensis SCHU S4
51% identity, 61% coverage
- The francisella tularensis proteome and its recognition by antibodies
Kilmury, Frontiers in microbiology 2010 - “...( 2007 ), Janovska et al. ( 2007a ), Sundaresh et al. ( 2007 ) FTT_0473 Acetyl-CoA carboxylase, biotin carboxylase subunit accC Mouse 2D-Western blot Cytoplasmic Havlasova et al. ( 2005 ) FTT_0479 PerM family Human, presumed type B Proteome microarray Cytoplasmic membrane Sundaresh et al....”
B9S1E2 Biotin carboxylase from Ricinus communis
48% identity, 61% coverage
T303_03115 acetyl-CoA carboxylase biotin carboxylase subunit from Streptococcus thermophilus ASCC 1275
49% identity, 62% coverage
- Proteomic analysis reveals potential factors associated with enhanced EPS production in Streptococcus thermophilus ASCC 1275
Padmanabhan, Scientific reports 2020 - “...upregulated. Downregulated proteins were those involved in fatty acid biosynthesis (acetyl-CoA carboxylase biotin carboxylase subunit, T303_03115; acetyl-CoA carboxylase subunit alpha, T303_03125), pyruvate metabolism (isopropylmalate synthase, T303_06880) and citrate cycle (isocitrate dehydrogenase, T303_07275). In glucose medium, there was no significant up/down regulation in other carbohydrate metabolism pathways...”
- Transcriptomic Insights Into the Growth Phase- and Sugar-Associated Changes in the Exopolysaccharide Production of a High EPS-Producing Streptococcus thermophilus ASCC 1275
Padmanabhan, Frontiers in microbiology 2018 - “...pathways (T303_00465, T303_04395, T303_04850, T303_05140, T303_06840, T303_07255, T303_07345, T303_08980, T303_09765) and pyruvate metabolism (T303_02435, T303_03105, T303_03115, T303_03120, T303_06180, T303_06185, T303_06190, T303_06195, T303_08485, T303_09120) were highly expressed at 5 h in M17-G but the expression of most of those genes were reduced or downregulated at 10 h....”
- “...trehalose metabolism (T303_00355, T303_00360, T303_00365) and acetyl CoA carboxylase biotin carrier protein and subunits (T303_03105 T303_03115, T303_03120, T303_03125) were significantly upregulated. FIGURE 7 Changes in expression of genes associated with nucleotide sugar synthesis and carbohydrate metabolism. (A) Heat map of DEGs involved in nucleotide sugar synthesis...”
Q1DDA2 Propionyl-CoA carboxylase, alpha subunit from Myxococcus xanthus (strain DK1622)
47% identity, 69% coverage
- Proteome Analyses of Soil Bacteria Grown in the Presence of Potato Suberin, a Recalcitrant Biopolymer
Sidibé, Microbes and environments 2016 - “...sufficient energy for bacterial proliferation. The presence of several carboxylases (Q1CYB4, Q1DDA0, Q1D0B9, Q1DOT9, Q1D555, Q1DDA2, and Q1D8V2) in the Myxococcus proteome also supports this hypothesis. Carboxylation represents a cellular biosynthetic mechanism to replenish tricarboxylic acid cycle intermediates used in biosynthetic pathways ( 9 ). In...”
- “...carboxylase carboxyl transferase 0.06 I Q1D234 acetyl-CoA acetyltransferase 0.05 I Q1CZK4 enoyl-[acyl-carrier-protein] reductase 0.07 E Q1DDA2 propionyl-CoA carboxylase 0.04 I Q1D343 3-oxoacyl-[acyl-carrier-protein] synthase 0.07 E Q1D964 acyl-CoA hydrolase 0.08 I Q1CYM5 medium-chain fatty acid-CoA ligase 0.03 I Q1D5Y4 3-hydroxybutyryl-CoA dehydratase 0.05 I Q1D8V2 acetyl-coenzyme A carboxylase...”
Ssal_01798 acetyl-CoA carboxylase biotin carboxylase subunit from Streptococcus salivarius 57.I
48% identity, 62% coverage
Q499_0133 acetyl-CoA carboxylase biotin carboxylase subunit from Chlamydia suis MD56
49% identity, 63% coverage
LA_2736 acetyl-CoA carboxylase biotin carboxylase subunit from Leptospira interrogans serovar lai str. 56601
51% identity, 61% coverage
CBU_1726 acetyl-CoA carboxylase, biotin carboxylase from Coxiella burnetii RSA 493
48% identity, 61% coverage
CDR20291_1861 biotin carboxylase (acetyl-CoA carboxylase subunit A) from Clostridium difficile R20291
CDR20291_1861 acetyl-CoA carboxylase biotin carboxylase subunit from Clostridioides difficile R20291
48% identity, 61% coverage
- Clostridioides difficile LuxS mediates inter-bacterial interactions within biofilms
Slater, Scientific reports 2019 - “...1.7011992 3-oxoacyl-ACP synthase III 4 CDR20291_1018 1.2469326 trans-2-enoyl-ACP reductase 5 CDR20291_1337 1.3290499 transcriptional regulator 6 CDR20291_1861 1.412304 biotin carboxylase acetyl-CoA carboxylase subunit A 7 CDR20291_2027 1.6309458 2-nitropropane dioxygenase 8 CDR20291_3225 1.0229025 formate/nitrite transporter 9 CDR20291_0363 1.377088 radical SAM protein 10 CDR20291_0364 1.003595 hypothetical protein 11 CDR20291_0365...”
HD0635 biotin carboxylase from Haemophilus ducreyi 35000HP
49% identity, 61% coverage
F6H9P9 Biotin carboxylase from Vitis vinifera
48% identity, 61% coverage
- Root Proteomic Analysis of Two Grapevine Rootstock Genotypes Showing Different Susceptibility to Salt Stress
Prinsi, International journal of molecular sciences 2020 - “...11, 21) 26.09 Lipid metabolism (11) 100 F6HXC8 Phospholipase D (11, 1, 27) 3.90 41 F6H9P9 Biotin carboxylase 1, chloroplastic (11) 2.57 70 F6HLJ7 Enoyl-[acyl-carrier-protein] reductase [NADH] 1, chloroplastic (11) 2.13 182 D7STF0 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (11) 3.22 211 D7T4I1 Biotin carboxyl carrier protein of acetyl-CoA...”
- “...reductase (11) 1.42 60 F6HLJ7 Enoyl-[acyl-carrier-protein] reductase [NADH] 1, chloroplastic isoform X1 (11) 1.68 65 F6H9P9 Biotin carboxylase 1, chloroplastic () 1.76 168 D7STF0 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (11) 1.94 203 D7T4I1 Biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic (11) 2.98 88 D7TAP7 3-oxoacyl-[acyl-carrier-protein] reductase...”
- Differential proteomic analysis of grapevine leaves by iTRAQ reveals responses to heat stress and subsequent recovery
Liu, BMC plant biology 2014 - “...1.095 6.3 Ricinus communis Malate dehydrogenase A5BEJ8 0.524 1.328 6.3 Vitis vinifera Malate dehydrogenase, putative F6H9P9 0.455 1.618 11.1.1 Camellia oleifera Biotin carboxylase, CAC2 G3G8J7 0.425 0.696 12.1.2 Vitis vinifera Nitrite reductase 1 D7SW04 0.744 0.519 13.1.1.2.1 Petunia x hybrida Prephenate aminotransferase A5ACX0 0.389 1.125 13.1.1.3.1...”
NGO0044 acetyl-CoA carboxylase, biotin carboxylase from Neisseria gonorrhoeae FA 1090
48% identity, 61% coverage
- Activation of Exogenous Fatty Acids to Acyl-Acyl Carrier Protein Cannot Bypass FabI Inhibition in Neisseria
Yao, The Journal of biological chemistry 2016 - “...carboxylase complex (accABCD, NGO0821, NGO0045, NGO0044, NGO0249), malonyl-CoA:ACP transacylase (fabD, NGO2166), 3-oxoacyl-ACP synthase III (fabH, NGO2168),...”
- Identification of a conserved protein involved in anaerobic unsaturated fatty acid synthesis in Neiserria gonorrhoeae: implications for facultative and obligate anaerobes that lack FabA
Isabella, Molecular microbiology 2011 - “...Carboxylase accA Carboxyl-transferase subunit NGO0821 accB Biotin carboxyl carrier protein (BCCP) NGO0045 accC Biotin carboxylase NGO0044 accD Carboxyl-transferase subunit NGO0249 Saturated Fatty Acid Synthesis acpP apo-ACP NGO1351 fabD Malonyl-CoA:ACP transacylase NGO2166 fabF 3-Ketoacyl-ACP synthase II NGO1763 fabG 3-Ketoacyl-ACP reductase NGO2163 fabH 3-Ketoacyl-ACP synthase III NGO2168 fabI...”
FTH_1537 acetyl-CoA carboxylase biotin carboxylase subunit from Francisella tularensis subsp. holarctica OSU18
FTL_1591 Acetyl-CoA carboxylase, biotin carboxylase subunit from Francisella tularensis subsp. holarctica
FTS_1551 acetyl-CoA carboxylase biotin carboxylase subunit from Francisella tularensis subsp. holarctica FSC200
50% identity, 61% coverage
- Use of magnetic hydrazide-modified polymer microspheres for enrichment of Francisella tularensis glycoproteins
Horák, Soft matter 2012 - “...cyt FTH_1503 Conserved hypothetical protein 69.85/10.14 CM TMH FTH_1536 Conserved hypothetical protein 25.35/6.96 ? cyt FTH_1537 Acetyl-CoA carboxylase biotin carboxylase subunit 50.05/6.85 cyt cyt FTH_1551 S49 family SohB endopeptidase 38.07/9.25 CM TMH FTH_1558 Glycosyltransferase, group 2 family protein 36.08/8.69 CM cyt FTH_1599 Conserved hypothetical protein 49.32/4.33...”
- Francisella tularensis: FupA mutation contributes to fluoroquinolone resistance by increasing vesicle secretion and biofilm formation
Siebert, Emerging microbes & infections 2019 - “...synthetase 20,082 0,00553302 2,07539867 1,730,31 FTL_0449 HTH-MerR Superfamily transcription regulator protein 10,91 0,00624757 3,4734326 0,960,46 FTL_1591 Acetyl-CoA carboxylase, biotin carboxylase subunit 73,596 0,00860376 2,01843356 2,380,85 FTL_1899 Glutamine synthetase 6.3.1.2 74,386 0,00862336 3,80186705 1,230,44 FTL_0738 Hypothetical lipoprotein 53,597 0,00923321 3,8760831 2,291,29 FTL_1832 lucA/IucC family siderophore biosynthesis protein...”
- “...proteins playing a role in replication (FTL_1025, FTL_1407, FTL_1842, FTL_1850, and FTL_1931), glycerolipid (FTL_1644), carbohydrate (FTL_1591 and FTL_1899), and cofactor and vitamin (FTL_1274) metabolism. Some of the differentially-expressed proteins identified may play a direct role in the antibiotic-resistance phenotype of the strain. They include membrane transport...”
- Further Characterization of the Capsule-Like Complex (CLC) Produced by Francisella tularensis Subspecies tularensis: Protective Efficacy and Similarity to Outer Membrane Vesicles
Champion, Frontiers in cellular and infection microbiology 2018 - “...Thioredoxin 1 78 12,194 6.60E-08 FTL_1743 T20,P, S,E DNA-directed RNA polymerase, subunit 77 157,289 6.20E-08 FTL_1591 S Acetyl-CoA carboxylase, biotin carboxylase subunit 76 50,019 7.50E-08 FTL_0097 N Hypothetical protein 76 13,785 6.10E-05 FTL_1780 N, C Triosephosphate isomerase 76 27,638 5.80E-08 FTL_0232 S 30S ribosomal protein S12...”
- Francisella tularensis subsp. holarctica Releases Differentially Loaded Outer Membrane Vesicles Under Various Stress Conditions
Klimentova, Frontiers in microbiology 2019 - “...ABC transporter ATP-binding protein (FTS_1893), isocitrate dehydrogenase (FTS_0587) and acetyl-CoA carboxylase, and biotin carboxylase subunit (FTS_1551). On the other hand, proteins from cluster no. 430, which was decreased in all conditions over control, included two FPI proteins (FTS_0099, IglC and FTS_0107, IglG) and a putative glycosyltransferase...”
F4JYE1 Biotin carboxylase from Arabidopsis thaliana
50% identity, 58% coverage
Q12EJ0 biotin carboxylase (EC 6.3.4.14) from Polaromonas sp. (see paper)
47% identity, 61% coverage
MBHS_02490 acetyl-CoA carboxylase biotin carboxylase subunit from Candidatus Venteria ishoeyi
49% identity, 61% coverage
Caur_3421 acetyl-CoA carboxylase, biotin carboxylase from Chloroflexus aurantiacus J-10-fl
WP_012259259 acetyl-CoA carboxylase biotin carboxylase subunit from Chloroflexus aurantiacus
48% identity, 61% coverage
- Complete genome sequence of the filamentous anoxygenic phototrophic bacterium Chloroflexus aurantiacus
Tang, BMC genomics 2011 - “...CO 2 -anaplerotic pathways tme (Caur_1614), pckA (Caur_2331), ppc (Caur_3161, Caur_3888) 3-hydroxypropionate cycle accC (Caur_1378, Caur_3421), accA (Caur_1647), accD (Caur_1648), accB (Caur_3739), mcr (Caur_2614), pcs (Caur_ 0613), pccB (Caur_2034, Caur_3435), mcee (Caur_3037), mut (Caur_1844, Caur_2508, Caur_2509), smtA (Caur_0179), smtB (Caur_0178), sdhBAC (Caur_1880 to Caur_1882), fh (Caur_1443),...”
- “...cycle were later characterized experimentally [ 4 ]: (1) acetyl-CoA carboxylase ( accC (Caur_1378 and Caur_3421, biotin carboxylase), accA (Caur_1647, -subunit), accD (Caur_1648, -subunit) and accB (Caur_3739) [ 79 ], (2) malonyl-CoA reductase ( mcr , Caur_2614) [ 80 ], (3) propionyl-CoA synthase ( pcs ,...”
- Chloroflexus aurantiacus acetyl-CoA carboxylase evolves fused biotin carboxylase and biotin carboxyl carrier protein to complete carboxylation activity
Shen, mBio 2024 - “...first BC isoform (WP_012257262, BC1) contains 596 amino acid residues, while the second BC isoform (WP_012259259, BC2) comprises 455 residues. During the transition from respiratory to phototrophic conditions, a simultaneous increase in the expression of C. aurantiacus BC1, CT, CT, and most enzymes involved in the...”
- “...C. aurantiacus BC1 and BC2. C. aurantiacus possesses two BC isoforms, BC1 (WP_012257262) and BC2 (WP_012259259). BC1 confers a fused BC (Met1-Glu452) and BCCP domain (Ala459-Lys596), which contains a hairpin (Thr473-Gly486) and a BCCP Core (Lys511-Gln587) at the C-terminus. Multiple sequence alignment revealed the presence of...”
SM12261_RS07530 acetyl-CoA carboxylase biotin carboxylase subunit from Streptococcus mitis NCTC 12261
47% identity, 62% coverage
O67449 Biotin carboxylase from Aquifex aeolicus (strain VF5)
aq_1470 biotin carboxylase from Aquifex aeolicus VF5
47% identity, 61% coverage
DDD_1224 acetyl-CoA carboxylase biotin carboxylase subunit from Nonlabens dokdonensis DSW-6
48% identity, 62% coverage
HSM_1606 acetyl-CoA carboxylase biotin carboxylase subunit from Haemophilus somnus 2336
49% identity, 61% coverage
SSU1599 biotin carboxylase subunit of acetyl-CoA carboxylase from Streptococcus suis P1/7
SSU05_1799 acetyl-CoA carboxylase biotin carboxylase subunit from Streptococcus suis 05ZYH33
48% identity, 62% coverage
- Precision Genome Engineering in Streptococcus suis Based on a Broad-Host-Range Vector and CRISPR-Cas9 Technology
Gussak, ACS synthetic biology 2023 - “...5.67 N/A repD 6.45 N/A tetA 5.71 lipid biosynthesis SSU1597 accA 5.42 SSU1598 accD 5.45 SSU1599 accC 5.81 SSU1600 fabZ 5.99 SSU1601 fabE 6.15 SSU1602 fabF 6.29 SSU1603 fabG 6.65 SSU1604 fabD 6.56 SSU1605 fabK 6.50 SSU1606 acpP 4.67 SSU1607 fabH 4.05 SSU1608 marR 3.78 SSU1609...”
- Proteomic and Metabolomic Analyses Provide Insights into the Mechanism on Arginine Metabolism Regulated by tRNA Modification Enzymes GidA and MnmE of Streptococcus suis
Gao, Frontiers in cellular and infection microbiology 2020 - “...6 19.46 AccD SSU05_1797 Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta 0.2778 8 31.25 AccC SSU05_1799 Biotin carboxylase 0.3785 10 28.88 FabZ SSU05_1800 3-hydroxyacyl-[acyl-carrier-protein] dehydratase 0.3905 2 17.14 AccB SSU05_1801 Biotin carboxyl carrier protein of acetyl-CoA carboxylase 0.4501 1 8.16 FabF SSU05_1802 3-oxoacyl-[acyl-carrier-protein] synthase 2 0.2011...”
- MnmE, a Central tRNA-Modifying GTPase, Is Essential for the Growth, Pathogenicity, and Arginine Metabolism of Streptococcus suis Serotype 2
Gao, Frontiers in cellular and infection microbiology 2019 - “...6 19.46 AccD SSU05_1797 Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta 0.2444 8 31.25 AccC SSU05_1799 Biotin carboxylase 0.3680 10 28.88 FabZ SSU05_1800 3-hydroxyacyl-[acyl-carrier-protein] dehydratase 0.3717 2 17.14 FabF SSU05_1802 3-oxoacyl-[acyl-carrier-protein] synthase 2 0.18734 8 26.52 FabG1 SSU05_1803 3-ketoacyl-ACP reductase 0.2132 13 80.33 FabD SSU05_1804 Malonyl...”
- “...acid biosynthesis pathway were significantly down-regulated ( Table S1 ), which included AccA (SSU05_1796), AccC (SSU05_1799), AccD (SSU05_1797), FabZ (SSU05_1800), FabF (SSU05_1802), and FabD (SSU05_1804). Notably, the expression levels of the proteins ArcA (SSU05_0624), ArcB (SSU05_0626), ArcC (SSU05_0627) in the arginine biosynthesis pathway were decreased in...”
CbuG_0107 biotin carboxylase from Coxiella burnetii CbuG_Q212
48% identity, 61% coverage
spr0385 Biotin carboxylase (a subunit of acetyl-CoA carboxylase (ACC) from Streptococcus pneumoniae R6
SPD_0388 acetyl-CoA carboxylase, biotin carboxylase from Streptococcus pneumoniae D39
47% identity, 62% coverage
- Phenotypic characterization of Streptococcus pneumoniae biofilm development
Allegrucci, Journal of bacteriology 2006 - “...gauA (spr1300) lysS (spr0626) glyS (spr1328) accC (spr0385) gpdA (spr1902) rpsA (spr0764) prfC (spr0396) rpsB (spr2020) tufA (spr1343) rplJ (spr1212) exoA...”
- Inactivation of Transcriptional Regulator FabT Influences Colony Phase Variation of Streptococcus pneumoniae
Zhang, mBio 2021 - “...Acetyl-CoA carboxylase biotin carboxyl carrier protein 1.79 0.000 SPD_0387 fabZ 3-Hydroxyacyl-ACP dehydratase FabZ 1.63 0.000 SPD_0388 accC Acetyl-CoA carboxylase biotin carboxylase subunit 2.00 0.000 SPD_0389 accD Acetyl-CoA carboxylase carboxyltransferase subunit beta 2.04 0.000 SPD_0390 accA Acetyl-CoA carboxylase carboxyl transferase subunit alpha 2.13 0.000 SPD_0391 briC Biofilm-regulating...”
- Cadmium stress dictates central carbon flux and alters membrane composition in Streptococcus pneumoniae
Neville, Communications biology 2020 - “...SPD_0386 accB Acetyl-CoA carboxylase, biotin carboxyl carrier protein 1.99 SPD_0387 fabZ 3-hydroxyacyl-[acyl-carrier-protein] dehydratase (EC:4.2.1.59) 1.92 SPD_0388 accC Acetyl-CoA carboxylase, biotin carboxylase (EC:6.4.1.2 6.3.4.14) 1.86 SPD_0389 accD Acetyl-CoA carboxylase carboxyl transferase subunit (EC:6.4.1.2 2.1.3.15) 1.79 SPD_0390 accA Acetyl-CoA carboxylase carboxyl transferase subunit (EC:6.4.1.2 2.1.3.15) 1.81 SPD_0684 bioY...”
- Pneumococcal galactose catabolism is controlled by multiple regulators acting on pyruvate formate lyase
Al-Bayati, Scientific reports 2017 - “...SPD_0385 3-oxoacyl-(acyl carrier protein) synthase 5.2 SPD_0386 Acetyl-CoA carboxylase 4.3 SPD_0387 (3R)-hydroxymyristoyl ACP dehydratase 4.6 SPD_0388 Acetyl-CoA carboxylase 6.3 SPD_0389 Acetyl-CoA carboxylase beta subunit 5.4 SPD_0390 Acetyl-CoA carboxylase alpha subunit 5.6 SPD_0407 Hypothetical protein 2 SPD_0420 Formate acetyltransferase 2.9 SPD_0471 Pseudo 2 SPD_0511 5,10-methylenetetrahydrofolate reductase 2.4...”
- The Small Molecule DAM Inhibitor, Pyrimidinedione, Disrupts Streptococcus pneumoniae Biofilm Growth In Vitro
Yadav, PloS one 2015 - “...(accB) acetyl-CoA carboxylase, biotin carboxyl carrier acetyl-CoA carboxylase activity fatty acid biosynthetic process -1.5 (0.001) SPD_0388 (accC) acetyl-CoA carboxylase, biotin carboxylase acetyl-CoA carboxylase activity/biotin carboxylase activity -1.9 (0.05) SPD_0389 (accD) acetyl-CoA carboxylase, carboxyl transferase, acetyl-CoA carboxylase activity/transferase activity fatty acid biosynthetic process -1.7 (0.05) SPD_0390 (accA)...”
OCAR_5979 acetyl-CoA carboxylase biotin carboxylase subunit from Oligotropha carboxidovorans OM5
49% identity, 62% coverage
C1DLJ7 biotin carboxylase (EC 6.3.4.14) from Azotobacter vinelandii (see paper)
48% identity, 61% coverage
NMA0596 putative acetyl-CoA carboxylase biotin carboxylase component from Neisseria meningitidis Z2491
48% identity, 61% coverage
SPCG_RS02200 acetyl-CoA carboxylase biotin carboxylase subunit from Streptococcus pneumoniae CGSP14
SP_0425 acetyl-CoA carboxylase biotin carboxylase subunit from Streptococcus pneumoniae TIGR4
47% identity, 62% coverage
- The transcriptomic response of Streptococcus pneumoniae following exposure to cigarette smoke extract
Manna, Scientific reports 2018 - “...subunit alpha AccA 3.64 0.003 SPCG_RS02205 Acetyl-CoA carboxylase carboxyl transferase subunit beta AccD 3.59 0.003 SPCG_RS02200 Acetyl-CoA carboxylase biotin carboxylase subunit AccC 3.34 0.004 SPCG_RS02190 Acetyl-CoA carboxylase biotin carboxyl carrier protein subunit AccB 3.32 0.004 SPCG_RS02195 3-hydroxyacyl-ACP dehydratase FabZ 3.18 0.005 SPCG_RS02185 3-oxoacyl-ACP synthase FabF 3.11...”
- Multi-omic profiling to assess the effect of iron starvation in Streptococcus pneumoniae TIGR4
Jiménez-Munguía, PeerJ 2018 - “...SP_0413 2/2 Downregulated 38547 SP_0416, SP_0417 2/2 Downregulated 38548 SP_0419, SP_0420, SP_0421, SP_0422, SP_0423, SP_0424, SP_0425, SP_0426, SP_0427, SP_0428, SP_0429, SP_0430, SP_0431 13/13 Downregulated 38571 SP_0526, SP_0527 2/3 Downregulated 38610 SP_0701, SP_0702 2/2 Downregulated 38617 SP_0737, SP_0738 2/2 Downregulated 38620 SP_0750, SP_0751, SP_0752, SP_0753 4/4 Downregulated...”
PM1091 AccC from Pasteurella multocida subsp. multocida str. Pm70
49% identity, 61% coverage
- Isolation and sequencing of a temperate transducing phage for Pasteurella multocida
Campoy, Applied and environmental microbiology 2006 - “...this work. Strain Relevant features Source PM108 PM403 PM1090 PM1091 PM1092 PM1093 Wild type and lysogenic for F108 Wild type and F108 sensitive Like PM403, but...”
- “...b Multiplicity of infection Transduction frequency b, c PM1091 PM1092 PM1093 PM403 PM403 PM403 rpsL rpoB gyrA 1543395 to 1543769 1960620 to 1956592 991251...”
NTHI1145 acetyl-CoA carboxylase biotin carboxylase subunit from Haemophilus influenzae 86-028NP
49% identity, 61% coverage
NMB1861 acetyl-CoA carboxylase, biotin carboxylase from Neisseria meningitidis MC58
48% identity, 61% coverage
P43873 biotin carboxylase (EC 6.3.4.14) from Haemophilus influenzae (see paper)
HI0972 acetyl-CoA carboxylase, biotin carboxylase (accC) from Haemophilus influenzae Rd KW20
49% identity, 61% coverage
Q93Y50 Biotin carboxylase from Brassica napus
48% identity, 61% coverage
AF_0220 acetyl-CoA carboxylase biotin carboxylase subunit from Archaeoglobus fulgidus DSM 4304
49% identity, 61% coverage
- A novel methoxydotrophic metabolism discovered in the hyperthermophilic archaeon Archaeoglobus fulgidus
Welte, Environmental microbiology 2021 - “...AF_0808), Llactate dehydrogenase LldD (AF_0807) and LldEFG (AF_0809AF_0811), lactate permease lctP (AF_0806), pyruvate carboxylase PycA (AF_0220) and oxaloacetate decarboxylase Oad (AF_1252), malate dehydrogenase MdhA (AF_0855) and malate oxidoreductase Mae (AF_1727), fumarate hydratase Fum1/2 (AF_1098/9), succinate dehydrogenase SdhAD (AF_06814), succinylCoA synthetase SucCD (AF_1539/40 & AF_2185/6), 2oxoglutarate/2oxoacid ferredoxin...”
6ojhA / P43873 Crystal structure of haemophilus influenzae biotin carboxylase complexed with (r)-7-(3-aminopyrrolidin-1-yl)-6-(naphthalen-1-yl) pyrido[2,3-d]pyrimidin-2-amine
49% identity, 61% coverage
- Ligands: 7-[(3r)-3-aminopyrrolidin-1-yl]-6-(naphthalen-1-yl)pyrido[2,3-d]pyrimidin-2-amine; calcium ion (6ojhA)
CT124 Biotin Carboxylase from Chlamydia trachomatis D/UW-3/CX
49% identity, 62% coverage
- Remodeling of host phosphatidylcholine by Chlamydia acyltransferase is regulated by acyl-CoA binding protein ACBD6 associated with lipid droplets
Soupene, MicrobiologyOpen 2015 - “...and the common extender molecule, malonyl-CoA, is produced by AccA, AccB, AccC, and AccD (CT123, CT124, CT265, CT293). The condensation/elongation reaction is also common to both pathways and is performed by FabH (CT239) and FabF (CT770). No fatty acid activating enzyme, long-chain acyl-CoA synthetase (FadD), is...”
- Chlamydia trachomatis infection induces replication of latent HHV-6
Prusty, PloS one 2013 - “...Blood virus load/10 3 cells 1 CT100 <32 ND ND ND (<5) 275809.309 7.99 2 CT124 128 ND ND ND (<5) 17020.3654 21.94766605 3 CT127 <32+/ ND ND ND (<5) 28133.5987 6.04619509 4 CT129 128 ND ND ND (<5) 20731.6709 6.483198133 5 CT133 64 80 ND...”
PP0558, PP_0558 acetyl-CoA carboxylase, biotin carboxylase from Pseudomonas putida KT2440
47% identity, 61% coverage
H16_A0184 acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha from Cupriavidus necator H16
H16_A0184 biotin carboxylase from Ralstonia eutropha H16
39% identity, 92% coverage
Rru_A1941 acyl-CoA carboxylase alpha chain from Rhodospirillum rubrum ATCC 11170
40% identity, 92% coverage
SPy1745 putative acetyl-CoA carboxylase biotin carboxylase subunit from Streptococcus pyogenes M1 GAS
48% identity, 62% coverage
AS87_RS06995 acetyl-CoA carboxylase biotin carboxylase subunit from Riemerella anatipestifer Yb2
48% identity, 61% coverage
CAETHG_1594 pyruvate carboxylase from Clostridium autoethanogenum DSM 10061
42% identity, 44% coverage
- Clostridium autoethanogenum alters cofactor synthesis, redox metabolism, and lysine-acetylation in response to elevated H2:CO feedstock ratios for enhancing carbon capture efficiency
Davin, Biotechnology for biofuels and bioproducts 2024 - “...key proteins, the biotin-carrier component of acetyl-CoA carboxylase complex (ACC, CAETHG_0127) and pyruvate carboxylase (PYC, CAETHG_1594), are regulated post-translationally by BirA biotinylation in the related bacterium, C. ljungdahlii [ 26 ]. This report prompted an examination of biotinylation in C. autoethanogenum . The search for biotinylation...”
- Comparison of single-molecule sequencing and hybrid approaches for finishing the genome of Clostridium autoethanogenum and analysis of CRISPR systems in industrial relevant Clostridia
Brown, Biotechnology for biofuels 2014 - “...dikinase (PPDK) CAETHG_2055, 2909, P 3 Pyruvate kinase (Pk) CAETHG_2440-41, P 4 Pyruvate carboxylase (Pyc) CAETHG_1594, P 5 PEP carboxykinase (PEPCK) CAETHG_2721, P 5 Malic enzyme CAETHG_0605, 1055. Incomplete TCA cycle. T 1 Citrate synthase CAETHG _2751, T 2 Citrate lyase CAETHG_1052-54, 18981901, 2480-83, T 3...”
Q8DSN9 Biotin carboxylase from Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
SMU_RS07890 acetyl-CoA carboxylase biotin carboxylase subunit from Streptococcus mutans UA159
50% identity, 62% coverage
- S-glutathionylation proteome profiling reveals a crucial role of a thioredoxin-like protein in interspecies competition and cariogenecity of Streptococcus mutans
Li, PLoS pathogens 2020 - “...[glutamine-hydrolyzing] Q8DRY2 nrdD 625 Putative anaerobic ribonucleoside-triphosphate reductase P26283 Pyruvate metabolism ldh 74 L-lactate dehydrogenase Q8DSN9 accC 95, 338 Putative acetyl-CoA carboxylase biotin carboxylase subunit Q8DTF8 pckA 236, 324 Phosphoenolpyruvate carboxykinase Q59939 Carbon metabolism citZ 13 Citrate synthase P72484 tpiA 127, 128, 188 Triosephosphate isomerase Q8DVV3...”
- Mass spectrometry and split luciferase complementation assays reveal the MecA protein interactome of Streptococcus mutans
Qin, Microbiology spectrum 2024 - “...5.5 Cysteine desulfurase Fatty acid biosynthesis SMU_RS07880 2.8 Acetyl-CoA carboxylase carboxyl transferase subunit alpha, AccA SMU_RS07890 2.6 Acetyl-CoA carboxylase biotin carboxylase subunit, AccC SMU_RS07910 2.5 3-oxoacyl-[acyl-carrier-protein] reductase, FabG SMU_RS07905 2.2 Beta-ketoacyl-ACP synthase II, FabF SMU_RS07915 2 2 ACP S-malonyltransferase, FabD Lipid metabolism SMU_RS01590 2.8 NAD(P)H-dependent glycerol-3-phosphate...”
I3LT90 Methylcrotonyl-CoA carboxylase subunit 1 from Sus scrofa
36% identity, 92% coverage
- Proteomic Profiling Reveals Specific Molecular Hallmarks of the Pig Claustrum
Pirone, Molecular neurobiology 2023 - “...0.02 1.9 665 F1RRS3 Vesicle-fusing ATPase NSF 10 7 7 83,500 6.52 0.004 2.3 665 I3LT90 Methylcrotonyl-CoA carboxylase 1 MCCC1 3 2 2 80,400 6.34 0.004 2.3 673 F1RRS3 Vesicle-fusing ATPase NSF 16 12 12 85,585 6.52 0.011 2 681 I3LJE2 Dihydropyrimidinase like 2 DPYSL2 20...”
- “...0.013 0.588 665 F1RRS3 Vesicle-fusing ATPase NSF 10 7 7 83,500 6.52 0.005 2.1 665 I3LT90 Methylcrotonyl-CoA carboxylase 1 MCCC1 3 2 2 80,400 6.34 0.005 2.1 918 F1RXD5 Copine 3 CPNE3 9 5 5 59,644 5.57 0.03 1.5 959 I3L7D3 Synapsin II SYN2 31 18...”
- An Aberrant Phosphorylation of Amyloid Precursor Protein Tyrosine Regulates Its Trafficking and the Binding to the Clathrin Endocytic Complex in Neural Stem Cells of Alzheimer's Disease Patients
Poulsen, Frontiers in molecular neuroscience 2017 - “...4,371 3,191 1,643 274 F1SGG2 Keratin 8 * 54.427 6,176 6,286 2,860 2,597 2,074 791 I3LT90 methylcrotonoyl-CoA carboxylase 1 * 80.418 2,080 909 1,427 1,133 623 478 3,089 498 3,330 481 863 498 I3LAH3 Numb-like protein * 64.815 563 240 1,876 882 551 123 2,944 507...”
PFLCHA0_RS03400 acetyl-CoA carboxylase biotin carboxylase subunit from Pseudomonas protegens CHA0
47% identity, 62% coverage
- Experimental-Evolution-Driven Identification of Arabidopsis Rhizosphere Competence Genes in Pseudomonas protegens
Li, mBio 2021 - “...intergenic mutations Nonsynonymous Synonymous Deletions PFLCHA0_RS02080 hutI Imidazolonepropionase F 4 1 0 1 0 0 PFLCHA0_RS03400 accC Biotin carboxylase, acetyl-CoA carboxylase subunit I 2 1 1 0 0 0 PFLCHA0_RS05510 nudL Coenzyme A pyrophosphatase/nudix hydrolase NudL L 4 1 0 1 0 0 PFLCHA0_RS06125 rpoS RNA...”
- “...galE c.94G>A p.Val32Met V32M 2/6 5/6 6/6 2 PFLCHA0_RS30120 tssM c.1336C>T p.Leu446Leu 1336C>T 1/6 2 PFLCHA0_RS03400 accC c.1237G>A p.Glu413Lys E413K 4/6 6/6 2 PFLCHA0_RS13000 yvaQ2 c.-9G>T NA -9G>T 1/6 2 PFLCHA0_RS17965 gacA c.160G>T p.As54Tyr D54Y 2/6 5.5% 4.5% 15.5% x 2 PFLCHA0_RS17965 gacA c.289G>A p.Gly97Ser G97S...”
B739_0889 acetyl-CoA carboxylase biotin carboxylase subunit from Riemerella anatipestifer RA-CH-1
48% identity, 61% coverage
- Investigation of TbfA in Riemerella anatipestifer using plasmid-based methods for gene over-expression and knockdown
Liu, Scientific reports 2016 - “...promoters of the genes B739_0921 (rpkm:27503, high transcriptional activity), B739_0973 (rpkm:2236, medium transcriptional activity) and B739_0889 (rpkm:993, low transcriptional activity) from RA-CH-1 and used them to replace the ermF promoter in plasmid pLMF01, giving the plasmids pLMF03, pLMF04 and pLMF05, respectively ( Fig. S1 ). To...”
- “...pLMF04, which contained the P B739_0973 promoter region. For plasmid pLMF05, which contained the P B739_0889 promoter region, there was lower expression than with plasmids pLMF04 and pLMF03 ( Fig. S3 ). To further ensure the plasmids can be used for complementation, we also used R....”
H16_A2142 Acetyl-CoA carboxylase alpha chain from Ralstonia eutropha H16
H16_A2142 acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha from Cupriavidus necator H16
48% identity, 61% coverage
CAB540 biotin carboxylase from Chlamydophila abortus S26/3
48% identity, 62% coverage
Lreu_0984 acetyl-CoA carboxylase biotin carboxylase subunit from Limosilactobacillus reuteri subsp. reuteri
Lreu_0984 acetyl-CoA carboxylase, biotin carboxylase from Lactobacillus reuteri DSM 20016
46% identity, 63% coverage
plu4075 biotin carboxylase (A subunit of acetyl-CoA carboxylase) (ACC) from Photorhabdus luminescens subsp. laumondii TTO1
48% identity, 61% coverage
MAB_4539c Putative acyl-CoA carboxylase alpha subunit AccA from Mycobacterium abscessus ATCC 19977
38% identity, 92% coverage
PCCA_HALMT / I3R7G3 Propionyl-CoA carboxylase, biotin carboxylase and biotin-carboxyl carrier subunit; PCC; EC 6.4.1.3; EC 6.3.4.14 from Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) (Halobacterium mediterranei) (see paper)
I3R7G3 propionyl-CoA carboxylase (subunit 3/3) (EC 6.4.1.3) from Haloferax mediterranei (see paper)
36% identity, 92% coverage
- function: This is one of the subunits of the biotin-dependent propionyl-CoA carboxylase (PCC), the enzyme catalyzing the carboxylation of propionyl-CoA/propanoyl-CoA to D-methylmalonyl- CoA/(S)-methylmalonyl-CoA. Within the holoenzyme, the alpha subunit catalyzes the ATP-dependent carboxylation of the biotin carried by the biotin carboxyl carrier (BCC) domain, while the beta subunit then transfers the carboxyl group from carboxylated biotin to propionyl-CoA (By similarity). Propionyl-CoA carboxylase is involved in propionate utilization and in the production of the poly(3-hydroxybutyrate-co-3- hydroxyvalerate)(PHBV), which is a water-insoluble biopolymer used as intracellular energy reserve material when cells grow under conditions of nutrient limitation (PubMed:25398867). Propionyl-CoA carboxylase is also able to catalyze the carboxylation of acetyl-CoA (PubMed:25398867).
catalytic activity: propanoyl-CoA + hydrogencarbonate + ATP = (S)-methylmalonyl- CoA + ADP + phosphate + H(+) (RHEA:23720)
catalytic activity: N(6)-biotinyl-L-lysyl-[protein] + hydrogencarbonate + ATP = N(6)-carboxybiotinyl-L-lysyl-[protein] + ADP + phosphate + H(+) (RHEA:13501)
cofactor: Mg(2+) Mn(2+) (Binds 2 magnesium or manganese ions per subunit.)
cofactor: biotin
subunit: The propionyl coenzyme A carboxylase (PCC) complex is composed of three subunits: PccA (biotin carboxylase and biotin-carboxyl carrier), PccB (carboxyltransferase) and PccX.
llmg_1779 acetyl-CoA carboxylase biotin carboxylase subunit from Lactococcus lactis subsp. cremoris MG1363
49% identity, 62% coverage
- Mechanisms of Acetoin Toxicity and Adaptive Responses in an Acetoin-Producing Species, Lactococcus lactis
Cesselin, Applied and environmental microbiology 2021 - “...a Expression change in acetoin Glycolysis llmg_2539 GapB glyceraldehyde 3-phosphate dehydrogenase Down Fatty acid biosynthesis llmg_1779 AccC subunit biotin carboxylase Down llmg_1783 FabF 3-oxoacyl-acyl carrier protein synthase II Down llmg_0538 FabZ (a) 3-hydroxy-acyl-[acyl-carrier-protein] dehydratase Down Cell wall llmg_0209 RmlB, dTDP-glucose-1-phosphate dehydratase Down llmg_0210 RmlD, dTDP-4-dehydrorhamnose reductase...”
SAK_0426 acetyl-CoA carboxylase, biotin carboxylase from Streptococcus agalactiae A909
48% identity, 63% coverage
CLJU_c37390 pyruvate carboxylase from Clostridium ljungdahlii DSM 13528
42% identity, 44% coverage
- Pleiotropic Regulator GssR Positively Regulates Autotrophic Growth of Gas-Fermenting Clostridium ljungdahlii
Zhang, Microorganisms 2023 - “...1 , No. 615) to examine phenotypic outcomes. Among these candidates, only the overexpression of CLJU_c37390 significantly affected the autotrophic growth of C. ljungdahlii ( Figure 4 A), while the others had no influence on cell growth ( Supplementary Figure S2 ). According to the genome...”
- “...38 ]. Based on this finding, we further examined the interaction between GssR and the CLJU_c37390 gene using EMSA. Specifically, a 305 bp DNA fragment covering the promoter region of the CLJU_c37390 gene was used as the DNA probe. As shown in Figure 4 B, GssR...”
- Functional dissection and modulation of the BirA protein for improved autotrophic growth of gas-fermenting Clostridium ljungdahlii
Zhang, Microbial biotechnology 2021 - “...Nterminal DNAbinding domain of Cl BirA) (Fig. 8A ); simultaneously, the acc (Clju_c4210042140) and pyc (Clju_c37390) genes, coding for the C. ljungdahlii ACC and PYC enzymes, respectively, were also overexpressed separately (Fig. 8A ). Such an engineering strategy was expected to specifically block the regulatory function,...”
- Clostridium ljungdahlii represents a microbial production platform based on syngas
Köpke, Proceedings of the National Academy of Sciences of the United States of America 2010 - “...and C4 compounds: pyruvate carboxylase (encoded by CLJU_c37390) and PEP-carboxykinase (encoded by CLJU_06210). C. ljungdahlii operates a branched TCA "cycle,"...”
AccC / b3256 biotin carboxylase (EC 6.3.4.14) from Escherichia coli K-12 substr. MG1655 (see 6 papers)
accC / P24182 biotin carboxylase (EC 6.3.4.14) from Escherichia coli (strain K12) (see 2 papers)
ACCC_ECOLI / P24182 Biotin carboxylase; Acetyl-coenzyme A carboxylase biotin carboxylase subunit A; EC 6.3.4.14 from Escherichia coli (strain K12) (see 3 papers)
P24182 biotin carboxylase (EC 6.3.4.14) from Escherichia coli (see 7 papers)
fabE / AAA23409.1 biotin carboxylase from Escherichia coli (see 4 papers)
ECOLIN_RS18665 acetyl-CoA carboxylase biotin carboxylase subunit from Escherichia coli Nissle 1917
NP_417722 biotin carboxylase from Escherichia coli str. K-12 substr. MG1655
b3256 acetyl-CoA carboxylase from Escherichia coli str. K-12 substr. MG1655
49% identity, 61% coverage
- function: This protein is a component of the acetyl coenzyme A carboxylase complex; first, biotin carboxylase catalyzes the carboxylation of the carrier protein and then the transcarboxylase transfers the carboxyl group to form malonyl-CoA.
catalytic activity: N(6)-biotinyl-L-lysyl-[protein] + hydrogencarbonate + ATP = N(6)-carboxybiotinyl-L-lysyl-[protein] + ADP + phosphate + H(+) (RHEA:13501)
cofactor: Mg(2+) Mn(2+) (Binds 2 magnesium or manganese ions per subunit.)
subunit: Acetyl-CoA carboxylase is a heterohexamer of biotin carboxyl carrier protein, biotin carboxylase and the two subunits of carboxyl transferase in a 2:2 complex. - Identification of a gene cluster for D-tagatose utilization in Escherichia coli B2 phylogroup
Ha, iScience 2022 - “...D-tagatose catabolism. The candidate region was completely absent in K-12 and was located between accC (ECOLIN_RS18665) encoding biotin carboxylase and yhdT (ECOLIN_RS18710) encoding a conserved inner membrane protein ( Figure2 A). Figure2 Gene cluster for D-tagatose degradation in E.coli Nissle 1917 (EcN) (A) Genetic organization of...”
- Cyclophilin PpiB is involved in motility and biofilm formation via its functional association with certain proteins.
Skagia, Genes to cells : devoted to molecular & cellular mechanisms 2016 (PubMed)- GeneRIF: For DnaK, acetyl-CoA carboxylase, biotin carboxylase subunit (AccC) and phosphate acetyltransferase (Pta) we also showed a direct role of PpiB in the functional control of these proteins because it increased the measured enzyme activity of each protein and further interfered with DnaK localization and the correct folding of AccC.
- Evidence against translational repression by the carboxyltransferase component of Escherichia coli acetyl coenzyme A carboxylase.
Smith, Journal of bacteriology 2014 - GeneRIF: This study reports that increased levels of carboxyltransferase (CT) tetramer have no detectable effect on translation of the CT subunit mRNAs.
- Dimerization of the bacterial biotin carboxylase subunit is required for acetyl coenzyme A carboxylase activity in vivo.
Smith, Journal of bacteriology 2012 - GeneRIF: It was concluded that biotin carboxylase must be dimeric to fulfill its physiological function.
- Crystal structure of biotin carboxylase in complex with substrates and implications for its catalytic mechanism.
Chou, The Journal of biological chemistry 2009 - GeneRIF: analysis of biotin carboxylase in complex with substrates and implications for its catalytic mechanism
- Coordinate expression of the acetyl coenzyme A carboxylase genes, accB and accC, is necessary for normal regulation of biotin synthesis in Escherichia coli.
Abdel-Hamid, Journal of bacteriology 2007 - GeneRIF: Results show that under AccC overexpression conditions AccB is underbiotinylated.
- The gene encoding the biotin carboxylase subunit of Escherichia coli acetyl-CoA carboxylase.
Li, The Journal of biological chemistry 1992 (PubMed)- GeneRIF: N-terminus verified by Edman degradation on complete protein
- Structural assembly of the bacterial essential interactome
Gómez, eLife 2024 - “...structures are AlphaFold2 (AF2) models. Uniprot codes used for AF2: AccA: P0ABD5, AccB: P0ABD8, AccC: P24182, AccD: P0A9Q5, and birA: P06709. Figure 3figure supplement 1. Predicted interfaces of FabG 2 -AcpP 2 ( a ) and FabI 2 -AcpP 2 ( b ). The experimentally solved...”
- Toward Single Bacterium Proteomics
Végvári, Journal of the American Society for Mass Spectrometry 2023 - “...tufB P0CE48 [239249] [K].VGEEVEIVGIK.[E] 1629.98 544.00 +3 75.80 15 203.77 75.00% 11 biotin carboxylase accC P24182 [315324] [R].IAAGQPLSIK.[Q] 1456.91 728.96 +2 71.29 2 147.8 12.50% 120 probable cyclic di-GMP phosphodiesterase PdeC pdeC P32701 [3643] [K].SEVNNQLR.[T] 1189.64 595.33 +2 41.77 4 177.29 25.00% succinylornithine transaminase astC P77581...”
- “...atpA P0ABB0 [165175] [R].ELIIGDRQTGK.[T] 1229.68 615.35 +2 30.30 1 228.28 0.00% 33 biotin carboxylase accC P24182 [315324] [R].IAAGQPLSIK.[Q] 998.59 499.80 +2 49.58 1 181.48 0.00% 120 chaperone protein DnaK dnaK P0A6Y8 [167183] [K].RIINEPTAAALAYGLDK.[G] 1816.00 606.01 +3 64.08 1 285.59 0.00% 15 chromomal replication initiator protein DnaA...”
- Comprehensively Characterizing the Thioredoxin Interactome In Vivo Highlights the Central Role Played by This Ubiquitous Oxidoreductase in Redox Control
Arts, Molecular & cellular proteomics : MCP 2016 - “...P0A7A9 P0AC38 P0ABK5 P0A9C5 P0A825 P0A6B7 P0A817 P0A853 P24182 P0A6Q3 P0A953 P0AAI9 P0A6R0 P0A6Q6 P0ABF6 P76440 P0A717 P0A7D4 P07650 P0AEZ9 P0ACD4 Description...”
- A curated C. difficile strain 630 metabolic network: prediction of essential targets and inhibitors.
Larocque, BMC systems biology 2014 - “...sequence identity Target (pair) a Sequence identity b DrugBank potential inhibitors c E.coli Human accC P24182 [53%] Q96RQ3 [48%] LZJ, LZK, LZL, OA1, OA2, OA3, OA4, OA5, L21, L22, L23 (P24182 [53%]); BTI (Q99UY8 [48%]); BTN (P11498 [45%]); D1L, H1L (O00763 [32%]) adk P69441 [52%] P54819-2...”
- “...PLP , THL (P34897 [41%]); Mimosine (Pr4896 [40%]) CD0727 (folD | fhs | fchA) d P24182 [53%] Q96RQ3 [48%] CNC , THL , I2A (Q99707 [31%]) scoB (folD | fhs | fchA) d E9YQ86 [56%] B7Z609 [51%] SIN , EMT (P55809 [52%]) scoA (folD | fhs...”
- The Escherichia coli proteome: past, present, and future prospects
Han, Microbiology and molecular biology reviews : MMBR 2006 - “...of acetyl-CoA carboxylase 4.66/16,687.21 AccC AccD P24182 P0A9Q5 6.65/49,320.74 7.58/33,321.89 AceA P0A9G6 Biotin carboxylase Acetyl-CoA carboxylase carboxyl...”
- Tracing the phylogenetic history of the Crl regulon through the Bacteria and Archaea genomes
Santos-Zavaleta, BMC genomics 2019 - “...[ 11 ] lipid metabolic process, fatty acid metabolic process, fatty acid biosynthetic process accC b3256 accBC AccB (), FadR(+) + GEA and IMP [ 11 ] lipid metabolic process, fatty acid metabolic process, fatty acid biosynthetic process, metabolic process, negative regulation of fatty acid biosynthetic...”
- Genome-scale analysis to the impact of gene deletion on the metabolism of E. coli: constraint-based simulation approach
Xu, BMC bioinformatics 2009 - “...b2316 b2312, b2476 b4013 b3957 b4160 b2323 b2499, b2507 s0001 b3958 b3255 b2557, b2780 b3959 b3256 b3642, b4005 b3960 b4006, b4177 s0001 b4244, b4245 SS NSP CAC GSM TTPM TIM genes b0639 b0720 b0907 b0908, b1260 b0914 b1098 b1136 b1261, b1262 s0001 b2827 b1263, b1264 b3648...”
- Analysis of promoter targets for Escherichia coli transcription elongation factor GreA in vivo and in vitro
Stepanova, Journal of bacteriology 2007 - “...ribosomal subunit protein L13 accB b3255 1.9 accC b3256 1.8 Acetyl-CoA carboxylase, BCCP (biotin carboxyl carrier protein) subunit; carrier of biotin Acetyl-CoA...”
- Combined, functional genomic-biochemical approach to intermediary metabolism: interaction of acivicin, a glutamine amidotransferase inhibitor, with Escherichia coli K-12
Smulski, Journal of bacteriology 2001 - “...exbD fecA fecI fecR fepB fhuE fimA fis fixX flgD b3256 b4015 b4016 b1623 b0111 b0050 b0564 b0469 b0908 b2601 b1704 b3433 b0930 b1597 b3734 b3731 b3732 b3736...”
ECA0260 acetyl-CoA carboxylase biotin carboxylase subunit from Pectobacterium atrosepticum SCRI1043
48% identity, 61% coverage
- Global Gene Expression Analysis of Cross-Protected Phenotype of Pectobacterium atrosepticum
Gorshkov, PloS one 2017 - “...ECA1166, ECA1540, ECA2013, ECA2873, ECA2226; down-regulatedECA3054, ECA3682, ECA4006, ECA4513, ECA1141, ECA1232, ECA4461, ECA1407, ECA2651, ECA4079, ECA0260, ECA0255, ECA0238, ECA3343, ECA3814. Total RNA was extracted from Pba cells and digested with DNAze as described above and used for cDNA synthesis. The reaction mixture for reverse transcription contained...”
c4012 acetyl-CoA carboxylase biotin carboxylase subunit from Escherichia coli CFT073
49% identity, 61% coverage
STM3380 acetyl CoA carboxylase, biotin carboxylase subunit from Salmonella typhimurium LT2
49% identity, 61% coverage
ECs4128 acetyl CoA carboxylase biotin carboxylase subunit from Escherichia coli O157:H7 str. Sakai
48% identity, 61% coverage
1dv2A / P24182 The structure of biotin carboxylase, mutant e288k, complexed with atp (see paper)
48% identity, 61% coverage
- Ligand: adenosine-5'-triphosphate (1dv2A)
Cs308_0800 acetyl-CoA carboxylase biotin carboxylase subunit from Candidatus Chlamydia sanziniae
47% identity, 62% coverage
Q1D0T9 Acetyl-CoA carboxylase, biotin carboxylase from Myxococcus xanthus (strain DK1622)
49% identity, 61% coverage
Z4616 acetyl CoA carboxylase, biotin carboxylase subunit from Escherichia coli O157:H7 EDL933
48% identity, 61% coverage
WP_202320510 acetyl-CoA carboxylase biotin carboxylase subunit from Archaeoglobus neptunius
49% identity, 61% coverage
lpg2664 acetyl-CoA carboxylase, biotin carboxylase subunit from Legionella pneumophila subsp. pneumophila str. Philadelphia 1
48% identity, 62% coverage
- New Global Insights on the Regulation of the Biphasic Life Cycle and Virulence Via ClpP-Dependent Proteolysis in Legionella pneumophila
Ge, Molecular & cellular proteomics : MCP 2022 - “..., ClpA, GrpE, DnaJ, ClpB, ClpS), and microbial metabolism in diverse environments ( e.g. , Lpg2664, Lpg0245, AcsB, AtoB) ( supplemental Fig.S4 C ). In addition, the downregulated proteins in the RP of the clpP strain were found to interact with ribosomal proteins ( e.g. ,...”
- “...network analysis showed that the key proteins involved in the TP to RP transition, including Lpg2664, AcsB, MmsA, AtoB, FliA, FliS, FlhF, Frr, Lpg0358, and Lpg2228, presented decreased abundance, whereas Lpg0102, Lpg0361, Lpg0362, FabZ, RpmA, RplS, RpsP, RpsH, Lpg0394, and FtsQ increased in abundance ( supplemental...”
8hz4A / A9W9X0 The tetrameric structure of biotin carboxylase from chloroflexus aurantiacus in complex with bicarbonate (see paper)
47% identity, 61% coverage
- Ligands: peptide; bicarbonate ion (8hz4A)
ACIAD1736 biotin carboxylase (A subunit of acetyl-CoA carboxylase) from Acinetobacter sp. ADP1
46% identity, 61% coverage
CD0021 pyruvate carboxylase from Clostridium difficile 630
44% identity, 40% coverage
SPO2789 acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha from Ruegeria pomeroyi DSS-3
49% identity, 61% coverage
- Diel investments in metabolite production and consumption in a model microbial system
Uchimiya, The ISME journal 2022 - “...Glycine-betaine transporter 1.6 (n.s.) [ 25 ] Amino Acid Leucine SPO2793 ivD isovaleryl-CoA dehydrogenase 2.6 SPO2789 mccA methylcrotonyl-CoA carboxylase, alpha subunit 3.1 SPO2790 mccB methylcrotonyl-CoA carboxylase, beta subunit 3.4 SPO0390 glutamate/leucine/phenylalanine/valine dehydrogenase 1.2 (n.s.) Amino acid derivative Ectoine/ 5-hydroxyectoine SPO1146 uehB TRAP transporter, small integral membrane...”
LSA0820 Acetyl-CoA carboxylase (biotin carbooxylase subunit) from Lactobacillus sakei subsp. sakei 23K
46% identity, 62% coverage
- Global transcriptome response in Lactobacillus sakei during growth on ribose
McLeod, BMC microbiology 2011 - “...LSA0817 fabF 3-oxoacyl-[acyl carrier protein] synthetase II -0.7 LSA0819 fabZ (3R)-hydroxymyristoyl-[acyl carrier proetin] dehydratase 0.7 LSA0820 accC Acetyl-CoA carboxylase (biotin carbooxylase subunit) -0.7 LSA0821 accD Acetyl-CoA carboxylase (carboxyl transferase beta subunit) 0.8 LSA0822 accA Acetyl-CoA carboxylase (carboxyl transferase alpha subunit) 0.6 LSA0823 fabI Enoyl [acyl carrier...”
B0MI45 Biotin carboxylase from Anaerostipes caccae (strain DSM 14662 / CCUG 47493 / JCM 13470 / NCIMB 13811 / L1-92)
48% identity, 61% coverage
- Environmentally Relevant Concentration of Bisphenol S Shows Slight Effects on SIHUMIx
Schäpe, Microorganisms 2020 - “...a subunit of an Acetyl-CoA carboxylase and a phosphoglucosamine mutase from A. caccae (Uniprot accession B0MI45 and B0MGA4), involved in fatty acid synthesis as well as peptidoglycan and lipopolysaccharide (LPS) synthesis, respectively. Also three transporters, two assigned to B. thetaiotaomicron (Uniprot accession Q8A992 and Q8A991), one...”
YPO3658 biotin carboxylase from Yersinia pestis CO92
YPTB3572 biotin carboxylase from Yersinia pseudotuberculosis IP 32953
47% identity, 61% coverage
Q75RY4 urea carboxylase (EC 6.3.4.6) from Oleomonas sagaranensis (see paper)
49% identity, 38% coverage
AKJ12_RS08585 acetyl-CoA carboxylase biotin carboxylase subunit from Xanthomonas arboricola pv. juglandis
48% identity, 61% coverage
- Proteome Analysis of Walnut Bacterial Blight Disease
H, International journal of molecular sciences 2020 - “...(AKJ12_RS18195, AKJ12_RS14795, AKJ12_RS12205, and AKJ12_RS12930); four aminopeptidases (AKJ12_RS15095, AKJ12_RS13855, AKJ12_RS05625, and AKJ12_RS04085); and biotin carboxylase (AKJ12_RS08585). In addition, we highlighted argininosuccinate synthase (AKJ12_RS01860); lytic murein transglucosylase (AKJ12_RS06545); two copper-binding proteins located adjacent to each other in the Xaj genome; and a copper chaperone (AKJ12_RS00535, AKJ12_RS00530, and...”
PYC_STAAM / A0A0H3JRU9 Pyruvate carboxylase; EC 6.4.1.1 from Staphylococcus aureus (strain Mu50 / ATCC 700699) (see 3 papers)
A0A0H3JRU9 pyruvate carboxylase (EC 6.4.1.1) from Staphylococcus aureus (see 4 papers)
NP_371638 pyruvate carboxylase from Staphylococcus aureus subsp. aureus Mu50
SA0963 pyruvate carboxylase from Staphylococcus aureus subsp. aureus N315
BJL64_05525, SAV1114 pyruvate carboxylase from Staphylococcus aureus
45% identity, 39% coverage
- function: Catalyzes a 2-step reaction, involving the ATP-dependent carboxylation of the covalently attached biotin in the first step and the transfer of the carboxyl group to pyruvate in the second.
catalytic activity: hydrogencarbonate + pyruvate + ATP = oxaloacetate + ADP + phosphate + H(+) (RHEA:20844)
cofactor: biotin
subunit: Homotetramer. - Blood Serum Affects Polysaccharide Production and Surface Protein Expression in S. Aureus
Islam, Advances in biotechnology & microbiology (Newbury, Calif.) 2017 - “...RNA polymerase(rpoB) Transcription of DNA into RNA 6_5/135 NP_371067 2.Pyruvate carboxylase (pycA) Carbohydrate metabolism 5_0/128 NP_371638 3.1soleucyl-tRNA synthetase (ileS) Aminio Acid biosynthesis 5.2/104 NP_371717 b6 1. Alanyl-tRNA synthetase RNA synthesis 4.9/93 NP_372142 2. Hypothetical protein (SAV0219) Not known 4.6/37 NP_370743 3.Collagen adhesin precursor (MW2612) Surface Adhesin...”
- Respiration and Small Colony Variants of Staphylococcus aureus
Proctor, Microbiology spectrum 2019 (secret) - Novel single-nucleotide variations associated with vancomycin resistance in vancomycin-intermediate Staphylococcus aureus
Lin, Infection and drug resistance 2018 - “...Transcriptome analysis data 10 SA1659 prsA 18927181893680 Peptidyl-prolyl cis/trans isomerase homolog Deletion frameshift mutation 10 SA0963 pycA 10912421094694 Pyruvate carboxylase Transcriptome analysis data 10 SA0500 rpoB 579620583171 RNA polymerase beta chain SNP (G171D, A447V, D471Y, H481Y) 4 SA1872 rsbU complement (21198212120822) SigmaB regulation protein RsbU Transcriptome...”
- Exposure of clinical MRSA heterogeneous strains to β-lactams redirects metabolism to optimize energy production through the TCA cycle
Keaton, PloS one 2013 - “...sucD 3.3 succinyl-CoA synthetase alpha subunit Catalyzes the only substrate-level phosphorylation in the TCA cycle. SA0963 pycA 3 pyruvate carboxylase Involved in the TCA cycle, alanine and aspartate metabolism, pyruvate metabolism. SA1510 gapB 4.8 glyceraldehyde 3-phosphate dehydrogenase Involved in glycolysis and glyconeogenesis. SA1845 2.2 hypothetical protein...”
- “...Genes encoding enzymes involved in gluconeogenesis were similarly down-regulated including pyruvate carboxylase ( pycA , SA0963), which catalyzes the conversion of pyruvate into oxaloacetate, and fructose-1,6-bisphosphatase III (SA2401). The only glycolytic gene observed to be up-regulated during the HeR/HoR selection was glyceraldehyde-3-phosphate dehydrogenase ( gapB ,...”
- Transcriptional profiling analysis of the global regulator NorG, a GntR-like protein of Staphylococcus aureus
Truong-Bolduc, Journal of bacteriology 2011 - “...SA1916 SA0994 SA0995 SA1110 SA2410 SA2411 SA2412 SA0964 SA0963 SA1158 SA1159 SA1160 SA1478 SA2198 SA2617 SA2199 SA1714 SA1715 Amino acid ABC transporter Amino...”
- walK and clpP mutations confer reduced vancomycin susceptibility in Staphylococcus aureus
Shoji, Antimicrobial agents and chemotherapy 2011 - “...0.43 0.37 0.35 0.35 0.34 Succinate dehydrogenase SA0963 SA0994 SA0995 SA0996 pycA sdhC sdhA sdhB Pyruvate carboxylase Succinate dehydrogenase, cytochrome b-558...”
- Staphylococcal major autolysin (Atl) is involved in excretion of cytoplasmic proteins
Pasztor, The Journal of biological chemistry 2010 - “...5 4.9 8.3 4.6 5.2 4.9 6.5 5.5 4.7 4.9 SA0935 SA0963 SA0500 SA1099 SA0829 SAS074 SA0719 01029 01064 00524 01232 00906 02425 00785 63 129 133 29.1 33.1 10 34 4.6...”
- Large-scale identification of genes required for full virulence of Staphylococcus aureus
Benton, Journal of bacteriology 2004 - “...asd 428 1,073 425 329 154 589 131 91 SA1749 SA0963 SA1044 SA1226 IVT35 vga 642 512 SA1852 IVT133 yflS (B. subtilis) 472 159 SA2486 IVT176 IVT207 yuiF (B....”
- Borosilicate bioactive glass synergizing low-dose antibiotic loaded implants to combat bacteria through ATP disruption and oxidative stress to sequentially achieve osseointegration
Fan, Bioactive materials 2025 - “...on cell membranes [ 47 , 48 ]. In our results, SACOL1102 , SAV1094 , SAV1114 , BSU28450 , etc., relative to genes involved in the TCA cycle, were significantly downregulated in S. aureus in the B/G/PMMA group. The expression of NADP binding-related genes (such as...”
- Joint Genomic and Proteomic Analysis Identifies Meta-Trait Characteristics of Virulent and Non-virulent Staphylococcus aureus Strains
Bonar, Frontiers in cellular and infection microbiology 2018 - “...protein (lipoprotein) BJL64_05335 [BJL65_05325] 69 Internal stop codon in ch22. 6. 975 Pyruvate carboxylase PycA BJL64_05525 [BJL65_05515] 1,150 Internal stop codon in ch22. 7. 1017 Hypothetical protein BJL64_05735 [BJL65_05725] 55 Internal stop codon in ch22. 8. 1702 Exotoxin SeN BJL64_09410 [BJL65_10575] 251 Internal stop codon in...”
WP_000809507 pyruvate carboxylase from Staphylococcus aureus
45% identity, 39% coverage
CPS_RS04200 acetyl-CoA carboxylase biotin carboxylase subunit from Colwellia psychrerythraea 34H
46% identity, 61% coverage
BPSS2034 putative acetyl-/propionyl-coenzyme A carboxylase alpha chain protein from Burkholderia pseudomallei K96243
38% identity, 92% coverage
- Microevolution of Burkholderia pseudomallei during an acute infection
Limmathurotsakul, Journal of clinical microbiology 2014 - “...C19, C70 Intergenic Small 2103217 CT/G b C24 Intergenic Small 2718281 Deletion of GC C4 BPSS2034 Frameshift Acetyl/propionyl-coenzyme A carboxylase alpha chain protein Fatty acid biosynthesis Small 3078443 Insertion of GAGTGCGGC C55 BPSS2328 Duplication of tripeptide, His-Ser-Pro at position 1961 Multidomain beta keto-acyl synthase Secondary metabolite...”
- “...the left thigh wound (C65) had a 9-bp insertion in the multidomain keto-acyl synthase CDS (BPSS2034), which resulted in an in-frame insertion of 3 amino acids (His-Ser-Pro). In contrast, an isolate from a right leg pustule (C4) had a 2-bp deletion in the acetyl/propionyl-coenzyme A carboxylase...”
Q9FAF5 biotin carboxylase (EC 6.3.4.14) from Myxococcus xanthus (see paper)
48% identity, 61% coverage
FGSG_08688 hypothetical protein from Fusarium graminearum PH-1
36% identity, 93% coverage
BMMGA3_RS05255 pyruvate carboxylase from Bacillus methanolicus MGA3
44% identity, 39% coverage
NWMN_0979 pyruvate carboxylase from Staphylococcus aureus subsp. aureus str. Newman
45% identity, 39% coverage
- Comparative Transcriptome Analysis Reveals Differentially Expressed Genes Related to Antimicrobial Properties of Lysostaphin in Staphylococcus aureus
Yan, Antibiotics (Basel, Switzerland) 2022 - “...Newman_WT. Of the 21 significant SNPs, 18 were associated with 4 individual genes (NWMN_0305, NWMN_0306, NWMN_0979, and NWMN_1288). The remaining three SNPs were distributed in the intergenic regions: two of them were between the lctp and Spa genes and one was located between the recR and...”
- “...region (between recR and tmk ) WGS mutant contigs 1,086,625 AGC AGT S S Yes NWMN_0979 ( pycA ): pyruvate carboxylase 1,085,501 1,088,971 WGS mutant reads 1,086,625 AGC AGT S S Yes NWMN_0979 ( pycA ): pyruvate carboxylase 1,085,501 1,088,971 RNA-seq mutant contig 1,086,625 AGC AGT...”
- CodY in Staphylococcus aureus: a regulatory link between metabolism and virulence gene expression
Pohl, Journal of bacteriology 2009 - “...NWMN_0379 NWMN_1110 NWMN_1111 NWMN_1112 NWMN_1249 NWMN_0163 NWMN_0162 NWMN_0979 NWMN_1325 NWMN_2294 NWMN_0167 Gene Newman vs codY mutant agr mutant vs agr codY...”
SAUSA300_1014 pyruvate carboxylase from Staphylococcus aureus subsp. aureus USA300_FPR3757
45% identity, 39% coverage
- Growth and Stress Tolerance Comprise Independent Metabolic Strategies Critical for Staphylococcus aureus Infection
Kim, mBio 2021 - “...17791 1013 + + + + SAUSA300_2073 tdk 5015 5338 992 + + + + SAUSA300_1014 pyc 582 12356 1001 + + + + 2,675 1,136 *** 325,000 208,601 *** SAUSA300_0959 fmtA 469 229 1002 + + + + SAUSA300_1112 stp1 6522 189 983 + +...”
- “...108.524.61 119.6325.29 35.076.38 0.60.21 SAUSA300_1246 acnA 4.8 1.020.04 2.51 77.0834.94 * 85.6320.98 29.829.97 0.760.31 * SAUSA300_1014 pyc 5.54 0.830.04 **** 2.85 66.5318.67 **** 145.2136.90 * 24.096.32 *** 0.640.32 SAUSA300_1902 PPP 5.98 0.940.12 *** 3.84 40.5811.60 **** 55.6121.59 *** 233.24 * 0.830.13 ** SAUSA300_0961 qoxC Oxphos 11.25...”
KMZ21_05015 pyruvate carboxylase from Staphylococcus aureus subsp. aureus RN4220
SAOUHSC_01064 pyruvate carboxylase from Staphylococcus aureus subsp. aureus NCTC 8325
SACOL1123 pyruvate carboxylase from Staphylococcus aureus subsp. aureus COL
YP_499610 pyruvate carboxylase from Staphylococcus aureus subsp. aureus NCTC 8325
45% identity, 39% coverage
- Hybrid assembly using long reads resolves repeats and completes the genome sequence of a laboratory strain of Staphylococcus aureus subsp. aureus RN4220
Panthee, Heliyon 2022 - “...- 15 KMZ21_04460 461 mgtE 925408..926793 - 16 KMZ21_04700 36 hypothetical protein 972806..972916 - 17 KMZ21_05015 1150 pyruvate carboxylase 1037702..1041154 - 18 KMZ21_05785 567 proline tRNA ligase 1196448..1198151 - 19 KMZ21_06475 97 transposase 1341780..1342073 - 20 KMZ21_06560 160 transposase 1357791..1358271(-) - 21 KMZ21_06705 9535 ebh: hyperosmolarity...”
- Proteomic and Metabolomic Analyses of a Tea-Tree Oil-Selected Staphylococcus aureus Small Colony Variant
Torres, Antibiotics (Basel, Switzerland) 2019 - “...metabolism 1.5 SAOUHSC_01043 PdhD dihydrolipoamide dehydrogenase carbohydrate metabolism 1.3 SAOUHSC_01058 TypA GTP-binding protein unclassified 1.7 SAOUHSC_01064 PycA pyruvate carboxylase carbohydrate metabolism 1.7 SAOUHSC_01091 SpoU tRNA G18 (ribose-2-O)-methylase uncharacterized 1.4 SAOUHSC_01093 PheT phenylalanyl-tRNA synthetase subunit beta protein synthesis 1.4 SAOUHSC_01110 Ecb extracellular complement-binding protein virulence factor 4.3...”
- Copper stress in Staphylococcus aureus leads to adaptive changes in central carbon metabolism
Tarrant, Metallomics : integrated biometal science 2019 - “...2.1 <0.00010 d -Alanine-poly(phosphoribitol) ligase subunit 1 dltA SAOUHSC_00869 gi|122539917 2 <0.00010 Pyruvate carboxylase pycA SAOUHSC_01064 gi|88194813 1.3 0.00013 Histone-like DNA-binding protein HU hup SAOUHSC_01490 gi|446966607 1.2 <0.00010 Proteins with decreased abundance in cells cultured in 1 mM Cu in TM medium Cold-shock protein cspC SAOUHSC_00819...”
- “...pdhC SAOUHSC_01042 gi|88194794 0.6 <0.00010 Bifunctional autolysin atl SAOUHSC_00994 gi|110832765 0.6 0.00038 Pyruvate carboxylase pycA SAOUHSC_01064 gi|88194813 0.6 <0.00010 Phosphoribosylamine-glycine ligase purD SAOUHSC_01018 gi|88194772 0.6 0.00074 DNA-directed RNA polymerase subunit beta rpoC SAOUHSC_00525 gi|114152142 0.5 0.00013 Elongation factor Tu tuf SAOUHSC_00530 gi|123098060 0.2 <0.00010 Alkaline shock...”
- A multihost bacterial pathogen overcomes continuous population bottlenecks to adapt to new host species
Bacigalupe, Science advances 2019 - “...NCTC8325 SNP 813,228 Missense metN2 Methionine import ATP-binding protein MetN2 TM NCTC8325 SNP 1,030,094 Missense SAOUHSC_01064 Pyruvate carboxylase TM NCTC8325 SNP 1,067,459 Missense sdhB Iron-sulfur subunit of succinate dehydrogenase%2C putative TM NCTC8325 SNP 1,121,026 Missense carB Carbamoyl phosphate synthase large subunit TM NCTC8325 SNP 1,138,999 Missense...”
- Protein CoAlation and antioxidant function of coenzyme A in prokaryotic cells
Tsuchiya, The Biochemical journal 2018 - “...LYGFC*IQR 106.68 pth Peptidyl-tRNA hydrolase 21.703 C*IVGLGNIGK 84.31 dnaK Chaperone protein DnaK 66.361 IIGIDLGTTNSC*VTVLEGDEPK 89.507 SAOUHSC_01064 Pyruvate carboxylase 18.812 C*AEEGIK18.812 77.73 sarR HTH-type transcriptional regulator SarR 13.669 C*SEFKPYYLTK 98.421 lepA Elongation factor 4 28.674 C*YGGDISR 128.35 asnS AsparaginetRNA ligase 49.157 SVLENC*KLELK 125.97 pfkA ATP-dependent 6-phosphofructokinase 34.839...”
- Bacterial Hypoxic Responses Revealed as Critical Determinants of the Host-Pathogen Outcome by TnSeq Analysis of Staphylococcus aureus Invasive Infection
Wilde, PLoS pathogens 2015 - “...that feed into the TCA cycle were also important for intraosseous growth, including pyruvate carboxylase (SAOUHSC_01064 pyc ), pyruvate dehydrogenase (SAOUHSC_01040 pdhA ), and a putative malic enzyme (SAOUHSC_01810). Mutations in 7 S . aureus genes encoding amino acid biosynthesis enzymes compromised bacterial growth during osteomyelitis,...”
- Genes contributing to Staphylococcus aureus fitness in abscess- and infection-related ecologies
Valentino, mBio 2014 - “...play an important role in Francisella virulence ( 52 ). Additionally, mutants in pyruvate carboxylase (SAOUHSC_01064) and aspartate aminotransferase (SAOUHSC_02158), involved in production of aspartate from pyruvate ( 53 ), were observed to be less abundant under all infection conditions tested, indicating a critical role for...”
- Redox sensing by a Rex-family repressor is involved in the regulation of anaerobic gene expression in Staphylococcus aureus
Pagels, Molecular microbiology 2010 - “...0.8 (0.8) 3.4 (1.4) 0.5 (0.5) 6.6 (3.1) 1.6 (1.7) SACOL0976 Hydrolase, haloacid dehalogenase-like family SAOUHSC_01064 Pyc 2 1.4 (11.4) 1.7 (1.4) 5.3 (6.8) 0.3 (0.2) 0.3 (1.7) SACOL1123 Pyruvate carboxylase SAOUHSC_01218 SucD 1.4 (1.1) 3.8 (1.5) 1.6 (1.2) 2.4 (1.3) 0.9 (0.9) SACOL1263 Succinyl-CoA synthetase...”
- Redox sensing by a Rex-family repressor is involved in the regulation of anaerobic gene expression in Staphylococcus aureus
Pagels, Molecular microbiology 2010 - “...dehalogenase-like family SAOUHSC_01064 Pyc 2 1.4 (11.4) 1.7 (1.4) 5.3 (6.8) 0.3 (0.2) 0.3 (1.7) SACOL1123 Pyruvate carboxylase SAOUHSC_01218 SucD 1.4 (1.1) 3.8 (1.5) 1.6 (1.2) 2.4 (1.3) 0.9 (0.9) SACOL1263 Succinyl-CoA synthetase subunit alpha SAOUHSC_01266 1.3 (1.2) 5.5 (4.4) 6.5 (5.2) 0.8 (0.8) 0.2 (0.2)...”
- Allosteric Site at the Biotin Carboxylase Dimer Interface Mediates Activation and Inhibition in Staphylococcus aureus Pyruvate Carboxylase.
Laseke, Biochemistry 2023 - GeneRIF: Allosteric Site at the Biotin Carboxylase Dimer Interface Mediates Activation and Inhibition in Staphylococcus aureus Pyruvate Carboxylase.
QV15_05170 pyruvate carboxylase from Staphylococcus aureus
SAR1088 putative pyruvate carboxylase from Staphylococcus aureus subsp. aureus MRSA252
45% identity, 39% coverage
- A spectrum of CodY activities drives metabolic reorganization and virulence gene expression in Staphylococcus aureus
Waters, Molecular microbiology 2016 - “...transporters for oligopeptides (QV15_04450-04470), p -aminobenzoyl-glutamate (QV15_12780), and galactitol (QV15_00960) are turned on early. pycA (QV15_05170), sucA (QV15_06885) and QV15_00370, coding for pyruvate carboxylase, 2-oxoglutarate dehydrogenase and acetoin reductase - all of which control the distribution of pyruvate and 2-oxoglutarate - are also turned on early....”
- Staphylococcus aureus mutant screen reveals interaction of the human antimicrobial peptide dermcidin with membrane phospholipids
Li, Antimicrobial agents and chemotherapy 2009 - “...10-14 6-15 8-16 38-40 6-14 10-16 1.6 1.5 SAR1343 SAR0674 SAR1088 SAR1196 SAR1202 SAR1075 1 6 3 3 1 4 20-23 8-16 9-12 8-14 52-54 8-14 1.4 Bioluminescence assay...”
- The Staphylococcus aureus response to unsaturated long chain free fatty acids: survival mechanisms and virulence implications
Kenny, PloS one 2009 - “...SAR0753 fruA fructose-specific PTS system component 2.50 3.78E-02 SAR0766 glutamine amidotransferase class-I protein 2.04 6.16E-04 SAR1088 putative pyruvate carboxylase 2.5 8.78E-04 SAR1450 tdcB putative threonine dehydratase 2.22 5.47E-03 SAR1451 ald2 alanine dehydrogenase 2 3.03 1.15E-03 SAR1777 pfkA 6-phosphofructokinase 2.86 2.87E-03 SAR1789 ackA acetate kinase 2.33 9.23E-03...”
- “...pyruvate levels. Concomitantly, there was down-regulation of genes involved in pyruvate utilisation, including ldh1 , SAR1088 ( pycA ), ald2 and SAR0355 converting pyruvate to lactate, oxaloacetate, alanine and cysteine, respectively. Reduced transcription of SAR2143 ( ilvC ) could further lower the expenditure of cellular pyruvate...”
lp_1678 acetyl-CoA carboxylase, biotin carboxylase subunit from Lactobacillus plantarum WCFS1
F9UP42 biotin carboxylase from Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
lp_1678 acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha from Lactiplantibacillus plantarum WCFS1
45% identity, 62% coverage
- Transcriptional analysis of the molecular mechanism underlying the response of Lactiplantibacillus plantarum to lactic acid stress conditions
Jang, Heliyon 2023 - “...4.07E-82 2.61E-79 acyl-carrier proteinreductase lp_1681 COG0623 accC2 5.06 8.15E-64 3.49E-61 5.81 5.19E-79 2.22E-76 acetyl-CoA carboxylase lp_1678 COG0439 accB2 4.99 3.46E-60 9.89E-58 5.66 1.07E-72 3.06E-70 acetyl-CoA carboxylase lp_1676 COG0511 fabG1 4.85 1.73E-62 5.57E-60 5.64 2.75E-78 1.01E-75 3-oxoacyl-ACP reductase lp_1674 COG1028 fabF 4.90 1.40E-68 1.20E-65 5.63 6.29E-85 5.39E-82...”
- “...Both acidic conditions increased the expression of acetyl-CoA carboxylase, acyl carrier proteins (lp_1680, lp_1679, lp_1676, lp_1678), oxoacyl-ACP reductase (lp_1674), oxoacyl-ACP synthase (lp_1675, lp_1671), acyl-CoA hydrolase (lp_1686), and membrane proteins (lp_3177, lp_2949, lp_1684). Interestingly, the expression of lactate racemization-related genes (lp_0105, lp_0104, lp_0106, and lp_1017) increased only...”
- Oleuropein Transcriptionally Primes Lactobacillus plantarum to Interact With Plant Hosts
Santamaría, Frontiers in microbiology 2019 - “...addition, genes coding for enzymes of the acetyl-CoA complex ( accB2 or lp_1676, accC2 or lp_1678, accD2 or lp_1679 ), which use acetyl-CoA to initiate the fatty acid biosynthesis (fab), and the acetate kinase ( lp_0210 ) which forms acetate from acetyl-P, were downregulated. The DAVID...”
- “...( fabZ1 or lp_1670 , fabD or lp_1673 , accB2 or lp_1676 , accC2 or lp_1678 , accD2 or lp_1679 ) and elongation ( fabH2 or lp_1670 , fabG1 or lp_1674 , fabF or lp_1675 , fabZ2 or lp_1677 , fabI or lp_1681 ) steps of...”
- Response of Lactobacillus plantarum WCFS1 to the Gram-Negative Pathogen-Associated Quorum Sensing Molecule N-3-Oxododecanoyl Homoserine Lactone
Spangler, Frontiers in microbiology 2019 - “...dehydratase 0.51 0.81 F9UP40_LACPL lp_1676 accB2 AcCoA carboxylase biotin carboxyl carrier protein 0.59 1.07 F9UP42_LACPL lp_1678 accC2 AcCoA carboxylase, biotin carboxylase subunit 0.78 0.52 ACCD2_LACPL lp_1679 accD2 AcCoA carboxylase carboxyl transferase subunit beta 0.80 0.66 F9UP44_LACPL lp_1680 accA2 AcCoA carboxylase carboxyl transferase subunit alpha 1.07 0.42...”
- Identification of prebiotic fructooligosaccharide metabolism in Lactobacillus plantarum WCFS1 through microarrays
Saulnier, Applied and environmental microbiology 2007 - “...and phospholipid metabolism lp_1675 lp_1673 lp_1674 lp_1678 lp_1680 lp_1672 lp_1676 lp_1679 lp_1671 lp_1681 lp_1682 lp_1670 3-Oxoacyl-[acyl-carrier protein]...”
- Identification of key proteins and pathways in cadmium tolerance of Lactobacillus plantarum strains by proteomic analysis.
Zhai, Scientific reports 2017 - “...pyrR1; pyrimidine operon regulator 1.62 F9UNA0 dgk2; Deoxynucleoside kinase 2.04 Lipid metabolism Fatty acid biosynthesis F9UP42 accC2; acetyl-CoA carboxylase, biotin carboxylase subunit 1.90 Q88WG0 accD2; acetyl-CoA carboxylase, carboxyl transferase subunit beta 1.84 F9UP44 accA2; acetyl-CoA carboxylase, carboxyl transferase subunit alpha 1.98 Glycerol lipid metabolism F9USY0 dak1B;...”
4rzqA / P43873 Structural analysis of substrate, reaction intermediate and product binding in haemophilus influenzae biotin carboxylase (see paper)
46% identity, 61% coverage
- Ligands: methyl (3as,4s,6ar)-4-(5-methoxy-5-oxopentyl)-2-oxohexahydro-1h-thieno[3,4-d]imidazole-1-carboxylate; adenosine-5'-diphosphate (4rzqA)
Tfu_0947 putative acetyl/propionyl CoA carboxylase alpha subunit: biotin carboxylase from Thermobifida fusca YX
39% identity, 91% coverage
- The Effects of Carbon Source and Growth Temperature on the Fatty Acid Profiles of Thermobifida fusca
Winkelman, Frontiers in molecular biosciences 2022 - “...or from Actinomycetes . Enzyme Description Gene name ACCase A ACCase BC and BCCP subunits Tfu_0947 ACCase B ACCase CT subunit Tfu_0948 AcCCase A AcCCase BC and BCCP subunit Tfu_2557 AcCCase B AcCCase CT subunit Tfu_2555 AcCCase E AcCCase E subunit Tfu_2556 ACCase B Additional ACCase...”
- “...the T. fusca genome identified additional genes that encode homologs of biotin-containing carboxylase proteins, namely Tfu_0947, Tfu_0948, Tfu_1215, Tfu_1228, Tfu_1513, and Tfu_1530. The adjacent Tfu_0947 and Tfu_0948 genes suggest that they are on a single operon, with Tfu_0947 encoding a subunit with the BC and BCCP...”
- Proteomics-based metabolic modeling and characterization of the cellulolytic bacterium Thermobifida fusca
Vanee, BMC systems biology 2014 - “...version whereas the proteomics version clearly shows its presence (EC 6.4.1.1, Gene ID: Tfu_2557, Tfu_1530, Tfu_0947, Tfu_1228). In addition, most of the amino acid pathways were fully or partially incomplete in Tfu_v2. Thus, the Tfu_v2 model had artificially high fluxes through transport reactions to uptake external...”
accC / A9W9X0 biotin carboxylase (EC 6.3.4.14) from Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) (see paper)
A9W9X0 biotin carboxylase (EC 6.3.4.14) from Chloroflexus aurantiacus (see paper)
Caur_1378 acetyl-CoA carboxylase, biotin carboxylase from Chloroflexus aurantiacus J-10-fl
WP_012257262 acetyl-CoA carboxylase biotin carboxylase subunit from Chloroflexus aurantiacus
47% identity, 62% coverage
- Coassimilation of organic substrates via the autotrophic 3-hydroxypropionate bi-cycle in Chloroflexus aurantiacus
Zarzycki, Applied and environmental microbiology 2011 - “...genes encoding biotin carboxyl carrier proteins/protein domains (Caur_1378, 64.3 kDa; Caur_2832, 69.4 kDa; and Caur_3739, 19.3 kDa) of acetyl-CoA/propionyl-CoA...”
- “...The two upper bands correspond to fusion proteins Caur_1378 (64.3 kDa) and Caur_2832 (69.4 kDa), each comprising a biotin carboxyl carrier protein and a...”
- Complete genome sequence of the filamentous anoxygenic phototrophic bacterium Chloroflexus aurantiacus
Tang, BMC genomics 2011 - “...3470) CO 2 -anaplerotic pathways tme (Caur_1614), pckA (Caur_2331), ppc (Caur_3161, Caur_3888) 3-hydroxypropionate cycle accC (Caur_1378, Caur_3421), accA (Caur_1647), accD (Caur_1648), accB (Caur_3739), mcr (Caur_2614), pcs (Caur_ 0613), pccB (Caur_2034, Caur_3435), mcee (Caur_3037), mut (Caur_1844, Caur_2508, Caur_2509), smtA (Caur_0179), smtB (Caur_0178), sdhBAC (Caur_1880 to Caur_1882), fh...”
- “...the 3HOP cycle were later characterized experimentally [ 4 ]: (1) acetyl-CoA carboxylase ( accC (Caur_1378 and Caur_3421, biotin carboxylase), accA (Caur_1647, -subunit), accD (Caur_1648, -subunit) and accB (Caur_3739) [ 79 ], (2) malonyl-CoA reductase ( mcr , Caur_2614) [ 80 ], (3) propionyl-CoA synthase (...”
- Chloroflexus aurantiacus acetyl-CoA carboxylase evolves fused biotin carboxylase and biotin carboxyl carrier protein to complete carboxylation activity
Shen, mBio 2024 - “...isoforms, and separate BCCP, CT, and CT subunits ( 4 ). The first BC isoform (WP_012257262, BC1) contains 596 amino acid residues, while the second BC isoform (WP_012259259, BC2) comprises 455 residues. During the transition from respiratory to phototrophic conditions, a simultaneous increase in the expression...”
- “...primary structures of C. aurantiacus BC1 and BC2. C. aurantiacus possesses two BC isoforms, BC1 (WP_012257262) and BC2 (WP_012259259). BC1 confers a fused BC (Met1-Glu452) and BCCP domain (Ala459-Lys596), which contains a hairpin (Thr473-Gly486) and a BCCP Core (Lys511-Gln587) at the C-terminus. Multiple sequence alignment revealed...”
SXYL_01821 pyruvate carboxylase from Staphylococcus xylosus
42% identity, 44% coverage
5vyzA Crystal structure of lactococcus lactis pyruvate carboxylase in complex with cyclic-di-amp (see paper)
45% identity, 39% coverage
- Ligands: manganese (ii) ion; adenosine-5'-diphosphate; magnesium ion; (2r,3r,3as,5r,7ar,9r,10r,10as,12r,14ar)-2,9-bis(6-amino-9h-purin-9-yl)octahydro-2h,7h-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide (5vyzA)
1dv1B / P24182 Structure of biotin carboxylase (apo) (see paper)
47% identity, 61% coverage
- Ligand: phosphate ion (1dv1B)
BLJAPNOD_04937 acetyl-CoA carboxylase biotin carboxylase subunit from Ensifer sp. M14
48% identity, 61% coverage
A0RY62 biotin carboxylase (EC 6.3.4.14) from Cenarchaeum symbiosum (see paper)
45% identity, 59% coverage
SCO6271 acyl-CoA carboxylase complex A subunit from Streptomyces coelicolor A3(2)
Q9EWV4 biotin carboxylase from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
SCO4921 acyl-CoA carboxylase complex A subunit from Streptomyces coelicolor A3(2)
35% identity, 92% coverage
- Genome Analysis of a Variant of Streptomyces coelicolor M145 with High Lipid Content and Poor Ability to Synthetize Antibiotics
Dulermo, Microorganisms 2023 - “...of the nine genes of S. coelicolor M145 encoding putative acyl/acetyl/propionyl CoA carboxylases, sco4921 and sco6271 , were deleted in the TD variant. These enzymes, that catalyze the first step of fatty acid biosynthesis, are usually constituted by two subunits: and . In S. coelicolor ,...”
- “...well as SCO4921 (AccA2, acyl-CoA carboxylase subunit ), SCO4926 (PccB, propionyl-CoA carboxylase subunit ) and SCO6271 (Acc1, acyl-CoA carboxylase subunit ). AcetylCoA carboxylase catalyzes the carboxylation of acetyl-CoA to produce malonyl-CoA yielding straight/iso fatty acids. Propionyl CoA carboxylase catalyzes the carboxylation of propionyl-CoA to methylmalonyl-CoA yielding...”
- Dissection of 3D chromosome organization in Streptomyces coelicolor A3(2) leads to biosynthetic gene cluster overexpression
Deng, Proceedings of the National Academy of Sciences of the United States of America 2023 - “...the one of 4.3 Mb. Interestingly, this region comprised three precursor supply genes (SCO6269 to SCO6271) for the synthesis of malonyl-CoA ( 51 ), the assembly unit for the polyketide synthase (PKS), and well-characterized regulation genes (SCO6265 to SCO6266) for -butyrolactone (GBL) signaling circuits, which hints...”
- Coelimycin Synthesis Activatory Proteins Are Key Regulators of Specialized Metabolism and Precursor Flux in Streptomyces coelicolor A3(2)
Bednarz, Frontiers in microbiology 2021 - “...CpkL (SCO6285) were the only members of the cpk cluster which were not detected. AccA1 (SCO6271) differs by only four amino acids from AccA2 (SCO4921), therefore it is not possible to distinguish accurately between these two proteins by the shotgun proteomics method. Almost all detected peptides...”
- “...biotin as a cofactor. In S. coelicolor A3(2) there are two almost identical subunits, AccA1 (SCO6271), encoded within cpk gene cluster, and essential AccA2 (SCO4921) ( Rodrguez et al., 2001 ). We have found that ACCase subunit(s) AccA2 and/or AccA1, subunits AccB (SCO5535) and CpkK (SCO6284),...”
- AccR, a TetR Family Transcriptional Repressor, Coordinates Short-Chain Acyl Coenzyme A Homeostasis in Streptomyces avermitilis
Lyu, Applied and environmental microbiology 2020 (secret) - Multi-Omics Analysis of the Effect of cAMP on Actinorhodin Production in Streptomyces coelicolor
Nitta, Frontiers in bioengineering and biotechnology 2020 - “...This observation also matches the high levels of expression of the two acetyl-CoA carboxylaseencoding genes, SCO6271 ( accA1 ) and SCO4921 ( accA2 ) in M1146 + ACT ( Figure 4B ). When malonyl-CoA levels were analyzed by LC-MS/MS, malonyl-CoA decreased with time, and the malonyl-CoA...”
- ScbR- and ScbR2-mediated signal transduction networks coordinate complex physiological responses in Streptomyces coelicolor
Li, Scientific reports 2015 - “...In addition to kasO and sco6268 promoters, it also bound at the intergenic regions of sco6271 - sco6272 , sco6275 - 6276 , and sco6282 - sco6283 , and the promoter of another regulatory gene sco6288 . Similarly, in the cda cluster, beside the CSR gene...”
- Crp is a global regulator of antibiotic production in streptomyces
Gao, mBio 2012 - “...pathway-specific activator; Red synthesis 590 G T CTCGCCCAC C A C (520) SCO6271-SCO6272 i 1.83 SCO6271 AccA1, acyl-CoA carboxylase complex; yCPK synthesis 51 G T G A GGAGAA T C TT (8) SCO6272 Scf, secreted FAD j -binding protein, yCPK synthesis 257 AA G A TTCTCC...”
- “...synthesis SCO5221-5222 SCO5222 Repressed EizA, putative lyase SCO5223 SCO5223 Repressed Putative cytochrome P450 SCO6271-6272 c SCO6271 Activated AccA1, acyl-CoA carboxylase complex; yCPK synthesis SCO6272 Activated Scf, secreted FAD d -binding protein; yCPK synthesis SCO6272 c SCO6272 Activated Scf, secreted FAD-binding protein; yCPK synthesis SCO6275-6276 c SCO6275...”
- Metabolic switches and adaptations deduced from the proteomes of Streptomyces coelicolor wild type and phoP mutant grown in batch culture
Thomas, Molecular & cellular proteomics : MCP 2012 - “...led to increased expression of Act (42, 43). SCO6271 (AccA1), SCO4921 (AccA2), and SCO5535 (AccB) encode subunits of an acetyl-CoA carboxylase (44). SCO4921 and...”
- More
- High cell density production of multimethyl-branched long-chain esters in Escherichia coli and determination of their physicochemical properties.
Menendez-Bravo, Biotechnology for biofuels 2016 - “...S. coelicolor A3 (2) SCO4921 Q9X4K7 pccB, propionyl-CoA carboxylase subunit S. coelicolor A3 (2) SCO4926 Q9EWV4 pccE , propionyl-CoA carboxylase subunit S. coelicolor A3 (2) SCO4925 Q9EWV8 sfp , phosphopantetheinyl transferase B. subtilis BSU03570 X63158 prpE , propionyl-CoA synthetase E. coli b0335 P77495 pMB20 was constructed...”
- σE of Streptomyces coelicolor can function both as a direct activator or repressor of transcription
Pospíšil, Communications biology 2024 - “...B (HrdB-dependent, Fig. 5 ), we tested SCO1595- pheS , SCO5393, SCO5535- accB , and SCO4921- accA2 as genes likely positively regulated by HrdB. Here, the selection was made based on the presence of predicted HrdB binding sequences upstream of the genes. Except for SCO5393, all...”
- “...be regulated by HrdB instead of E (SCO1595- pheS , SCO5393, SCO5535- accB , and SCO4921- accA2 ). The Figure description is the same as in Fig. 4 . The blue rectangles show the -10 region of HrdB-dependent promoters (if identified in ref. 4 ). The...”
- Genome Analysis of a Variant of Streptomyces coelicolor M145 with High Lipid Content and Poor Ability to Synthetize Antibiotics
Dulermo, Microorganisms 2023 - “...Biosynthesis Two of the nine genes of S. coelicolor M145 encoding putative acyl/acetyl/propionyl CoA carboxylases, sco4921 and sco6271 , were deleted in the TD variant. These enzymes, that catalyze the first step of fatty acid biosynthesis, are usually constituted by two subunits: and . In S....”
- “...catalyzes the carboxylation of propionyl-CoA to methylmalonyl-CoA yielding branched/ante-iso fatty acids ( Figure 5 ). SCO4921 and SCO6271 might constitute the and subunits of a carboxylase complex that would be absent in the TD variant. This leaves six genes encoding three functional carboxylase complexes, SCO2445/44, SCO2776/77...”
- Coelimycin Synthesis Activatory Proteins Are Key Regulators of Specialized Metabolism and Precursor Flux in Streptomyces coelicolor A3(2)
Bednarz, Frontiers in microbiology 2021 - “...cluster which were not detected. AccA1 (SCO6271) differs by only four amino acids from AccA2 (SCO4921), therefore it is not possible to distinguish accurately between these two proteins by the shotgun proteomics method. Almost all detected peptides can be attributed to both of them. AccA1 and/or...”
- “...are two almost identical subunits, AccA1 (SCO6271), encoded within cpk gene cluster, and essential AccA2 (SCO4921) ( Rodrguez et al., 2001 ). We have found that ACCase subunit(s) AccA2 and/or AccA1, subunits AccB (SCO5535) and CpkK (SCO6284), and a small accessory protein AccE (SCO5536), were more...”
- The Onset of Tacrolimus Biosynthesis in Streptomyces tsukubaensis Is Dependent on the Intracellular Redox Status
Pires, Antibiotics (Basel, Switzerland) 2020 - “...STSU_10154 SCO5374 ATP synthase subunit epsilon (AtpC) 0.42 STSU_11515 SCO5044 Fumarate hydratase (FumB) 0.38 STSU_12400 SCO4921 putative acyl-CoA carboxylase complex A subunit 0.09 STSU_12680 SCO4855 succinate dehydrogenase iron-sulfur subunit (SdhB) 0.50 1 STSU_30056 SCO1391 Phosphoenolpyruvate-protein phosphotransferase (EI component) 0.45 Amino acid metabolism STSU_14552 SCO3345 Dihydroxy-acid dehydratase...”
- Iron competition triggers antibiotic biosynthesis in Streptomyces coelicolor during coculture with Myxococcus xanthus
Lee, The ISME journal 2020 - “...the acetyl-CoA synthetase (SCO6195) converted acetate to acetyl-CoA; and (iii) acetyl-CoA carboxylases (SCO2776, SCO2777, and SCO4921) converted acetyl-CoA to malonyl-CoA (Fig. 1e ). Considering that the transcription levels of genes involved in other acetyl-CoA-associated pathways, such as glycolysis and the citrate cycle, showed no differences between...”
- Multi-Omics Analysis of the Effect of cAMP on Actinorhodin Production in Streptomyces coelicolor
Nitta, Frontiers in bioengineering and biotechnology 2020 - “...high levels of expression of the two acetyl-CoA carboxylaseencoding genes, SCO6271 ( accA1 ) and SCO4921 ( accA2 ) in M1146 + ACT ( Figure 4B ). When malonyl-CoA levels were analyzed by LC-MS/MS, malonyl-CoA decreased with time, and the malonyl-CoA level was lower in M1146...”
- De novo biosynthesis of myricetin, kaempferol and quercetin in Streptomyces albus and Streptomyces coelicolor
Marín, PloS one 2018 - “.... coelicolor chromosomal genes birA (biotin ligase, SCO4927 gene), accA2 (alpha subunit of acetyl-CoA carboxylase, SCO4921 gene) and accBE (beta and epsilon subunits of acetyl-CoA carboxylase, SCO5535 and SCO5536 genes respectively) [ 49 51 ]. These plasmids were amplified by PCR from S . coelicolor chromosomal...”
- More
TTHA1123 acetyl-CoA carboxylase, biotin carboxylase subunit from Thermus thermophilus HB8
50% identity, 61% coverage
- Transcriptional repression mediated by a TetR family protein, PfmR, from Thermus thermophilus HB8
Agari, Journal of bacteriology 2012 - “...TTHA0417 [FabB(F), AcpP, FabG, FabD, and FabH], TTHA1123 (AccC), TTHA1124 (AccB), TTHA1767 (AccA), and TTHA1768 (AccD) (NCBI accession number NC_006461). Since...”
BAS3859 pyruvate carboxylase from Bacillus anthracis str. Sterne
GBAA4157 pyruvate carboxylase from Bacillus anthracis str. 'Ames Ancestor'
44% identity, 40% coverage
JYQ65_01920 acetyl-CoA carboxylase biotin carboxylase subunit from Limosilactobacillus fermentum
45% identity, 62% coverage
D0C8Q7 Urea carboxylase from Acinetobacter baumannii (strain ATCC 19606 / DSM 30007 / JCM 6841 / CCUG 19606 / CIP 70.34 / NBRC 109757 / NCIMB 12457 / NCTC 12156 / 81)
44% identity, 37% coverage
BSSC8_27920 pyruvate carboxylase from Bacillus subtilis subsp. subtilis str. SC-8
44% identity, 40% coverage
- Proteomic Analysis of the Characteristic Flavor Components in Bacillus subtilis BSNK-5-Fermented Soymilk
Hu, Foods (Basel, Switzerland) 2024 - “...2.20 2.47 A0A6I4DHN9 mmgD 2-methylcitrate synthase 0.49 G4ESR9 BSSC8_13990 Succinate dehydrogenase (quinone) 0.43 0.43 G4EWR2 BSSC8_27920 Pyruvate carboxylase 2.03 2.09 Pyruvate metabolism A0A199WLB6 ackA Acetate kinase 0.45 0.49 A0A6H0H0J6 acoC Acetoin dehydrogenase complex dihydrolipoyllysine-residue acetyltransferase 0.11 0.08 A0A6H0H4J8 accC Acetyl-CoA carboxylase biotin carboxylase subunit 2.16 2.25...”
PAAG_04099 methylcrotonoyl-CoA carboxylase subunit alpha from Paracoccidioides lutzii Pb01
48% identity, 60% coverage
- Hemoglobin uptake by Paracoccidioides spp. is receptor-mediated
Bailão, PLoS neglected tropical diseases 2014 - “...2.4.2.-; 4.1.3.- Histidine biosynthesis 1 PAAG_09095 ATP phosphoribosyltransferase 1303.26 4.67 1.79 2.4.2.17 Histidine biosynthesis 2 PAAG_04099 methylcrotonoyl-CoA carboxylase subunit alpha 179.63 10.00 *** 6.4.1.4 Leucine degradation 1 PAAG_06387 homoisocitrate dehydrogenase 431.93 8.00 1.84 1.1.1.87 Lysine biosynthesis 2 PAAG_02693 saccharopine dehydrogenase 241.77 12.67 1.43 1.5.1.10 Lysine metabolism...”
- Transcriptional and proteomic responses to carbon starvation in Paracoccidioides
Lima, PLoS neglected tropical diseases 2014 - “...# glutamate biosynthesis PAAG_07317 PENR2 protein # methionine biosynthesis PAAG_08162 maleylacetoacetate isomerase # phenylalanine degradation PAAG_04099 methylcrotonoyl-CoA carboxylase subunit alpha # leucine degradation PAAG_02693 saccharopine dehydrogenase # lysine biosynthesis PAAG_02901 S-adenosylmethionine synthetase # L-methionine biosynthesis PAAG_06416 alanine racemase family protein # D- alanine biosynthethic process Nitrogen...”
AYM39_19225 acetyl-CoA carboxylase biotin carboxylase subunit from Methylomonas sp. DH-1
46% identity, 62% coverage
SE0813 pyruvate carboxylase from Staphylococcus epidermidis ATCC 12228
45% identity, 39% coverage
Poly24_16690 pyruvate carboxylase from Rosistilla carotiformis
44% identity, 39% coverage
Q5HQ53 Pyruvate carboxylase from Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
45% identity, 39% coverage
For advice on how to use these tools together, see
Interactive tools for functional annotation of bacterial genomes.
The PaperBLAST database links 793,807 different protein sequences to 1,259,118 scientific articles. Searches against EuropePMC were last performed on March 13 2025.
PaperBLAST builds a database of protein sequences that are linked
to scientific articles. These links come from automated text searches
against the articles in EuropePMC
and from manually-curated information from GeneRIF, UniProtKB/Swiss-Prot,
BRENDA,
CAZy (as made available by dbCAN),
BioLiP,
CharProtDB,
MetaCyc,
EcoCyc,
TCDB,
REBASE,
the Fitness Browser,
and a subset of the European Nucleotide Archive with the /experiment tag.
Given this database and a protein sequence query,
PaperBLAST uses protein-protein BLAST
to find similar sequences with E < 0.001.
To build the database, we query EuropePMC with locus tags, with RefSeq protein
identifiers, and with UniProt
accessions. We obtain the locus tags from RefSeq or from MicrobesOnline. We use
queries of the form "locus_tag AND genus_name" to try to ensure that
the paper is actually discussing that gene. Because EuropePMC indexes
most recent biomedical papers, even if they are not open access, some
of the links may be to papers that you cannot read or that our
computers cannot read. We query each of these identifiers that
appears in the open access part of EuropePMC, as well as every locus
tag that appears in the 500 most-referenced genomes, so that a gene
may appear in the PaperBLAST results even though none of the papers
that mention it are open access. We also incorporate text-mined links
from EuropePMC that link open access articles to UniProt or RefSeq
identifiers. (This yields some additional links because EuropePMC
uses different heuristics for their text mining than we do.)
For every article that mentions a locus tag, a RefSeq protein
identifier, or a UniProt accession, we try to select one or two
snippets of text that refer to the protein. If we cannot get access to
the full text, we try to select a snippet from the abstract, but
unfortunately, unique identifiers such as locus tags are rarely
provided in abstracts.
PaperBLAST also incorporates manually-curated protein functions:
- Proteins from NCBI's RefSeq are included if a
GeneRIF
entry links the gene to an article in
PubMed®.
GeneRIF also provides a short summary of the article's claim about the
protein, which is shown instead of a snippet.
- Proteins from Swiss-Prot (the curated part of UniProt)
are included if the curators
identified experimental evidence for the protein's function (evidence
code ECO:0000269). For these proteins, the fields of the Swiss-Prot entry that
describe the protein's function are shown (with bold headings).
- Proteins from BRENDA,
a curated database of enzymes, are included if they are linked to a paper in PubMed
and their full sequence is known.
- Every protein from the non-redundant subset of
BioLiP,
a database
of ligand-binding sites and catalytic residues in protein structures, is included. Since BioLiP itself
does not include descriptions of the proteins, those are taken from the
Protein Data Bank.
Descriptions from PDB rely on the original submitter of the
structure and cannot be updated by others, so they may be less reliable.
(For SitesBLAST and Sites on a Tree, we use a larger subset of BioLiP so that every
ligand is represented among a group of structures with similar sequences, but for
PaperBLAST, we use the non-redundant set provided by BioLiP.)
- Every protein from EcoCyc, a curated
database of the proteins in Escherichia coli K-12, is included, regardless
of whether they are characterized or not.
- Proteins from the MetaCyc metabolic pathway database
are included if they are linked to a paper in PubMed and their full sequence is known.
- Proteins from the Transport Classification Database (TCDB)
are included if they have known substrate(s), have reference(s),
and are not described as uncharacterized or putative.
(Some of the references are not visible on the PaperBLAST web site.)
- Every protein from CharProtDB,
a database of experimentally characterized protein annotations, is included.
- Proteins from the CAZy database of carbohydrate-active enzymes
are included if they are associated with an Enzyme Classification number.
Even though CAZy does not provide links from individual protein sequences to papers,
these should all be experimentally-characterized proteins.
- Proteins from the REBASE database
of restriction enzymes are included if they have known specificity.
- Every protein with an evidence-based reannotation (based on mutant phenotypes)
in the Fitness Browser is included.
- Sequence-specific transcription factors (including sigma factors and DNA-binding response regulators)
with experimentally-determined DNA binding sites from the
PRODORIC database of gene regulation in prokaryotes.
- Putative transcription factors from RegPrecise
that have manually-curated predictions for their binding sites. These predictions are based on
conserved putative regulatory sites across genomes that contain similar transcription factors,
so PaperBLAST clusters the TFs at 70% identity and retains just one member of each cluster.
- Coding sequence (CDS) features from the
European Nucleotide Archive (ENA)
are included if the /experiment tag is set (implying that there is experimental evidence for the annotation),
the nucleotide entry links to paper(s) in PubMed,
and the nucleotide entry is from the STD data class
(implying that these are targeted annotated sequences, not from shotgun sequencing).
Also, to filter out genes whose transcription or translation was detected, but whose function
was not studied, nucleotide entries or papers with more than 25 such proteins are excluded.
Descriptions from ENA rely on the original submitter of the
sequence and cannot be updated by others, so they may be less reliable.
Except for GeneRIF and ENA,
the curated entries include a short curated
description of the protein's function.
For entries from BioLiP, the protein's function may not be known beyond binding to the ligand.
Many of these entries also link to articles in PubMed.
For more information see the
PaperBLAST paper (mSystems 2017)
or the code.
You can download PaperBLAST's database here.
Changes to PaperBLAST since the paper was written:
- November 2023: incorporated PRODORIC and RegPrecise. Many PRODORIC entries were not linked to a protein sequence (no UniProt identifier), so we added this information.
- February 2023: BioLiP changed their download format. PaperBLAST now includes their non-redundant subset. SitesBLAST and Sites on a Tree use a larger non-redundant subset that ensures that every ligand is represented within each cluster. This should ensure that every binding site is represented.
- June 2022: incorporated some coding sequences from ENA with the /experiment tag.
- March 2022: incorporated BioLiP.
- April 2020: incorporated TCDB.
- April 2019: EuropePMC now returns table entries in their search results. This has expanded PaperBLAST's database, but most of the new entries are of low relevance, and the resulting snippets are often just lists of locus tags with annotations.
- February 2018: the alignment page reports the conservation of the hit's functional sites (if available from from Swiss-Prot or UniProt)
- January 2018: incorporated BRENDA.
- December 2017: incorporated MetaCyc, CharProtDB, CAZy, REBASE, and the reannotations from the Fitness Browser.
- September 2017: EuropePMC no longer returns some table entries in their search results. This has shrunk PaperBLAST's database, but has also reduced the number of low-relevance hits.
Many of these changes are described in Interactive tools for functional annotation of bacterial genomes.
PaperBLAST cannot provide snippets for many of the papers that are
published in non-open-access journals. This limitation applies even if
the paper is marked as "free" on the publisher's web site and is
available in PubmedCentral or EuropePMC. If a journal that you publish
in is marked as "secret," please consider publishing elsewhere.
Many important articles are missing from PaperBLAST, either because
the article's full text is not in EuropePMC (as for many older
articles), or because the paper does not mention a protein identifier such as a locus tag, or because of PaperBLAST's heuristics. If you notice an
article that characterizes a protein's function but is missing from
PaperBLAST, please notify the curators at UniProt
or add an entry to GeneRIF.
Entries in either of these databases will eventually be incorporated
into PaperBLAST. Note that to add an entry to UniProt, you will need
to find the UniProt identifier for the protein. If the protein is not
already in UniProt, you can ask them to create an entry. To add an
entry to GeneRIF, you will need an NCBI Gene identifier, but
unfortunately many prokaryotic proteins in RefSeq do not have
corresponding Gene identifers.
References
PaperBLAST: Text-mining papers for information about homologs.
M. N. Price and A. P. Arkin (2017). mSystems, 10.1128/mSystems.00039-17.
Europe PMC in 2017.
M. Levchenko et al (2017). Nucleic Acids Research, 10.1093/nar/gkx1005.
Gene indexing: characterization and analysis of NLM's GeneRIFs.
J. A. Mitchell et al (2003). AMIA Annu Symp Proc 2003:460-464.
UniProt: the universal protein knowledgebase.
The UniProt Consortium (2016). Nucleic Acids Research, 10.1093/nar/gkw1099.
BRENDA in 2017: new perspectives and new tools in BRENDA.
S. Placzek et al (2017). Nucleic Acids Research, 10.1093/nar/gkw952.
The EcoCyc database: reflecting new knowledge about Escherichia coli K-12.
I. M. Keeseler et al (2016). Nucleic Acids Research, 10.1093/nar/gkw1003.
The MetaCyc database of metabolic pathways and enzymes.
R. Caspi et al (2018). Nucleic Acids Research, 10.1093/nar/gkx935.
CharProtDB: a database of experimentally characterized protein annotations.
R. Madupu et al (2012). Nucleic Acids Research, 10.1093/nar/gkr1133.
The carbohydrate-active enzymes database (CAZy) in 2013.
V. Lombard et al (2014). Nucleic Acids Research, 10.1093/nar/gkt1178.
The Transporter Classification Database (TCDB): recent advances
M. H. Saier, Jr. et al (2016). Nucleic Acids Research, 10.1093/nar/gkv1103.
REBASE - a database for DNA restriction and modification: enzymes, genes and genomes.
R. J. Roberts et al (2015). Nucleic Acids Research, 10.1093/nar/gku1046.
Deep annotation of protein function across diverse bacteria from mutant phenotypes.
M. N. Price et al (2016). bioRxiv, 10.1101/072470.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory