PaperBLAST
PaperBLAST Hits for TCDB::D2RXA4 PTS system, fructose-specific, IIB subunnit, component of Fructose Enzyme II complex (IIAFru - IIBFru - IICFru) (based on homology) (Haloterrigena turkmenica (strain ATCC 51198 / DSM 5511 / NCIMB 13204 / VKM B-1734)) (150 a.a., MKFVAVTSCP...)
Show query sequence
>TCDB::D2RXA4 PTS system, fructose-specific, IIB subunnit, component of Fructose Enzyme II complex (IIAFru - IIBFru - IICFru) (based on homology) (Haloterrigena turkmenica (strain ATCC 51198 / DSM 5511 / NCIMB 13204 / VKM B-1734))
MKFVAVTSCPTGIAHSQMAAENLEQTATDRGHEIDVEVQGAMGQENELSSDAIAEADAVI
IAADTSVNQDRFEGKPVVTAPVKDAVNDVEDLLERAIAAADGETSTADSAQSEGAADASA
SDAEAADSGAPRRGGDPSKGLFARLKRLLS
Running BLASTp...
Found 180 similar proteins in the literature:
TC 4.A.2.1.14 / D2RXA4 PTS system, fructose-specific, IIB subunnit, component of Fructose Enzyme II complex (IIAFru - IIBFru - IICFru) (based on homology) from Haloterrigena turkmenica (strain ATCC 51198 / DSM 5511 / NCIMB 13204 / VKM B-1734) (see paper)
100% identity, 100% coverage
PTFB_HALVD / D4GYE1 PTS system fructose-specific EIIB component; EIIB-Fru; Fructose-specific phosphotransferase enzyme IIB component; EC 2.7.1.202 from Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) (Halobacterium volcanii) (see paper)
TC 4.A.2.1.15 / D4GYE1 Phosphotransferase system IIB component, component of Fructose-specific PTS, PtfABC from Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) (see paper)
HVO_1495 phosphotransferase system IIB component from Haloferax volcanii DS2
55% identity, 95% coverage
- function: The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. The enzyme II PtfABC PTS system is involved in fructose transport.
catalytic activity: D-fructose(out) + N(pros)-phospho-L-histidyl-[protein] = D- fructose 1-phosphate(in) + L-histidyl-[protein] (RHEA:49252) - substrates: fructose
tcdb comment: The transcriptional regulation of the fructose PTS in the very similar organism, Haloferax mediterranei, has shown that GlpR is a transcriptional activator (Cai et al. 2014) - Archaeal ubiquitin-like SAMP3 is isopeptide-linked to proteins via a UbaA-dependent mechanism
Miranda, Molecular & cellular proteomics : MCP 2014 - “...HVO_0736 HVO_0835 HVO_0860 HVO_0966f HVO_1081 HVO_1289 HVO_1495 HVO_1577 HVO_1611 HVO_1655 HVO_1864 HVO_1896 HVO_2011 HVO_2104 HVO_2177* HVO_2328 HVO_B0057...”
- Carbohydrate metabolism in Archaea: current insights into unusual enzymes and pathways and their regulation
Bräsen, Microbiology and molecular biology reviews : MMBR 2014 - “...volcanii harbors one complete fructose PTS gene cluster (HVO_1495 to HVO_1499 [ptfB, ptsI, ptsH1, ptfA, and ptfC]). The cluster encodes the soluble components...”
- Post-translation modification in Archaea: lessons from Haloferax volcanii and other haloarchaea
Eichler, FEMS microbiology reviews 2013 - “...phosphorylated during group translocation provided in parenthesis. Recent work demonstrates that the PTS gene cluster HVO_1495 to HVO_1499, encoding PtsI, EIIB, HPr, EIIA, and EIIC homologs, was highly upregulated as a cotranscript during growth on fructose ( Pickl et al., 2012 ). Deletion of HVO_1499, encoding...”
- Fructose degradation in the haloarchaeon Haloferax volcanii involves a bacterial type phosphoenolpyruvate-dependent phosphotransferase system, fructose-1-phosphate kinase, and class II fructose-1,6-bisphosphate aldolase
Pickl, Journal of bacteriology 2012 - “...During growth on fructose, the gene cluster HVO_1495 to HVO_1499, encoding homologs of the five bacterial phosphotransferase system (PTS) components enzyme...”
- “...(1-PFK) of the PfkB family; the HVO_1499 to HVO_1495 cluster (ptfC, ptfA, ptsH1, ptsI, and ptfB) encodes all five components of the putative fructose-specific...”
- Genetic and proteomic analyses of a proteasome-activating nucleotidase A mutant of the haloarchaeon Haloferax volcanii
Kirkland, Journal of bacteriology 2008 - “...(fbp) HVO_1495 ........................................................PTS IIB component...”
TC 4.A.2.1.26 / Q5V5X1 Phosphotransferase system IIB component, component of Fructose-specific Enzyme I-HPr-Enzyme IIABC complex, all encoded within a single operon with genes in the order: ptsC (IIC), ptsA (IIA), ptsH (HPr), ptsI (Enzyme I) and ptsB (IIB) from Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
61% identity, 100% coverage
TKV_c23130 PTS fructose transporter subunit IIC from Thermoanaerobacter kivui
56% identity, 21% coverage
PTN3B_BACSU / O31645 PTS system mannose-specific EIIBCA component; EIIBCA-Man; EII-Man; EC 2.7.1.191 from Bacillus subtilis (strain 168) (see 2 papers)
O31645 protein-Npi-phosphohistidine-D-mannose phosphotransferase (EC 2.7.1.191) from Bacillus subtilis (see paper)
TC 4.A.2.1.6 / O31645 The mannose porter (ManP) (37% identical to 4.A.2.1.1). It is encoded in an operon with 3 genes: from Bacillus subtilis (see 5 papers)
NP_389083 phosphotransferase system (PTS) mannose-specific enzyme IIBCA component from Bacillus subtilis subsp. subtilis str. 168
BSU12010 phosphotransferase system (PTS) mannose-specific enzyme IIBCA component from Bacillus subtilis subsp. subtilis str. 168
53% identity, 15% coverage
- function: The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active -transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. This system is involved in mannose transport
catalytic activity: D-mannose(out) + N(pros)-phospho-L-histidyl-[protein] = D- mannose 6-phosphate(in) + L-histidyl-[protein] (RHEA:49232)
disruption phenotype: Cells lacking this gene are unable to grow with mannose as the sole carbon source. Deletion of manP results in constitutive expression from both the manP and manR promoters, indicating that the phosphotransferase system (PTS) component EII-Man has a negative effect on regulation of the mannose operon and manR. - substrates: Mannose
tcdb comment: manP-manA-yjdD, where manP codes for the IIBCA mannose transporter, manA codes for a mannose-6-P isomerase and YjdD codes for a 5-formyltetrahydrofolate cyclo-ligase, characterized in B. anthrasis. Expression of the operon is regulated by ManP and ManR, an activator, in response to external mannose (Sun and Altenbuchner 2010) - Characterization of a mannose utilization system in Bacillus subtilis.
Sun, Journal of bacteriology 2010 - GeneRIF: The phosphoenolpyruvate (PEP)-dependent phosphorylation by the histidine protein HPr via His15 plays an essential role in transcriptional activation of P(manP) and P(manR).
- Comparison of Bacillus subtilis transcriptome profiles from two separate missions to the International Space Station
Morrison, NPJ microgravity 2019 - “...2.52 2.61 1.17 1.10 Oligopeptide ABC transporter, inactive pseudogene in strain 168 CodY, ScoC, TnrA BSU12010 manP 2.38 2.67 1.38 1.47 PTS system-mannose-specific transporter subunit EIIBCA ManR, SigA BSU15960 sivC 2.89 3.06 2.67 2.71 Inhibitor of entry into sporulation via KinB or KinC AbrB, SigD BSU18000...”
CAC0234 PTS system, fructoso-specific IIBC component from Clostridium acetobutylicum ATCC 824
52% identity, 21% coverage
- Sugar uptake by the solventogenic clostridia
Mitchell, World journal of microbiology & biotechnology 2016 - “...fructose phosphotransferases were systematically deleted or inactivated confirmed that the PTS encoded by cacc0233 / cac0234 in C. acetobutylicum ATCC 824 is a fructose PTS, consistent with the fact that cac0232 encodes a putative 1-phosphofructokinase (Voigt et al. 2014 ). The same study implicated the PTS...”
- Transcriptional analysis of micronutrient zinc-associated response for enhanced carbohydrate utilization and earlier solventogenesis in Clostridium acetobutylicum
Wu, Scientific reports 2015 - “...Forward primer sequence (53) Reverse primer sequence (53) RNA-Seq Q-RT-PCR (Zinc/Control) 8h(0.001) 16h(0.001) 32h(0.001) 16h(0.0005) CAC0234 CAATGGCAGCAGGAATGGT TGGTATTGCGCCTTCTGTTATG 2.76 3.27 4.03 0.78 4.16 CAC0386 CAAACTTCCAGAAAGCGTACCA AACACCAAACCACCAGAAGAAAG 5.19 5.96 7.78 0.66 6.33 CAC0570 AAATGCTTGGAGACGGTTTTG AGTCCGCCTTCTGTTGTTATTG 3.62 4.93 4.98 0.53 3.82 CAC1353 GCACTTCCAGCTGCATGTTTAG TCCAAGAAGCATACCAGAAACCT 1.76 1.46 2.01 0.46...”
- DENSE: efficient and prior knowledge-driven discovery of phenotype-associated protein functional modules
Hendrix, BMC systems biology 2011 - “...is presented. Proteins involved in this cluster include E1 proteins (CAC0231), EII enzymes (CAC0233 and CAC0234), a transcriptional regulator involved in sugar metabolism (CAC0231), and fructose 1-phosphate kinase (CAC0232). The EII proteins and fructose 1-phosphate kinase are shown to interact with each protein in the cluster....”
- “...metabolism CAC3087 - Phosphoenolpyruvate-protein kinase (PTS system enzyme I) CAC0232 - 1-phosphofructokinase (fructose 1-phosphate kinase) CAC0234 - PTS system fructose-specific IIBC component Effectiveness of DENSE at Efficiently Detecting , -quasi-cliques In this section, we present several empirical results to demonstrate the effectiveness of our algorithm at...”
- Comparative genomic and transcriptomic analysis revealed genetic characteristics related to solvent formation and xylose utilization in Clostridium acetobutylicum EA 2018
Hu, BMC genomics 2011 - “...CA_P0141 566(T) 566(C) 189(I) 189(T) Periplasmic hydrogenase small subunit, dehydrogenase Substrate utilization related genes CEA_G0239 CAC0234 1072(T) 1072(C) 358(Stop codon) 358(Q) PTS system, fructoso-specific IIBC component CEA_G1333 CAC1319 5(T) 5(C) 2(I) 2(T) Glycerol uptake facilitator protein, GLPF CEA_G1472 CAC1456 974(T) 974(A) 325(M) 325(K) Sugar-binding periplasmic protein...”
- A proteomic and transcriptional view of acidogenic and solventogenic steady-state cells of Clostridium acetobutylicum in a chemostat culture
Janssen, Applied microbiology and biotechnology 2010 - “...4.7 4.8 G CAC0233 PTS system, IIA component 2.5 2.0 18.2 2.3 6.2 8.0 G,T CAC0234 PTS system, fructoso-specific IIBC component 2.2 2.1 8.1 3.0 3.9 2.9 G CAC0360 Transcriptional regulator 3.1 2.6 6.5 5.6 4.5 1.9 K CAC0407 PP2C phosphatase family 2.7 2.1 4.6 3.5...”
Csac_2439 PTS system, fructose subfamily, IIC subunit from Caldicellulosiruptor saccharolyticus DSM 8903
54% identity, 21% coverage
SE2228 PTS system fructose-specific II component from Staphylococcus epidermidis ATCC 12228
SERP2260 PTS system, fructose-specific IIABC components from Staphylococcus epidermidis RP62A
SERP_RS11135 fructose-specific PTS transporter subunit EIIC from Staphylococcus epidermidis RP62A
51% identity, 15% coverage
- Identification of antigenic components of Staphylococcus epidermidis expressed during human infection
Pourmand, Infection and immunity 2006 - “...Conserved hypothetical protein 26 2283238-2285302 SE2228 (105-646) SE2229 (1-141) Phosphotransferase system fructose-specific II component Mannose-6-phosphate...”
- Skin-to-blood pH shift triggers metabolome and proteome global remodelling in Staphylococcus epidermidis
Gonçalves, Frontiers in microbiology 2022 - “...Carbamate kinase SERP2352 arcC Delta-1-pyrroline-5-carboxylate dehydrogenase SERP2128 rocA Phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) Fructose-specific IIABC components SERP2260 Sucrose-specific IIBC components SERP1900/68 Glucose-specific EIICBA component SERP2114 ptsG 6-Phospho-beta-galactosidase SERP1789 lacG Tagatose 1,6-diphosphate aldolase SERP1792 lacD Membrane Transporters: Hemin, Iron and Mn Multidrug resistance efflux pump SERP1767 SepA Flotillin-like...”
- “...their translocation across the cell membrane. Four proteins from this system (PtsG, SERP1900, SERP1968 and SERP2260) specific for glucose, sucrose and fructose transport, and enzymes generating phosphoenolpyruvate from oxaloacetate (PckA) and pyruvate (PpdK and its regulator SERP2169) support the fuelling of glycolysis in the N77 condition....”
- The Vancomycin Resistance-Associated Regulatory System VraSR Modulates Biofilm Formation of Staphylococcus epidermidis in an ica-Dependent Manner
Wu, mSphere 2021 - “...genes such as serp2114 (phosphotransferase [PTS] glucose EIICBA component), serp2343 (PTS mannose transporter subunit IIA), serp2260 (fructose-specific IIABC components), and lacF (PTS lactose-specific phosphotransferase IIA component) ( Table2 ). TABLE2 Transcription levels of genes involved in antibiotic tolerance and biofilm formation of S. epidermidis vraSR Gene...”
- AI-2-dependent gene regulation in Staphylococcus epidermidis
Li, BMC microbiology 2008 - “...operon transcriptional repressor 0.37 6.03 SERP2100 Ribokinase 0.49 2.71 SERP2101 Ribose transport protein 0.42 3.14 SERP2260 PTS system, fructose-specific IIABC components 0.29 8.11 SERP2261 Mannose-6-phosphate isomerase 0.34 5.9 SERP2312 Malate:quinone oxidoreductase 2.64 0.33 Nucleotide metabolism SERP0067 Xanthine phosphoribosyltransferase 3.17 0.4 SERP0068 Xanthine permease 3.35 0.39 SERP0652...”
- The Vancomycin Resistance-Associated Regulatory System VraSR Modulates Biofilm Formation of Staphylococcus epidermidis in an ica-Dependent Manner
Wu, mSphere 2021 - “...mannose transporter subunit IIA 0.41 ND SERP_RS11515 NC_002976.3 (23899822390557) Dihydroxyacetone kinase subunit L 0.46 ND SERP_RS11135 NC_002976.3 (22894202291360) PTS system, fructose-specific IIABC components 0.27 ND SERP_RS09555 NC_002976.3 (19283961929985) PTS alpha-glucoside transporter subunit IIBC 0.17 ND lacF NC_002976.3 (18381491838463) PTS system lactose-specific phosphotransferase IIA component 0.40 ND...”
B5X54_RS01275 PTS fructose transporter subunit IIC from Caldicellulosiruptor bescii
52% identity, 21% coverage
- Gene targets for engineering osmotolerance in Caldicellulosiruptor bescii
Sander, Biotechnology for biofuels 2020 - “...NaCl B5X54_RS01265 1-Phosphofructokinase 4.2 0.8 4.5 B5X54_RS01270 PTS fructose transporter subunit IIA 4.5 0.7 4.5 B5X54_RS01275 PTS fructose transporter subunit IIBC 4.8 0.6 4.3 B5X54_RS01280 HPr family phosphocarrier protein 4.1 0.8 3.7 B5X54_RS01285 Phosphoenolpyruvate-protein phosphotransferase 4.5 0.6 4.0 B5X54_RS01290 Acetylesterase 2.4 0.4 2.7 B5X54_RS04520 Transposase 1.4...”
RSP_1788 PTS system, fructose-specificIIBC component from Rhodobacter sphaeroides 2.4.1
49% identity, 19% coverage
AZOBR_RS32335 fructose-specific PTS system (fructose 1-phosphate forming), EII-B'BC components (FruA) from Azospirillum brasilense Sp245
52% identity, 17% coverage
- mutant phenotype: Specific phenotype on fructose.
SXYL_00278 PTS fructose transporter subunit IIABC from Staphylococcus xylosus
49% identity, 15% coverage
- Transcriptomic analysis of Staphylococcus xylosus in the presence of nitrate and nitrite in meat reveals its response to nitrosative stress
Vermassen, Frontiers in microbiology 2014 - “...Phosphotransferase system (PTS) maltose-specific enzyme IICB component 2.3 SXYL_00253 PTS system, glucose-specific IIBC component 0.5 SXYL_00278 PTS system, fructose-specific IIABC components 3.4 SXYL_00626 PTS system arbutin-like IIBC component 1.5 SXYL_01351 malA Alpha-D-1,4-glucosidase 1.9 SXYL_01960 pgi Glucose-6-phosphate isomerase 2.2 SXYL_00426 fbp Fructose-1,6-bisphosphatase 1.8 SXYL_00039 iolJ Fructose-bisphosphate aldolase,...”
- “...a crucial role in redox metabolism (Kleijn et al., 2006 ). Four genes (SXYL_02255, SXYL_00253, SXYL_00278, SXYL_00626) encoding phosphotransferase systems (PTS) that catalyze the concomitant uptake and phosphorylation of carbohydrates were modulated (Table 1 ). The two genes paralogs (SXYL_02255, SXYL_00626) coding for a PTS for...”
Smlt2558 putative PTS system, fructose-specific IIBC component from Stenotrophomonas maltophilia K279a
46% identity, 20% coverage
LMOf2365_2305 PTS system, fructose-specific, IIABC component from Listeria monocytogenes str. 4b F2365
52% identity, 15% coverage
- Role of FruR transcriptional regulator in virulence of Listeria monocytogenes and identification of its regulon
Abdelhamed, PloS one 2022 - “...Genes with significantly changed expression in fruR strain. Locus Tag Protein name Fold changes Upregulated LMOf2365_2305 PTS fructose transporter subunit IIC (FruA) 8.30 LMOf2365_2306 1-phosphofructokinase (FruB) 9.35 LMOf2365_0272 hypothetical protein 1.56 LMOf2365_0568 tagatose 1,6-diphosphate aldolase 1.77 LMOf2365_0604 GntR family transcriptional regulator 1.73 LMOf2365_0588 Magnesium transporter CorA...”
- Transcriptomics of Listeria monocytogenes Treated With Olive Leaf Extract
Liu, Frontiers in microbiology 2021 - “...addition of OLE included the phosphotransferase transport system (PTS), with the expression of 4 genes (LMOf2365_2305, LMOf2365_2664, LMOf2365_2665, and LMOf2365_2762), being differentially regulated at the 3.5-h treatment period (Log 2 FC=5.71, 1.36, 1.47, and 1.13, respectively). At 24h post-treatment, 9 PTS-related genes (LMOf2365_0030, LMOf2365_0113, LMOf2365_0572, LMOf2365_0922,...”
Q8Y4U6 FruA protein from Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
lmo2335 highly similar to phosphotransferase system (PTS) fructose-specific enzyme IIABC component from Listeria monocytogenes EGD-e
52% identity, 15% coverage
- Proteomic dataset of Listeria monocytogenes exposed to sublethal concentrations of free and nanoencapsulated nisin
Pinilla, Data in brief 2022 - “...Nis / LNis Annotation not available Q8Y8C6 lmo0982 lmo0982 Nis / LNis Annotation not available Q8Y4U6 lmo2335 fruA Nis / LNis FruA protein; sugar transporter, phosphoenolpyruvate-dependent phosphotransferase system Q7AP82 lmo0685 lmo0685 Nis / LNis Flagellar motor protein MotA; with MotB forms the ion channels that couple...”
- DegU-mediated suppression of carbohydrate uptake in Listeria monocytogenes increases adaptation to oxidative stress
Chen, Applied and environmental microbiology 2023 (secret) - Listeria monocytogenes GshF contributes to oxidative stress tolerance via regulation of the phosphoenolpyruvate-carbohydrate phosphotransferase system
Chen, Microbiology spectrum 2023 - “...lmo2137 PTS fructose transporter subunit IIA lmo2259 3.02 Yes/up lmo2259 PTS beta-glucoside transporter subunit IIA lmo2335 5.14 Yes/down fruA PTS fructose transporter subunit IIABC lmo2373 1.30 Yes/up lmo2373 PTS beta-glucoside transporter subunit IIB lmo2649 5.48 Yes/down ulaA PTS system ascorbate transporter subunit IIC lmo2650 5.75 Yes/down...”
- Proteomic dataset of Listeria monocytogenes exposed to sublethal concentrations of free and nanoencapsulated nisin
Pinilla, Data in brief 2022 - “.../ LNis Annotation not available Q8Y8C6 lmo0982 lmo0982 Nis / LNis Annotation not available Q8Y4U6 lmo2335 fruA Nis / LNis FruA protein; sugar transporter, phosphoenolpyruvate-dependent phosphotransferase system Q7AP82 lmo0685 lmo0685 Nis / LNis Flagellar motor protein MotA; with MotB forms the ion channels that couple flagellar...”
- Virulence gene repression promotes Listeria monocytogenes systemic infection
Pombinho, Gut microbes 2020 (secret) - Comparative genomics and transcriptomics of lineages I, II, and III strains of Listeria monocytogenes
Hain, BMC genomics 2012 - “...transporting PTS systems ( lmo0021-lmo0024 , lmo0781-lmo0784 , lmo1997-lmo2002 ), two fructose specific systems ( lmo2335 and lmo2733 ), two galacitol specific systems ( lmo0503 , lmo0507 , lmo0508 and lmo2665-lmo2667 ), two beta-glucoside systems (the partial system lmo0373-lmo0374 and lmo0874-lmo0876 ), and two cellobiose specific...”
- Transcriptomic and phenotypic analyses identify coregulated, overlapping regulons among PrfA, CtsR, HrcA, and the alternative sigma factors sigmaB, sigmaC, sigmaH, and sigmaL in Listeria monocytogenes
Chaturongakul, Applied and environmental microbiology 2011 - “...lmo1849, lmo1993, lmo2040, lmo2159, lmo2161, lmo2163, lmo2193, lmo2335, lmo2557, lmo2597, and lmo2785) were not included. The number of B-dependent genes...”
- Pyruvate carboxylase plays a crucial role in carbon metabolism of extra- and intracellularly replicating Listeria monocytogenes
Schär, Journal of bacteriology 2010 - “...lmo2308 lmo2309 lmo2310 lmo2311 lmo2312 lmo2315 lmo2322 lmo2335 (fruA) lmo2336 (fruB) lmo2337 lmo2343 lmo2344 lmo2345 lmo2437d lmo2522 lmo2539 (glyA) lmo2590b...”
- “...glucose control are several genes with unknown functions, lmo2335 to lmo2337 (fruRAB), encoding a PTSFru; panBCD (lmo1900 to lmo1902), involved in panthotenate...”
LMOf6854_2394 PTS system, fructose-specific, IIABC component from Listeria monocytogenes str. 1/2a F6854
52% identity, 15% coverage
HWN72_20600 PTS fructose transporter subunit IIC from Novosphingobium sp. HR1a
48% identity, 19% coverage
- LuxR402 of Novosphingobium sp. HR1a regulates the correct configuration of cell envelopes
Segura, Frontiers in microbiology 2023 - “...with the wild-type. Gene_id Log 2 fold change Gene_description HWN72_20595 5.14 Carbohydrate porin OprB family HWN72_20600 4.94 PTS fructose transporter subunit EIIB/C HWN72_20605 4.28 1-phosphofructokinase ( pfkB ) HWN72_20610 2.94 Phosphoenolpyruvateprotein phosphotransferase 2 ( ptsP ) HWN72_14810 4.69 Hypothetical protein HWN72_14815 1.82 Polysaccharide biosynthesis tyrosine autokinase...”
- “...in the absence of a functional LuxR402, and through the decreased expression of the HWN72_20595, HWN72_20600 and HWN72_20605 , genes involved in sugar uptake and utilization, the mutant cells sensed a lack of nutrients, which in turn modified their cellular surfaces to aggregate and survive these...”
SGO_1113 PTS system, fructose specific IIABC components from Streptococcus gordonii str. Challis substr. CH1
44% identity, 18% coverage
- Transcriptome analysis of Streptococcus gordonii Challis DL1 indicates a role for the biofilm-associated fruRBA operon in response to Candida albicans
Jesionowski, Molecular oral microbiology 2016 - “...4.0 0.002 SGO_1111 Phosphotransferase system repressor fruR Energy metabolism/Biosynthesis and degradation of polysaccharides 3.4 0.002 SGO_1113 PTS system, fructose specific IIABC components fruA Regulatory functions/Other 3.4 0.001 SGO_0702 hypothetical protein Hypothetical 3.1 0.002 SGO_1109 aspartate carbamoyltransferase catalytic subunit pyrB Purines, pyrimidine, nucleosides, and nucleotides/Pyrimidine ribonucleotide biosynthesis...”
- “...Avg. Expression Potentially Up-regulated by Microarray analysis SGO_1111 fruR 6.5 1.98 SGO_1112 fruB 9.05 0.64 SGO_1113 fruA 3.75 0.92 SGO_0701 hup 0.95 0.21 SGO_0702 Hypothetical 1.95 0.35 Potentially Down-regulated by Microarray analysis SGO_1593 arcA 0.6 0.28 SGO_1592 arcB 0.6 0.28 SGO_1757 glmS 0.5 0.14 a Values...”
XOO2812 PTS system, fructose-specific IIBC component from Xanthomonas oryzae pv. oryzae KACC10331
49% identity, 17% coverage
- Time-resolved pathogenic gene expression analysis of the plant pathogen Xanthomonas oryzae pv. oryzae
Kim, BMC genomics 2016 - “...Xoo2810 encoding the multi-phosphoryl transfer protein), fruK ( Xoo2811 encoding the 1-phosphofructokinase), and fruA ( Xoo2812 encoding the PTS fructose-specific transporter subunit IIBC); all of which were upregulated at 5min (Fig. 5a ). In the same operon, rpfN ( Xoo2813 ), a regulator of pathogenicity factors...”
- “...and single-gene knockout mutants of oprO ( Xoo1104 ), hrpX ( Xoo1380 ), fruA ( Xoo2812 ), fliC ( Xoo2581 ) and gumC ( Xoo3178 ). hrpX ( Xoo1380 ) was essential for Xoo pathogenicity (Fig. 6 ). In different Xoo strains of KACC10859, the mutants...”
AMD14_RS13175 PTS fructose transporter subunit IIC from Xanthomonas citri pv. citri
XAC2503 PTS system, fructose-specific IIBC component from Xanthomonas axonopodis pv. citri str. 306
49% identity, 17% coverage
- The Role of ClpV in the Physiology and Pathogenicity of <i>Xanthomonas citri</i> subsp. <i>citri</i> Strain zlm1908
Li, Microorganisms 2024 - “...to the RNA-seq results, the top 10 significantly upregulated genes were hslV , AMD14_RS15995, AMD14_RS09150, AMD14_RS13175, bfr , metH , msrB , AMD14_RS13675, AMD14_RS14885, and AMD14_RS02230. Conversely, the top 10 significantly downregulated genes were AMD14_RS24660, AMD14_RS04820, mreD , AMD14_RS14990, fliN , flgH , AMD14_RS13515, AMD14_RS00135, AMD14_RS12895,...”
- Diffusible signal factor (DSF)-mediated quorum sensing modulates expression of diverse traits in Xanthomonas citri and responses of citrus plants to promote disease
Li, BMC genomics 2019 - “...HmsH protein /substrate-specific transmembrane transporter XAC2501 fruB 1.73 multiphosphoryl transfer protein XAC2502 fruK 1.68 1-phosphofructokinase XAC2503 fruA 1.79 PTS system fructose-specific transporter subunit II XAC3474 cit1 1.08 citrate carrier protein XAC3487 cebR 2.20 transcriptional regulator XAC3489 fyuA 1.49 TonB-dependent sucrose outer membrane transporter XAC3490 1.22 amylosucrase...”
SBI_04453 fructose-specific PTS transporter subunit EIIC from Streptomyces bingchenggensis BCW-1
47% identity, 15% coverage
Teth39_0334 PTS system, fructose-specific, IIB subunnit from Thermoanaerobacter ethanolicus ATCC 33223
47% identity, 65% coverage
P23387 PTS system fructose-specific EIIB'BC component from Rhodobacter capsulatus
51% identity, 17% coverage
USA300HOU_2641 possible PTS family fructose/mannitol (fru) porter component IIABC from Staphylococcus aureus subsp. aureus USA300_TCH1516
49% identity, 15% coverage
SA2434 hypothetical protein from Staphylococcus aureus subsp. aureus N315
49% identity, 15% coverage
- Exposure of clinical MRSA heterogeneous strains to β-lactams redirects metabolism to optimize energy production through the TCA cycle
Keaton, PloS one 2013 - “...system (PTS) SA2320 glcA 4.6 PTS system glucose-specific EIICBA component Phosphotransferase transport system (PTS, glucose-specific). SA2434 4.2 PTS system EIIBC component Putative phosphotransferase transport system (PTS), EIIBC component. SA0186 ptsG 4 PTS system glucoside-specific IICBA component Phosphotransferase transport system (PTS), glucoside specific. SA0325 glpT 2.7 glycerol-3-phosphate...”
- “...mannose specific PTS (SA2527), glucose specific PTS ( glcA , SA0183), putative fructose specific PTS (SA2434), glucoside specific PTS ( ptsG , SA2326) and glucose specific PTS (SA1566). A group of hypothetical proteins predicted to be related to carbohydrate metabolism were downregulated during HeR/HoR selection, including...”
- Global transcriptome analysis of Staphylococcus aureus biofilms in response to innate immune cells
Scherr, Infection and immunity 2013 - “...SA2173 SA1339 SA1038 SA2007 SA0671 SA1576 SA2434 SA1941 Glucosamine-6-phosphate isomerase, putative Phytoene dehydrogenase CBS domain protein Pyridine...”
- Effect of a glucose impulse on the CcpA regulon in Staphylococcus aureus
Seidl, BMC microbiology 2009 - “...*SA2295 NWNM_2403 gntR gluconate operon transcriptional repressor 1.5 3.2 SA2321 NWMN_2432 hypothetical protein 0.1 2.5 SA2434 NWNM_2540 PTS system, fructose-specific IIABC component 1.2 0.4 SA2435 NWNM_2541 pmi mannose-6-phosphate isomerase 1.2 0.4 1 Genes with parallel glucose-mediated regulation in wild-type and mutant but with different ratios, genes...”
- “...PTS system, mannitol specific IIBC component 6.4 0.2 *SA2293 NWNM_2401 gntP gluconate permease 0.7 2.5 SA2434 NWNM_2540 PTS system, fructose-specific IIABC component 1.2 0.4 a Cellular main roles are in accordance with the N315 annotation of the DOGAN website [ 26 ] and/or the KEGG website...”
- Transcriptome and functional analysis of the eukaryotic-type serine/threonine kinase PknB in Staphylococcus aureus
Donat, Journal of bacteriology 2009 - “...SA2079 SA2132 SA2143 SA2200 SA2202 SA2253 SA2302 SA2434 vraF vraG oppB oppD oppF oppA mtlF fhuD2 Change (fold)a Xanthine phosphoribosyltransferase...”
- Reporter metabolite analysis of transcriptional profiles of a Staphylococcus aureus strain with normal phenotype and its isogenic hemB mutant displaying the small-colony-variant phenotype
Seggewiss, Journal of bacteriology 2006 - “...0.00 0.01 2.19 0.38 2.04 SA0531 SA0417 SA0655 SA0374 SA2053 SA2434 0.01 0.01 0.01 0.01 0.01 0.02 2.20 2.15 2.25 0.39 2.06 2.31 a b Description PTS enzyme II,...”
- Global regulation of Staphylococcus aureus genes by Rot
Saïd-Salim, Journal of bacteriology 2003 - “...2612 2860 2926 3017 3078 3373 3768 SA2218 SA1437 SA2434 SA1725 SA1093 SA0989 SA0663 SA0127 SA0165 SA0904 SA0850 4061 4069 4530 5131 SA1007 SA0123 SA0710 SA2297...”
SACOL2663 PTS system, fructose-specific IIABC components from Staphylococcus aureus subsp. aureus COL
NWMN_2540 PTS system, fructose-specific IIABC component from Staphylococcus aureus subsp. aureus str. Newman
49% identity, 15% coverage
- Virulence and Metabolism
Richardson, Microbiology spectrum 2019 (secret) - Changes in the Staphylococcus aureus transcriptome during early adaptation to the lung
Chaffin, PloS one 2012 - “...in vitro conditions. Trehalose, glycerol-3-phosphate, fructose and ascorbate-specific transport systems ( treP , glpT , SACOL2663 and ulaA ) had up to 47.0 fold lower transcription in vivo. Genes with high expression in in vitro but lowest expression in vivo also included SACOL-2521, a protein, similar...”
- “...systems. These included the glucose-specific PTS IIABC transporter component ptsG , fructose/(mannose)-specific PTS IIABC component SACOL2663, maltose/maltodextrin ABC permease malK and glycerol-3-phosphate transporter gene, glpT . Also upregulated were the phosphate transporter ptsS , sodium:solute symporter family gene SACOL0311 and putative transport gene SACOL2521. Like the...”
- A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome
Becher, PloS one 2009 - “...(Gpm), SACOL1320 (GlpK), SACOL1319 (GlpF), SACOL0200, SACOL0407 (GlpT)], or consumption of alternative sugars [SACOL1393 (GlcT), SACOL2663, SACOL0516, SACOL0178, SACOL0224, SACOL2316]. Of the proteins down-regulated in stationary phase numerous could be assigned to the category of iron uptake facilitation [SACOL2010, SACOL2277, SACOL2167, SACOL0799, SACOL0099 (SirA), SACOL0704] or...”
- A defect in menadione biosynthesis induces global changes in gene expression in Staphylococcus aureus
Kohler, Journal of bacteriology 2008 - “...of trehalose (SACOL0516), mannitol (SACOL2146), and fructose (SACOL2663) and also of glucose (ptsI, SACOL0175, SACOL2552) (see Table S2 in the supplemental...”
- Inactivation of the Ecs ABC transporter of Staphylococcus aureus attenuates virulence by altering composition and function of bacterial wall
Jonsson, PloS one 2010 - “...permease 4.5 NWMN_2458 cation transporter E1-E2 family ATPase 1.8 2.6 NWMN_2521 permease domain-containing protein 2.0 NWMN_2540 PTS system fructose-specific IIABC component 0.5 NWMN_2592 sodium sulfate symporter 1.8 NWMN_2593 RarD protein 3.5 opp1F peptide ABC transporter ATP-binding protein 2.2 opuCD amino acid ABC transporter permease protein 2.0...”
KQ76_13845, RDJ18_RS14335 fructose-specific PTS transporter subunit EIIC from Staphylococcus aureus
SAR2720 putative PTS transport system, IIABC component from Staphylococcus aureus subsp. aureus MRSA252
49% identity, 15% coverage
- Multiomics analysis of Staphylococcus aureus ST239 strains resistant to virulent Herelleviridae phages
Kornienko, Scientific reports 2024 - “...fructose into the cell at both early and late stages (RDJ18_RS00835, RDJ18_RS01075, RDJ18_RS01200, RDJ18_RS03920, RDJ18_RS13495, RDJ18_RS14335) (Table S4 ). The key genes encoding enzymes involved in glycolysis exhibited upregulation: pyruvate kinase (RDJ18_RS06570), L-lactate dehydrogenase (RDJ18_RS01065), phosphoglycerate kinase (RDJ18_RS04310), triose-phosphate isomerase (RDJ18_RS04315), and 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (RDJ18_RS04320)....”
- Unveiling Co-Infection in Cystic Fibrosis Airways: Transcriptomic Analysis of Pseudomonas aeruginosa and Staphylococcus aureus Dual-Species Biofilms
Magalhães, Frontiers in genetics 2022 - “...transport and metabolism 118.54 8.20E-04 KQ76_13345 Membrane protein [R] General functional prediction only 95.65 1.08E-02 KQ76_13845 PTS mannose transporter subunit IIABC [G] Carbohydrate transport and metabolism 78.44 0.00 KQ76_11410 6-Phospho-beta-galactosidase [G] Carbohydrate transport and metabolism 48.05 6.29E-09 KQ76_13300 Hypothetical protein [S] Function unknown 45.09 8.44E-12 KQ76_13275...”
- The Staphylococcus aureus response to unsaturated long chain free fatty acids: survival mechanisms and virulence implications
Kenny, PloS one 2009 - “...tagatose-bisphosphate aldolase 3.13 6.59E-03 SAR2262 putative uridylyltransferase 2.27 8.35E-03 SAR2579 gtaB putative uridylyltransferase 2.63 6.84E-03 SAR2720 putative PTS system component 4.17 3.54E-03 SAR2721 pmi mannose-6-phosphate isomerase 3.57 2.76E-03 Cell Wall Synthesis SAR0228 putative glutamine amidotransferase class-I 2.13 2.08E-03 SAR0257 lytS autolysin sensor kinase protein 3.33 3.00E-03...”
- “...and phosphorylation of glucose, mannose, maltose and galactitol, namely SAR0235 , SAR1777 ( pfkA ), SAR2720 , SAR2721 ( pmi ), SAR0242 and SAR0263 were also down-regulated. This could indicate an alteration of central metabolism via the action of the linoleic acid. Here, in concert with...”
RSAU_002484 fructose-specific PTS transporter subunit EIIC from Staphylococcus aureus subsp. aureus 6850
49% identity, 15% coverage
SAS2527 putative PTS transport system, IIABC component from Staphylococcus aureus subsp. aureus MSSA476
49% identity, 15% coverage
PTFBC_XANCP / P23355 PTS system fructose-specific EIIB'BC component; EIIB'BC-Fru; EC 2.7.1.202 from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see 2 papers)
44% identity, 20% coverage
- function: The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. The enzyme II FruAB PTS system is involved in fructose transport.
catalytic activity: D-fructose(out) + N(pros)-phospho-L-histidyl-[protein] = D- fructose 1-phosphate(in) + L-histidyl-[protein] (RHEA:49252)
disruption phenotype: Cells lacking this gene grow normally on glucose but are unable to grow on fructose. - Changes in variation at the MHC class II DQA locus during the final demise of the woolly mammoth.
Pečnerová, Scientific reports 2016 - “...000 49 000 Tusk Chukotka L272 LU-5159 47 400 47 400 Tusk Chukotka L155 OxA-20038 (P23355) 47 700750 47 772 Tooth Chukotka L156 OxA-20039 (P23356) 46 350650 49 466 Femur Chukotka M2 Ua-13365 >38 000 >38 000 Tooth Wrangel* L163 OxA-20047 (P23363) 26 180110 30 525...”
- Cloning, sequencing, and characterization of genomic subtracted sequences from Listeria monocytogenes
Wu, Applied and environmental microbiology 1999 - “...E. coli (accession no. P20966), Xanthomonas campestris (P23355), Rhodobacter capsulatus (P23387), and Bacillus amyloliquefaciens (P41029). (B) Alignment of the...”
AO356_07325 fructose phosphotransferase system, IIB/IIC components (EC 2.7.1.202) from Pseudomonas fluorescens FW300-N2C3
45% identity, 18% coverage
- mutant phenotype: Specific phenotype: utilization of D-Fructose
F5VVS9 PTS system protein fructose-specific EIIABC component from Streptococcus oralis SK255
48% identity, 15% coverage
TC 4.A.2.1.20 / Q3K0G6 Chromosomal fructose Enzyme IIABC (Fru1) of 654 aas; in an operon with fructose-1-P kinase from Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
SAK_1377 PTS system, fructose-specific IIABC component from Streptococcus agalactiae A909
53% identity, 14% coverage
- substrates: fructose
- The Role of Regulator Catabolite Control Protein A (CcpA) in Streptococcus agalactiae Physiology and Stress Response
Roux, Microbiology spectrum 2022 - “..., galactitol PTS, IIA, IIC, and IIB subunits; SAK_0915 , PTS system, -glucoside-specific IIABC component; SAK_1377 , PTS system, fructose-specific IIABC component; SAK_1702 , PTS system, sucrose-specific IIABC component; SAK_1893-1895 , PTS system, glucose-specific IIABC component; SAK_1908-1911 , mannose/fructose/sorbose PTS, IID, IIC, IIB, and IIA subunits,...”
- A Vaginal Tract Signal Detected by the Group B Streptococcus SaeRS System Elicits Transcriptomic Changes and Enhances Murine Colonization
Cook, Infection and immunity 2018 - “...sak_0524 sak_0525 sak_0526 sak_0528 sak_0529 sak_0530 sak_1377 sak_1702 sak_1759 sak_1825 sak_1833 sak_1834 sak_1835 sak_1893 sak_1894 sak_1895 sak_1908...”
- “...sak_0594 sak_0981 sak_0982 sak_0980 sak_0983 sak_0985 sak_1377 sak_1759 sak_1911 sak_1910 sak_1909 sak_1908 sak_1751 sak_0666 Two-component systems sak_0467...”
OG1RF_10454 fructose-specific PTS transporter subunit EIIC from Enterococcus faecalis OG1RF
EF0717 PTS system, fructose-specific family, IIABC components from Enterococcus faecalis V583
43% identity, 19% coverage
- Global Regulation of Gene Expression by the MafR Protein of Enterococcus faecalis
Ruiz-Cruz, Frontiers in microbiology 2015 - “...2 FC of mutant strain versus wild-type strain was about 4). The latter genes were OG1RF_10454 ( fruA , PTS family fructose porter, IIABC component), OG1RF_10455 ( fruk2 , 1-phosphofructokinase), and OG1RF_10456 ( lacR , lactose PTS family porter repressor), which constitute an operon ( lacR-fruk2-fruA...”
- The Intraperitoneal Transcriptome of the Opportunistic Pathogen Enterococcus faecalis in Mice
Muller, PloS one 2015 - “...(EF0709 and EF0710, respectively) are significantly downregulated (-4.9-fold) as well as a fructose specific PTS (EF0717; -15.7-fold) ( S4 Table and Fig 2 ). This suggests that PTS sugars may be scarce in the mouse peritoneum, a conclusion supported by the fact that expression of only...”
- The transcriptome of the nosocomial pathogen Enterococcus faecalis V583 reveals adaptive responses to growth in blood
Vebø, PloS one 2009 - “...during growth in blood and mannitol (EF0411-12) during growth in YTB. The fructose PTS system (EF0717), was up-regulated in blood, but down-regulated in YTB. The PTS mannose/fructose/sorbose (EF3029) showed a reduced expression during growth in both blood and YTB. The observed changes in substrate utilization and...”
- Survey of genomic diversity among Enterococcus faecalis strains by microarray-based comparative genomic hybridization
Aakra, Applied and environmental microbiology 2007 - “...carbohydrates ORF (gene) EF1131 (araD) EF1159 EF1160 EF0694 EF0717 EF1167 (fba) EF1504 EF1834 (lacB) EF1835 (lacA) EF1416 (pgi) EF1129 EF1928 EF1929 (glpK)...”
- Transcriptional response of Enterococcus faecalis V583 to erythromycin
Aakra, Antimicrobial agents and chemotherapy 2005 - “...EF1645 EF2066 EF2259 EF2653 EF2852 EF3272 EF0021 EF0022 EF0717 EF0958 EF1051 EF1261 EF1516 EF2978 EF2979 EF0846 EF1170 EF3214 EF0188 EF0636 EF0744 EF0760 EF0789...”
SP_0877 fructose-specific PTS transporter subunit EIIC from Streptococcus pneumoniae TIGR4
47% identity, 15% coverage
- A Nonadjuvanted Whole-Inactivated Pneumococcal Vaccine Induces Multiserotype Opsonophagocytic Responses Mediated by Noncapsule-Specific Antibodies
David, mBio 2022 - “...20,514.81,842.74 5,411.27557.36 1.923 SP_0629 VanY domain-containing protein 17,791.131,923.57 11,916.271,183.09 0.578 SP_0845 Lipoprotein 17,436.81,509.69 18,895.932,571.16 0.116 SP_0877 fruA PTS system, fructose specific IIABC components 16,762.471,323.25 12,392.272,455.32 0.436 SP_1368 psr Psr protein 16,422.132,437.2 20,221.273,117.34 0.300 SP_0730 spxB Pyruvate oxidase 15,773.81,840.67 3,601.27212.76 2.131 SP_1872 piuA Iron-compound ABC transporter, iron-compound-binding...”
- Polyamine Synthesis Effects Capsule Expression by Reduction of Precursors in Streptococcus pneumoniae
Ayoola, Frontiers in microbiology 2019 - “...Choline binding protein I 1.5 pcpA SP_2136 Choline binding protein PcpA 2.3 Carbon utilization pathways SP_0877 SP_0877 PTS system, fructose-specific IIABC components 2.6 SP_0645 SP_0645 Putative PTS system, IIA component 3.1 SP_0646 SP_0646 Putative PTS system, IIB component 2.6 SP_0647 SP_0647 Putative PTS system, IIC component...”
- “...in metabolic pathways catalyzing the conversion of galactose ( SP_0645-7 , lacDCBA ), fructose ( SP_0877 ), fucose ( fucA , SP_2167 ), and GlcNAc1P ( nagA , nagB ) to G3P with concomitant higher expression of transketolase C and N subunits ( tktC , tktN...”
- ManLMN is a glucose transporter and central metabolic regulator in Streptococcus pneumoniae
Fleming, Molecular microbiology 2016 - “...transporter (SP_0061-3; PTS) and one predicted fructose transporter (SP_0877; PTS), encoded in the TIGR4 genome. There is only one predicted lactose transporter...”
- “...(SP_0061-3), the lac PTS (SP_1185-6) and the fru PTS (SP_0877). In contrast to the manLMN deletion strain, inactivation of the GlcNAc/gal, lac or fru PTS had no...”
SPD_0773 PTS system, fructose specific IIABC components from Streptococcus pneumoniae D39
47% identity, 15% coverage
- Glutamate Dehydrogenase (GdhA) of Streptococcus pneumoniae Is Required for High Temperature Adaptation
Gazioglu, Infection and immunity 2021 (secret) - Arachidonic Acid Stress Impacts Pneumococcal Fatty Acid Homeostasis
Eijkelkamp, Frontiers in microbiology 2018 - “...fructose phosphotransferase system (PTS) repressor (SPD_0771), phosphofructokinase (SPD_0772) and fructose PTS system enzyme II ABC (SPD_0773), was significantly upregulated (Table S2 ), corroborating previous studies of YycFG (Ng et al., 2003 ). Transcription of the yycF and yycG genes increased by 1.3- and 1.2-fold upon AA...”
- Panproteome-wide analysis of antibody responses to whole cell pneumococcal vaccination
Campo, eLife 2018 - “...0.039 (0.0850.071) 0.615 (0.1171.452) 0.283 (0.2310.730) 1.986 (1.4542.437) Both FruA Fructose PTS transporter protein FruA SPD_0773 1.044 (0.5681.389) 0.029 (0.125 - 0.002) 0.480 (0.1180.817) 0.335 (0.3220.360) 0.591 (0.4060.770) Linear mixed effects GalT Galactose-1-phosphate uridylyltransferase GalT SPD_1633 0.295 (0.2110.494) 0.024 (0.0550.047) 0.110 (0.220 - 0.034) 0.068 (0.0820.012)...”
- Autoinducer 2 Signaling via the Phosphotransferase FruA Drives Galactose Utilization by Streptococcus pneumoniae, Resulting in Hypervirulence
Trappetti, mBio 2017 - “...SPD_0771 lacR1 Lactose phosphotransferase system repressor 1.9 0.3 0.6 SPD_0772 fruB 1-Phosphofructokinase 1.9 0.3 0.5 SPD_0773 fruA PTS, fructose-specific IIABC components 1.7 0.4 0.7 c SPD_0900 asd Aspartate-semialdehyde dehydrogenase 1.6 SPD_0901 dapA Dihydrodipicolinate synthase 1.6 SDP_1004 gapN Glyceraldehyde-3-phosphate dehydrogenase 0.6 SPD_1256 Peptidase, U32 family protein 0.6...”
- Ascorbic acid-dependent gene expression in Streptococcus pneumoniae and the activator function of the transcriptional regulator UlaR2
Afzal, Frontiers in microbiology 2015 - “...protein, IID component 2.2 spd_0502 PTS system, beta-glucosides-specific IIABC components 2.3 spd_0503 6-Phospho-beta-glucosidase, BglA-2 2.9 spd_0773 PTS system, fructose specific IIABC components 2.4 spd_0888 Adhesion lipoprotein, AdcAII/LmB 3.2 spd_0889 Pneumococcal histidine triad protein D, PhtD 3.6 spd_0890 Pneumococcal histidine triad protein E, PhtE 4.4 spd_1038 Pneumococcal...”
- Transcriptional and metabolic effects of glucose on Streptococcus pneumoniae sugar metabolism
Paixão, Frontiers in microbiology 2015 - “...1.21 SPD_0561 PTS system, IIC component, putative 1.55 SPD_0661 exp5 PTS system, IIABC components 0.61 SPD_0773 PTS system, fructose specific IIABC components 0.36 SPD_1039 ptsI Phosphoenolpyruvate-protein phosphotransferase 0.49 SPD_1040 ptsH Phosphocarrier protein HPr 0.56 SPD_1047 lacE-2 PTS system, lactose-specific IIBC components 0.78 SPD_1057 PTS system, IIB...”
spr0780 Fructose specific-phosphotransferase system IIBC component from Streptococcus pneumoniae R6
47% identity, 15% coverage
llmg_1568 PTS system, fructose specific IIBC components from Lactococcus lactis subsp. cremoris MG1363
51% identity, 15% coverage
- Further Elucidation of Galactose Utilization in Lactococcus lactis MG1363
Solopova, Frontiers in microbiology 2018 - “...llmg_0446 msmK 22.3 16.1 Multiple sugar-binding transport ATP-binding protein llmg_1569 fruC 4.5 1.1 Tagatose-6-phosphate kinase llmg_1568 fruA 3.8 1.3 PTS system, fructose specific IIBC components llmg_1570 fruR 3.1 1.3 Fructose operon transcriptional repressor Column Growth phase I shows fold upregulation of genes in cells harvested during...”
- Towards enhanced galactose utilization by Lactococcus lactis
Neves, Applied and environmental microbiology 2010 - “...llmg_0867 llmg_0963 llmg_1045 (ptbA) llmg_1244 llmg_1426 (yleD) llmg_1568 (fruA) llmg_pseudo54 (yidB) Familya VOL. 76, 2010 GALACTOSE METABOLISM IN L. LACTIS...”
ACIAD1993 phosphotransferase system, fructose-specific IIBC component from Acinetobacter sp. ADP1
45% identity, 20% coverage
SSA_1082 PTS system, fructose specific II ABC components, putative from Streptococcus sanguinis SK36
42% identity, 18% coverage
tagL / A0A415J7H7 tagatose-specific PTS enzyme IIBC component from Bacillus licheniformis (see 2 papers)
TC 4.A.2.1.23 / T5HN74 PTS fructose transporter subunit IIC, component of The tagatose-1-P-forming tagatose phosphorylating Enzyme IIA/IIBC, TagM/L (Van der Heiden et al. 2015). The product is phosphorylated by tagatose-1-P kinase (TagK), and then cleaved by tagatose-1,6-bisphosphate aldolase (GatY) from Bacillus licheniformis CG-B52
43% identity, 26% coverage
EHLA_0331 PTS fructose transporter subunit IIABC from Anaerobutyricum hallii
47% identity, 14% coverage
CD630_22690 PTS fructose transporter subunit IIABC from Clostridioides difficile 630
CD2269 PTS system, IIbc component from Clostridium difficile 630
45% identity, 15% coverage
- The repertoire of ABC proteins in Clostridioides difficile
Pipatthana, Computational and structural biotechnology journal 2021 - “...motif and are not associated with transport activity [2] . Eleven proteins (cd630_03880, cd630_04690, cd630_08160, cd630_22690, cd630_30750, cd630_30860, cd630_30970, cd630_31160, cd630_31250, cd630_31340, and cd630_31370) annotated as phosphoryl transfer protein subunit IIABC were also omitted from further analyses. Although the phosphotransferase system (PTS) is involved in the...”
- The Clostridium difficile Protease Cwp84 Modulates both Biofilm Formation and Cell-Surface Properties
Pantaléon, PloS one 2015 - “...system, sugar-family CD630_08770 ABC-type transport system, sugar-family CD630_11840 FabF CD630_14790 FeoB1 CD630_14840 SsuA CD630_18220 Bcp CD630_22690 FruABC CD630_23880 Putative peptidoglycan-binding/hydrolysing CD630_26670 PtsG-BC CD630_27350 Cwp14 CD630_27840 Cwp6 CD630_27860 Cwp5 CD630_27980 Cwp9 CD630_28010 Conserved hypothetical protein CD630_30300 PTS system, glucose-like IIBC component CD630_31920 Cwp21 CD630_32840 Serine protease, HrtA...”
- Increased sporulation underpins adaptation of Clostridium difficile strain 630 to a biologically-relevant faecal environment, with implications for pathogenicity
Ternan, Scientific reports 2018 - “...of the sorbitol specific IIB component, srlEa , (CD0765) was increased as was expression of CD2269 encoding the fructose specific IIABC component, fruABC , as were genes encoding the IIA and IIB components of the glucose PTS transport system (CD2512, CD2510, respectively). Expression of the IIC...”
- Pleiotropic role of the RNA chaperone protein Hfq in the human pathogen Clostridium difficile
Boudry, Journal of bacteriology 2014 - “...Hfq-depleted strain while genes encoding a fructose PTS (CD2269) were upregulated. The principal source of energy in C. difficile comes from carbohydrate and...”
Q8DWE7 protein-Npi-phosphohistidine-D-fructose phosphotransferase (subunit 2/2) (EC 2.7.1.202) from Streptococcus mutans serotype c (see paper)
TC 4.A.2.1.8 / Q8DWE7 Putative PTS system, fructose-specific IIBC component aka FruC, component of The constitutive fructose porter FruC/FruD from Streptococcus mutans (see paper)
SMU_114 PTS fructose transporter subunit IIC from Streptococcus mutans UA159
43% identity, 27% coverage
- substrates: fructose
- Modification of the Streptococcus mutans transcriptome by LrgAB and environmental stressors
Rice, Microbial genomics 2017 - “...putative 67-kDa myosin-cross reactive streptococcal antigen-like protein), SMU_2133c (encoding a membrane protein of unknown function), SMU_114 (fructose permease), SMU_1400c (uncharacterized protein), SMU_1596 (PtcC permease subunit), SMU_1599 (CelR transcriptional regulator) and SMU_1927 (ABC transporter gene). Interestingly, expression of the pdh operon was highly expressed in a subpopulation...”
VPAR_RS08070 fructose-specific PTS transporter subunit EIIC from Veillonella parvula DSM 2008
42% identity, 18% coverage
WU75_14960 PTS fructose transporter subunit IIBC from Vibrio parahaemolyticus
57% identity, 13% coverage
- Identification of Antibacterial Components and Modes in the Methanol-Phase Extract from a Herbal Plant Potentilla kleiniana Wight et Arn
Tang, Foods (Basel, Switzerland) 2023 - “...V. parahaemolyticus ATCC17802 treatment group ( p < 0.05). Of these, the DEGs ( fruA, WU75_14960 ; ulaA, WU75_00450 ), encoding a PTS fructose transporter subunit IIBC and a PTS beta-glucoside transporter subunit IIBC, respectively, were highly up-regulated (5.096-fold and 6.946-fold) ( p < 0.05). In...”
- “...4.118 PTS system mannitol-specific Transporter subunit IIA WU75_01640 cmtB 4.539 PTS mannitol transporter subunit IIA WU75_14960 fruA 5.096 PTS fructose transporter subunit IIBC WU75_00450 ulaA 6.946 PTS beta-glucoside transporter subunit IIBC Butanoate metabolism WU75_01985 acsA 0.334 Acetoacetyl-CoA synthetase WU75_10825 phaC 0.336 Poly(3-hydroxyalkanoate) synthetase Lysine degradation WU75_21960...”
BC3718 PTS system, fructose-specific IIABC component from Bacillus cereus ATCC 14579
48% identity, 15% coverage
VPA0811 PTS system, fructose-specific IIBC component from Vibrio parahaemolyticus RIMD 2210633
57% identity, 13% coverage
CAETHG_0142, CLJU_RS10110, CLJU_c20590 PTS fructose transporter subunit IIABC from Clostridium ljungdahlii DSM 13528
41% identity, 19% coverage
- Interactive Regulation of Formate Dehydrogenase during CO2 Fixation in Gas-Fermenting Bacteria
Zhang, mBio 2020 - “...mutations at acetylated lysine sites on CcpA DNA-binding activity. Binding to the promoter of the CLJU_c20590 gene was determined by EMSA. Download FIGS5, TIF file, 1.6 MB . Copyright 2020 Zhang et al. 2020 Zhang et al. This content is distributed under the terms of the...”
- “...485-bp DNA fragment covering the promoter region (which contains a CcpA-binding cre site) of the CLJU_c20590 gene was obtained by PCR amplification and then used as the DNA probe in EMSA ( Fig.3C ). As shown in Fig.3D , compared to the original CcpA, CcpA Dat...”
- Transcriptomic profiles of Clostridium ljungdahlii during lithotrophic growth with syngas or H2 and CO2 compared to organotrophic growth with fructose
Aklujkar, Scientific reports 2017 - “...to organotrophic growth on fructose encode the fructose transport phosphotransferase system-specific membrane protein ( fruA CLJU_RS10110), the enzyme fructose-1-phosphate 6-kinase ( fruK CLJU_RS10115) that is only required for utilization of exogenous fructose (Fig. 5 ), and the fructose-1-phosphate-responsive transcriptional regulator ( fruR CLJU_RS10120, Supplementary Table S2...”
- Comparison of single-molecule sequencing and hybrid approaches for finishing the genome of Clostridium autoethanogenum and analysis of CRISPR systems in industrial relevant Clostridia
Brown, Biotechnology for biofuels 2014 - “...2062, 2479, T 7 Fumarate reductase CAETHG_0344, 1032, 2961. Glycolysis/Gluconeogenesis. PTS Fructose phosphotransferase system (PTS) CAETHG_0142, 0676-73, G 1 Fructokinase (Fk) /Fructose-6-phosphate isomerase CAETHG_0166, 0156, G 2 1-phosphofructokinase (Pfk1) CAETHG_0143, G 3 6-phosphofructokinase (Pfk6) CAETHG_648, 2439, G 4 Fructose bisphosphate aldolase (Aldo) CAETHG_2382, G 5 Triose-phosphate...”
- Clostridium ljungdahlii represents a microbial production platform based on syngas
Köpke, Proceedings of the National Academy of Sciences of the United States of America 2010 - “...mannitol-specific phosphotransferase (PTS) systems (encoded by CLJU_c20590 and CLJU_c26050-70) and can be further converted by 1-phosphofructokinase (encoded by...”
AB6M95_07020 PTS fructose-like transporter subunit IIB from Pseudodesulfovibrio karagichevae
41% identity, 19% coverage
EF0694 PTS system, fructose-specific family, IIBC components from Enterococcus faecalis V583
EF_0694 PTS fructose transporter subunit IIC from Enterococcus faecalis V583
47% identity, 21% coverage
X276_17630 fructose-specific PTS transporter subunit EIIC from Clostridium beijerinckii NRRL B-598
42% identity, 18% coverage
Cbei_1844 PTS system, fructose subfamily, IIC subunit from Clostridium beijerincki NCIMB 8052
42% identity, 18% coverage
LBCZ_2402 PTS fructose transporter subunit IIC from Lacticaseibacillus casei DSM 20011 = JCM 1134 = ATCC 393
45% identity, 20% coverage
- Genomic adaptation of the Lactobacillus casei group
Toh, PloS one 2013 - “...LBCZ_2247 81.7 putative cell surface protein, conjugative transposon protein LRHM_2085 LRHM_2097 12.3 conserved hypothetical protein LBCZ_2402 LBCZ_2414 12.5 carbohydrate utilization gene cluster LRHM_2115 LRHM_2119 8.3 CRISPR-associated protein LBCZ_2437 LBCZ_2492 66.7 putative cell surface protein, carbohydrate utilization gene cluster LRHM_2193 LRHM_2198 11.8 cell surface protein, glycosyltransferase LBCZ_2499...”
Halsa_0020 PTS fructose transporter subunit IIC from Halanaerobium hydrogeniformans
56% identity, 22% coverage
VFMJ11_A1058 PTS fructose transporter subunit IIBC from Aliivibrio fischeri MJ11
VFMJ11_A1058 pts system fructose-specific eiibc component from Vibrio fischeri MJ11
42% identity, 20% coverage
A0J47_RS08270 PTS fructose transporter subunit IIBC from Photobacterium damselae subsp. damselae
42% identity, 19% coverage
C289_1174 PTS fructose transporter subunit IIABC from Anoxybacillus ayderensis
50% identity, 16% coverage
- A high molecular-mass Anoxybacillus sp. SK3-4 amylopullulanase: characterization and its relationship in carbohydrate utilization
Kahar, International journal of molecular sciences 2013 - “...Several putative sugar transporters (C289_0465, C289_0466, C289_0467, C289_0603, C289_0763, C289_0764, C289_0765, C289_0778, C289_0779, C289_0780, C289_1015, C289_1174, C289_1392, C289_1394, C289_1910, C289_1911, and C289_1912) were also found in the Blast2GO annotation. The draft genome was submitted to the National Center for Biotechnology Information (NCBI) Bioproject with accession no....”
SUB0750 fructose-specific phosphotransferase system (PTS), IIABC component from Streptococcus uberis 0140J
46% identity, 16% coverage
GJQ69_00900 PTS fructose transporter subunit IIC from Caproicibacterium lactatifermentans
45% identity, 20% coverage
- Revealing the Characteristics of Glucose- and Lactate-Based Chain Elongation for Caproate Production by Caproicibacterium lactatifermentans through Transcriptomic, Bioenergetic, and Regulatory Analyses
Wang, mSystems 2022 - “...biomass synthesis. The enzyme II (EII) components of sugar phosphotransferase system (PTS)-encoding genes (GJQ69_00890, GJQ69_00895, GJQ69_00900, and GJQ69_01220) and a phosphocarrier protein (HPr)-encoding gene (GJQ69_00905) were significantly upregulated with glucose as carbon source, suggesting that glucose was taken up by PTS rather than ATP-binding cassette (ABC)...”
- “...GJQ69_00900 was annotated as fructose PTS IIBC by NCBI prokaryotic genome annotation pipeline (PGAP), gene GJQ69_00900 is more likely to be mainly responsible for glucose uptake in C. lactatifermentans . Nevertheless, except for the PTS system, most glycolytic genes showed similar expression levels under glucose and...”
TC 4.A.2.1.18 / Q9RZP7 Fructose PTS Enzyme IIBC, FruA from Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)
DR_B0073 PTS system, fructose-specific IIBC component from Deinococcus radiodurans R1
47% identity, 16% coverage
Spy49_0674 PTS system, fructose-specific IIABC component from Streptococcus pyogenes NZ131
44% identity, 17% coverage
SPy0855 putative fructose-specific enzyme II, PTS system BC component from Streptococcus pyogenes M1 GAS
44% identity, 17% coverage
FrwB / b3950 putative PTS enzyme IIB component FrwB from Escherichia coli K-12 substr. MG1655 (see 4 papers)
FrwB / P69816 putative PTS enzyme IIB component FrwB from Escherichia coli (strain K12) (see 2 papers)
43% identity, 63% coverage
SSU0768 fructose-specific phosphotransferase system (PTS), IIABC component from Streptococcus suis P1/7
B9H01_RS04040 fructose-specific PTS transporter subunit EIIC from Streptococcus suis
44% identity, 18% coverage
- FlpS, the FNR-Like Protein of Streptococcus suis Is an Essential, Oxygen-Sensing Activator of the Arginine Deiminase System
Willenborg, Pathogens (Basel, Switzerland) 2016 - “...maltose degradation were upregulated. In the exp growth phase the predicted PTS for fructose ( SSU0768 ), trehalose ( SSU0217 ) and glucose/mannose ( SSU1583 ), and in the stat growth phase the PTS for predicted transport of mannose ( SSU0199-201 ), galactose ( SSU0403-0406 ),...”
- Orphan response regulator CovR plays positive regulative functions in the survivability and pathogenicity of Streptococcus suis serotype 2 isolated from a pig
Zhang, BMC veterinary research 2023 - “...change Fructose and mannose metabolism B9H01_RS08575 B9H01_RS08575 K02795 manY 0.79238 B9H01_RS04035 pfkB K00882 fruK 0.877493 B9H01_RS04040 B9H01_RS04040 K02770 fruA 0.819678 B9H01_RS08580 B9H01_RS08580 K02796 manZ 0.832418 Glycerolipid metabolism B9H01_RS07520 B9H01_RS07520 K07407 galA 0.666382 B9H01_RS03575 glpK K00864 glpK 0.85005 ABC transporters B9H01_RS09200 B9H01_RS09200 K17319 lplB 0.682764 B9H01_RS09195 B9H01_RS09195...”
- “...B9H01_RS01065 B9H01_RS01065 K03475 ulaA 0.720561893 B9H01_RS04035 pfkB K00882 fruK 0.87749257 B9H01_RS01165 B9H01_RS01165 K02761 celB 0.749690724 B9H01_RS04040 B9H01_RS04040 K02770 fruA 0.819677837 B9H01_RS08580 B9H01_RS08580 K02796 manZ 0.832418165 B9H01_RS09285 B9H01_RS09285 K02810 scrA 0.800577967 The GO analysis of differentially expressed genes was used to annotate the 117 up-regulated genes. Translation,...”
LMOf2365_0662 PTS system, fructose-specific, IIB component, putative from Listeria monocytogenes str. 4b F2365
lmo0633 similar to PTS system, fructose-specific IIB component from Listeria monocytogenes EGD-e
46% identity, 63% coverage
- Catabolite control protein C contributes to virulence and hydrogen peroxide-induced oxidative stress responses in <i>Listeria monocytogenes</i>
Ogunleye, Frontiers in microbiology 2024 - “...2 1.8 3.6E-02 LMOf2365_0659 Transcriptional regulator MtlR: Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2 1.8 5.6E-03 LMOf2365_0662 PTS system fructose-like EIIB component 2: PTS system, Lactose/Cellobiose specific IIB subunit 2.2 1.7E-02 LMOf2365_0892 Ascorbate-specific PTS system EIIA component 2.1 1.5E-03 LMOf2365_0894 PTS system cellobiose-specific: PTS system, Lactose/Cellobiose specific...”
- DegU-mediated suppression of carbohydrate uptake in Listeria monocytogenes increases adaptation to oxidative stress
Chen, Applied and environmental microbiology 2023 (secret) - Listeria monocytogenes GshF contributes to oxidative stress tolerance via regulation of the phosphoenolpyruvate-carbohydrate phosphotransferase system
Chen, Microbiology spectrum 2023 - “...lmo0631 PTS fructose transporter subunit IIA lmo0632 3.13 Yes/down lmo0632 PTS fructose transporter subunit IIC lmo0633 lmo0633 PTS fructose transporter subunit IIB lmo0738 lmo0738 PTS beta-glucoside transporter subunit IIABC lmo0781 1.33 Yes/down lmo0781 PTS mannose transporter subunit IID lmo0782 3.54 Yes/down lmo0782 PTS mannose transporter subunit...”
- YjbH mediates the oxidative stress response and infection by regulating SpxA1 and the phosphoenolpyruvate-carbohydrate phosphotransferase system (PTS) in Listeria monocytogenes
Cheng, Gut microbes 2021 - “...Yes lmo2259 PTS beta-glucoside-specific enzyme IIA 1.37 Yes EIIB lmo2782 PTS cellobiose-specific enzyme IIB Yes lmo0633 PTS fructose-specific enzyme IIB Yes lmo2799 PTS mannitol-specific enzyme IIBC 10.27 Yes lmo0738 PTS beta-glucoside-specific enzyme IIABC 9.85 Yes lmo2666 PTS galacticol-specific enzyme IIB 4.79 Yes lmo2650 PTS L-ascorbate-specific enzyme...”
- Probing the pan-genome of Listeria monocytogenes: new insights into intraspecific niche expansion and genomic diversification
Deng, BMC genomics 2010 - “...component IIIA - - lmo0632 Similar to PTS system, fructose-specific IIC component IIIA + - lmo0633 Similar to PTS system, fructose-specific IIB component IIIA + - lmo0735 Similar to ribulose-5-phosphate 3-epimerase IIIA + 119 lmo0736 Similar to ribose 5-phosphate isomerase IIIA + 119 lmo0738 Similar to...”
- Gene expression profiling of Listeria monocytogenes strain F2365 during growth in ultrahigh-temperature-processed skim milk
Liu, Applied and environmental microbiology 2008 - “...sequence Amplicon size (bp) lmo0037 lmo0172 lmo0516 lmo0633 lmo0886 lmo1264 lmo1265 lmo1352 lmo1381 lmo1392 lmo1808 lmo1814 lmo1824 lmo1844 lmo1946 lmo2041...”
LMRG_00092 PTS system, fructose-specific, IIB component domain protein from Listeria monocytogenes 10403S
lmo0399 similar to fructose-specific phosphotransferase enzyme IIB from Listeria monocytogenes EGD-e
44% identity, 67% coverage
- Listeria monocytogenes σA Is Sufficient to Survive Gallbladder Bile Exposure
Boonmee, Frontiers in microbiology 2019 - “...lmo2132 Cyclic nucleotide-binding protein 2.08 0.00 LMRG_00091 lmo0398 LMRG_00091-LMRG_00095 PTS system, IIA component 2.51 0.01 LMRG_00092 lmo0399 PTS system, IIB component 3.52 0.00 LMRG_00352 lmo0665 LMRG_00351-LMRG_00353 Hypothetical protein 2.32 0.01 LMRG_00353 lmo0666 Domain-containing protein 2.12 0.01 LMRG_00369 lmo0681 Flagellar biosynthesis regulator FlhF 2.01 0.00 LMRG_00373 lmo0685...”
- “...Figure 2D ). Among the 155 genes in group I, three of these genes ( LMRG_00092- LMRG_00094 ) with higher FC are part of an operon that includes genes encoding a PTS fructose transporter subunit and alpha-mannosidase. LMRG_02456 and LMRG_02567 encode PTS system beta-glucoside-specific components. LMRG_01933...”
- DegU-mediated suppression of carbohydrate uptake in Listeria monocytogenes increases adaptation to oxidative stress
Chen, Applied and environmental microbiology 2023 (secret) - Listeria monocytogenes GshF contributes to oxidative stress tolerance via regulation of the phosphoenolpyruvate-carbohydrate phosphotransferase system
Chen, Microbiology spectrum 2023 - “...beta-glucoside transporter subunit IIB lmo0398 3.27 Yes/down 3.27 Yes/down lmo0398 PTS sugar transporter subunit IIA lmo0399 7.90 Yes/down lmo0399 PTS fructose transporter subunit IIB lmo0400 9.39 Yes/down lmo0400 PTS fructose transporter subunit IIC lmo0426 1.75 Yes/up 2.63 Yes/down lmo0426 PTS fructose transporter subunit IIA lmo0427 1.65...”
- New Insights into the Lactic Acid Resistance Determinants of Listeria monocytogenes Based on Transposon Sequencing and Transcriptome Sequencing Analyses
Liu, Microbiology spectrum 2023 - “...fructose transporter subunit IIBC 0.2495 2.06E-04 lmo0374 lmo0374 PTS beta-glucoside transporter subunit IIB 0.2696 4.37E-03 lmo0399 lmo0399 PTS fructose transporter subunit IIB 0.1191 4.36E-10 lmo0400 lmo0400 PTS fructose transporter subunit IIC 0.0261 8.89E-14 lmo0426 lmo0426 PTS fructose transporter subunit IIA 0.2280 8.76E-07 lmo0427 lmo0427 PTS fructose...”
- Listeria monocytogenes σA Is Sufficient to Survive Gallbladder Bile Exposure
Boonmee, Frontiers in microbiology 2019 - “...Cyclic nucleotide-binding protein 2.08 0.00 LMRG_00091 lmo0398 LMRG_00091-LMRG_00095 PTS system, IIA component 2.51 0.01 LMRG_00092 lmo0399 PTS system, IIB component 3.52 0.00 LMRG_00352 lmo0665 LMRG_00351-LMRG_00353 Hypothetical protein 2.32 0.01 LMRG_00353 lmo0666 Domain-containing protein 2.12 0.01 LMRG_00369 lmo0681 Flagellar biosynthesis regulator FlhF 2.01 0.00 LMRG_00373 lmo0685 motA...”
- Refinement of the Listeria monocytogenes σB regulon through quantitative proteomic analysis
Mujahid, Microbiology (Reading, England) 2013 - “...of this gene. The Group D proteins Lmo0398 and Lmo0399 (annotated as fructose-specific PTS system IIA and IIB components) are also encoded by an operon. lmo0398...”
- “...microarray study with the prfA* strain. lmo0398 and lmo0399 were previously proposed to play a role in sB-dependent regulation of carbohydrate metabolism during...”
- Listeria monocytogenes {sigma}B has a small core regulon and a conserved role in virulence but makes differential contributions to stress tolerance across a diverse collection of strains
Oliver, Applied and environmental microbiology 2010 - “...lmo0342 lmo0343 lmo0344 lmo0345 lmo0346 lmo0348 lmo0398 lmo0399 lmo0400 lmo0401 lmo0402 lmo0439 lmo0449 lmo0584 lmo0589 lmo0590 Productb 4226 OLIVER ET AL....”
- “...I wild-type strain. (A) Operon consisting of lmo0398, lmo0399, lmo0400, lmo0401, and lmo0402. Genes in this operon were flanked by Rho-independent terminators,...”
- Intracellular gene expression profile of Listeria monocytogenes
Chatterjee, Infection and immunity 2006 - “...2.88 lmo2085 lmo2257 2.97 2.13 Strain-specific genes lmo0398 lmo0399 lmo0400 2.55 2.84 2.42 lmo0445 2.04 lmo0750 lmo0751 3.31 2.55 lmo1083 lmo1084 lmo1100 2.48...”
- “...6.16 2.73 2.86 2.25 5.15 2.80 2.13 9.06 lmo0399 2.46 lmo0434 lmo0445 lmo0748 lmo0750 lmo0751 lmo0783 lmo0888 lmo1081 lmo1082 lmo1083 lmo1084 2.05 3.30 12.44...”
- Two-dimensional electrophoresis database of Listeria monocytogenes EGDe proteome and proteomic analysis of mid-log and stationary growth phase cells
Folio, Proteomics 2004 (PubMed)- “...a fructose-specific phosphotransferase enzyme IIB (Lmo0399) and different post-translational modified forms of listeriolysin (LLO). Keywords: Listeria...”
- “...the stationary phase. This is the case for Lmo0399, a fructose-specific phosphotransferase enzyme IIB required for the uptake of fructose and for five proteins...”
DQM59_RS06275 fructose-specific PTS transporter subunit EIIC from Streptococcus mutans
48% identity, 14% coverage
- Adaptation to simulated microgravity in Streptococcus mutans
Fernander, NPJ microgravity 2022 - “...MG2 MG3 MG4 Annotation Description 42 0.06 G88A rpoC 63 0.20 G123C ccpA 0.12 Y636* DQM59_RS06275 0.12 A78V DQM59_RS04610 (eno) 1.00 G88A rpoC 0.06 E105G rpoC 0.12 E55D DQM59_RS10195 (sprV) 0.11 L22I ylqF 100 0.14 intergenic (+181/+120) asnS / DQM59_RS04320 0.20 G77R DQM59_RS00400 0.84 intergenic (381/244)...”
SMUGS5_03875 fructose-specific PTS transporter subunit EIIC from Streptococcus mutans GS-5
48% identity, 14% coverage
- D‑Tagatose inhibits the growth and biofilm formation of Streptococcus mutans
Hasibul, Molecular medicine reports 2018 - “...EII-glu/man-F ctaaagctgaccgtatcattgttg 111 EII-glu/man-R attggtacaacattggccttgaca SMUGS5_09220 Maltose/Glucose-specific PTS subunit IIABC EII-mal/glu-F acacaatatctttggcggtaaga 105 EII-mal/glu-R cgaaaccagagataataccaacg SMUGS5_03875 Fructose-specific PTS subunit IIABC EII-fru-F tgatacttttaaggctgggatca 116 EII-fru-R aaaagaaccgttgcttcctttac SMUGS5_08275 Sucrose-specific PTS subunit IIABC EII-sucF ggtgtctttggtgctctgtattc 113 EII-suc-R gtcaccatgaccagtaccatttt SMUGS5_R09892 16S ribosomal RNA 16SF cctacgggaggcagcagtag 101 16SR caacagagctttacgatccgaaa...”
TC 4.A.2.1.7 / Q1LZ59 The fructose inducible fructose/xylitol porter, FruI from Streptococcus mutans UA159 (see paper)
Q8DUN3 Inducible fructose permease from Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
SMU_872 fructose-specific PTS transporter subunit EIIC from Streptococcus mutans UA159
48% identity, 14% coverage
- substrates: Xylitol, fructose
- Strategic protein target analysis for developing drugs to stop dental caries
Horst, Advances in dental research 2012 - “...Q00749; Fig. 2b), fructose phosphotransferase (Q8DUN3), purine nucleoside phosphorylase (Q8DTU4), glycogen synthase (Q8CWX0), signal recognition particle...”
- Cnm of Streptococcus mutans is important for cell surface structure and membrane permeability
Naka, Frontiers in cellular and infection microbiology 2022 - “...subunit IIBC 1027880 SMU_312 3.057 SMU_313 PTS system sorbitol-specific transporter subunit IIA 1029420 SMU_313 2.925 SMU_872 PTS system fructose-specific transporter subunit IIABC 1028238 SMU_872 2.920 copA Copper-transporting ATPase 1028623 SMU_426 2.886 nrgA Ammonium transporter 1028890 SMU_1658 2.865 SMU_1006 ABC transporter ATP-binding protein 1028342 SMU_1006 2.842 SMU_998...”
- Protein Interactomes of Streptococcus mutans YidC1 and YidC2 Membrane Protein Insertases Suggest SRP Pathway-Independent- and -Dependent Functions, Respectively
Lara, mSphere 2021 - “...protease HtrA (SMU_2164) Putative carbonic anhydrase precursor (SMU_1595) Putative PTS system, fructose-specific enzyme IIABC component (SMU_872) Putative PTS system, mannose-specific component IID (SMU_1879) Putative deacetylase (SMU_623c) Hypothetical protein (SMU_591c)* Hemolysin (SMU_1693) Conserved hypothetical protein, glycosyl transferase (SMU_834) Putative ABC transporter, ATP-binding protein ComA (SMU_286) Hypothetical protein...”
- MGcV: the microbial genomic context viewer for comparative genome analysis
Overmars, BMC genomics 2013 - “...the view shows that the operon showing the strongest response (consisting of SMU_870, SMU_871 and SMU_872) is not preceded by a putative binding-site and therefore probably is regulated indirectly. In fact, this operon encodes a PTS system for which no functional relation with nitrogen is described....”
TC 4.A.2.1.4 / P71012 The fructose porter, FruA (fructose-1-P forming IIABC) (Delobbe et al. 1975) FruA is 39% identical to 4.A.2.1.1). fructose can be metabolized to Fru-1-P via this system as well as Fru-6-P by another PTS system from Bacillus subtilis (see paper)
39% identity, 20% coverage
U876_15985 fructose-specific PTS transporter subunit EIIC from Aeromonas hydrophila NJ-35
42% identity, 15% coverage
A0KI59 protein-N(pi)-phosphohistidine--D-fructose phosphotransferase from Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
42% identity, 15% coverage
LCA_RS05240 fructose-specific PTS transporter subunit EIIC from Latilactobacillus sakei subsp. sakei 23K
41% identity, 18% coverage
- Transcriptome Analysis Reveals the Role of Sucrose in the Production of Latilactobacillus sakei L3 Exopolysaccharide
Wang, International journal of molecular sciences 2024 - “...5 and Table 3 , the PTS-S (LCA_RS08985) and PTS fructose transporter subunit IIC (PTS-F, LCA_RS05240), assigned to the phosphotransferase system (PTS) relating to the transport and metabolism of sugars from the extracellular to the intracellular sides of cells [ 24 ], were significantly up-regulated, indicating...”
- “...Figure 12 Validation of selected DEGs from sucrose metabolism using RT-qPCR. ( a ) PTS-F (LCA_RS05240); ( b ) PTS-S (LCA_RS08985); ( c ) sucrose-6-phosphate hydrolase (LCA_RS08990). ijms-25-07185-t001_Table 1 Table 1 Clean read quality metrics. Sample Total Raw Reads (Mb) Total Clean Reads (Mb) Total Clean...”
CD0208 PTS system, IIb component from Clostridium difficile 630
47% identity, 63% coverage
AHA_1419 phosphotransferase system enzyme II , fructose-specific from Aeromonas hydrophila subsp. hydrophila ATCC 7966
56% identity, 51% coverage
- Transcriptome differences between enrofloxacin-resistant and enrofloxacin-susceptible strains of Aeromonas hydrophila
Zhu, PloS one 2017 - “...AHA_2812, AHA_0913, AHA_3728, AHA_1964, AHA_1687, AHA_4285, AHA_1595, and AHA_2813 (ABC transporters) were upregulated, while the AHA_1419 (environmental information processing), AHA_1331 (drug metabolism-cytochrome P450), AHA_2360, AHA_1331 (glycolysis/gluconeogenesis), and AHA_1331 (metabolism of xenobiotics by cytochrome P450) genes were downregulated. The ABC transporter genes were expressed at higher levels...”
BB0408 PTS system, fructose-specific IIABC component (fruA-1) from Borrelia burgdorferi B31
41% identity, 16% coverage
- Global Tn-seq analysis of carbohydrate utilization and vertebrate infectivity of Borrelia burgdorferi
Troy, Molecular microbiology 2016 - “...metabolism of the tested carbohydrates. Strong phenotypes were observed for the putative carbohydrate phosphotransferase transporters BB0408 and BBB29 as well as the response regulator Rrp1. We further validated Tn-seq for use in mouse studies and were able to correctly identify known infectivity factors as well as...”
- “...had fitness values of 0.33 or 3.0 following growth in media containing mannose ( bb0407, bb0408, bba76, bb0789, bba03, bb0825, bb0756, bbb29 ), and transposon mutants in nine genes were affected following growth in media containing maltose ( bb0155, bba76, bbb29, bb0163, bba04, bbn39, bbg30, bbf14,...”
- Phosphoenolpyruvate Phosphotransferase System Components Modulate Gene Transcription and Virulence of Borrelia burgdorferi
Khajanchi, Infection and immunity 2015 - “...T06TC053e,f T08P02E04 T04TC008 T05TC295 BB0723 BB0723 BB0645 BB0645 BB0408 BB0629 BB0629 BB0629 BB0629 BB0116 BBB29 BBB05 cyaB cyaB ptsG ptsG fruA1 fruA2 fruA2...”
- Stage-specific global alterations in the transcriptomes of Lyme disease spirochetes during tick feeding and following mammalian host adaptation
Iyer, Molecular microbiology 2015 - “...1997 ). Presumably, GlcNAc can also be transported into the cell via these EII components. BB0408 and BB0629 initially were annotated as fructose-specific ( Fraser et al. , 1997 ), but fructose does not support B. burgdorferi growth in vitro ( von Lackum and Stevenson, 2005...”
- Transposon mutagenesis as an approach to improved understanding of Borrelia pathogenesis and biology
Lin, Frontiers in cellular and infection microbiology 2014 - “...T (Lin et al., 2012 ) FlgI BB0772 Non-infectious PHOSPHOTRANSFERASE SYSTEM ptsG BB0645 Non-infectious FruA1 BB0408 Non-infectious FruA2 BB0629 Variable infectivity MalX1 BB0116 Intermediate infectivity MalX2 BBB29 Intermediate infectivity ChbB BBB06 Non-infectious ABC TRANSPORT PROTEINS, BORRELIA EFFLUX SYSTEM (Bes), AND OTHER TRANSPORT SYSTEMS ProX BB0144 Intermediate...”
- Analysis of an ordered, comprehensive STM mutant library in infectious Borrelia burgdorferi: insights into the genes required for mouse infectivity
Lin, PloS one 2012 - “...infectivity in this system. Low infectivity was also obtained with a mutant in fruA-1 ( bb0408 , fructose-specific IIABC component). Inconsistent results were obtained with two mutants in fruA-2 ( bb0629 ), precluding interpretation in the absence of additional information. In terms of other transporter systems...”
- A genome-wide proteome array reveals a limited set of immunogens in natural infections of humans and white-footed mice with Borrelia burgdorferi
Barbour, Infection and immunity 2008 - “...BB0323 BB0328 BB0329 BB0337 BB0348 BB0359 BB0365 BB0385 BB0408 BB0476 BB0518 BB0543 BB0603 BB0649 BB0652 BB0668 BB0681 BB0751 BB0772 BB0774 BB0805 BB0811 BB0844...”
- “...prevalent Orfs for sera obtained later in disease: BB0408, BB0476, BB0751, BB0805, INFECT. IMMUN. VOL. 76, 2008 IMMUNOGENS OF B. BURGDORFERI IN NATURAL...”
TC 4.A.2.1.19 / M7PF02 PTS family enzyme IIB'BC, fructose-specific, component of The tagatose-specific PTS transporter/kinase, TagIIA-TPr/TagIIB'BC (tagatose-1-P forming) from Klebsiella pneumoniae ATCC BAA-2146
45% identity, 20% coverage
- substrates: Tagatose
tcdb comment: TagIIA-TPr is a fusion of a IIA domain fused N-terminal to an HPr domain. TagIIB'BC has and inactive IIB' domain fused N-terminal to the active C-terminal IIBC domains. This arrangement resembles that for the E. coli fructose Enzyme II complex
KP1_RS09385, KPK_RS16820, VK055_1469 PTS fructose-like transporter subunit IIB from Klebsiella pneumoniae subsp. pneumoniae
43% identity, 62% coverage
- Identification of Pathogenicity-Associated Loci in Klebsiella pneumoniae from Hospitalized Patients
Martin, mSystems 2018 - “...KP1_RS09335 Iron ABC transporter substrate-binding protein 5 (13.1) 30 (39.4) 0.007219 KPK_RS16820 , VK055_1469 , KP1_RS09385 f PTS fructose transporter subunit IIB 6 (15.8) 32 (42.1) 0.008326 KPK_RS16835, VK055_1472, KP1_RS09370 PTS fructose transporter subunit IIB 6 (15.8) 32 (42.1) 0.008326 KP1_RS12840 , KPNJ1_RS13410 , KPN_01702 g...”
- “...KPK_RS16865 , VK055_1479 , KP1_RS09335 Iron ABC transporter substrate-binding protein 5 (13.1) 30 (39.4) 0.007219 KPK_RS16820 , VK055_1469 , KP1_RS09385 f PTS fructose transporter subunit IIB 6 (15.8) 32 (42.1) 0.008326 KPK_RS16835, VK055_1472, KP1_RS09370 PTS fructose transporter subunit IIB 6 (15.8) 32 (42.1) 0.008326 KP1_RS12840 ,...”
- “...Representative gene for KPK_RS16810, -16815, -16825, -16830, -16840, -16845, and -16850. f Representative gene for KPK_RS16820 and -16835. g Representative gene for KP1_RS12820 to -12840. h Representative gene for KP1_RS26720, -26700, -26655, and -26650. To determine which loci were significantly and independently associated with infection in...”
- “...VK055_1479 , KP1_RS09335 Iron ABC transporter substrate-binding protein 5 (13.1) 30 (39.4) 0.007219 KPK_RS16820 , VK055_1469 , KP1_RS09385 f PTS fructose transporter subunit IIB 6 (15.8) 32 (42.1) 0.008326 KPK_RS16835, VK055_1472, KP1_RS09370 PTS fructose transporter subunit IIB 6 (15.8) 32 (42.1) 0.008326 KP1_RS12840 , KPNJ1_RS13410 ,...”
CPE0584 PTS system from Clostridium perfringens str. 13
40% identity, 17% coverage
- RNA-seq analysis of virR and revR mutants of Clostridium perfringens
Low, BMC genomics 2016 - “...protein 1.53 1.93 Others b cpe2562 cspB protease 3.87 4.49 cpe0855 rubY rubrerythrin 1.42 1.66 cpe0584 fruA PTS fructose transporter 1.48 1.83 cpe0638 pstC phosphate ABC transporter permease 1.27 6.50 cpe0094 nirC nitrite transporter 1.75 5.13 a As defined by FDR <0.01; log 2 fold change>1...”
STM4113 PTS system fructose-like IIB component 1 from Salmonella typhimurium LT2
42% identity, 63% coverage
- Salmonella serovar identification using PCR-based detection of gene presence and absence
Arrach, Journal of clinical microbiology 2008 - “...STM4068, STM4072, STM4074, STM4075, STM4078, STM4102, STM4113, STM4115, STM4205, STM4261, STM4279, STM4306, STM4319, STM4373, STM4413, STM4420, STM4426,...”
PTFBC_VIBCH / Q9KM72 PTS system fructose-specific EIIB'BC component; EC 2.7.1.202 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) (see 2 papers)
VCA0516 PTS system, fructose-specific IIBC component from Vibrio cholerae O1 biovar eltor str. N16961
46% identity, 20% coverage
- function: The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. The enzyme II FruAB PTS system is involved in fructose transport.
catalytic activity: D-fructose(out) + N(pros)-phospho-L-histidyl-[protein] = D- fructose 1-phosphate(in) + L-histidyl-[protein] (RHEA:49252)
disruption phenotype: Does not affect growth on fructose or on glucose. - Cra and cAMP Receptor Protein Have Opposing Roles in the Regulation of fruB in Vibrio cholerae
Beck, Journal of bacteriology 2021 - “...protein that is capable of both fructose and mannose transport ( 7 , 11 ). VCA0516, VCA0517, and VCA0518 make up the second locus encoding PTS Fru proteins ( 12 ). VCA0518 ( fruB ) encodes the fructose-specific EIIA domain and FPr, which exist as fusion...”
- “...responsible for phosphorylating fructose-1-phosphate to fructose-1,6-bisphosphate following uptake and phosphorylation of fructose into the cell. VCA0516 ( fruA ) encodes the fructose-specific EIIB and EIIC domains, which exist as fusion proteins. Experimental evidence suggests that in V. cholerae , the proteins encoded by fruBKA play the...”
- Vibrio cholerae FruR facilitates binding of RNA polymerase to the fru promoter in the presence of fructose 1-phosphate
Yoon, Nucleic acids research 2021 - “...( 2528 ). The fructose PTS (PTS Fru ) consists of the membrane-spanning transporter FruA (VCA0516) and cytosolic FruB (VCA0518). It phosphorylates fructose to fructose 1-phosphate (F1P) during its translocation across the membrane. F1P is then converted to fructose 1,6-bisphosphate (FBP) by the 1-phosphofructokinase FruK (VCA0517)....”
- Transcriptomics reveals a cross-modulatory effect between riboflavin and iron and outlines responses to riboflavin biosynthesis and uptake in Vibrio cholerae
Sepúlveda-Cisternas, Scientific reports 2018 - “...VCA0269 decarboxylase group II 1.218 VCA0344 hypothetical protein 1.012 VCA0511 nrdG anaerobic ribonucleoside-triphosphate reductase 1.175 VCA0516 ptsIIB PTS system fructose-specific IIBC component 2.838 VCA0517 fruK 1-phosphofructokinase 1.948 1.919 VCA0518 ptsIIA PTS system fructose-specific IIA/FPR component 1.778 1.113 VCA0523 cqsA aminotransferase class II 2.585 VCA0540 formate transporter...”
- The transcriptional regulator, CosR, controls compatible solute biosynthesis and transport, motility and biofilm formation in Vibrio cholerae
Shikuma, Environmental microbiology 2013 - “...transporter BCCT family 6.17 VC1854 ompT ompT protein 0.45 VC1929 dctP-2 C4-dicarboxylate-binding periplasmic protein 3.08 VCA0516 fruA-2 PTS system fructose-specific IIBC component 0.40 VCA0745 glpF Glycerol uptake facilitator protein 0.48 Differentially expressed genes were determined using SAM software, with criteria of a 2-fold change in gene...”
VPA1424 PTS system, fructose-specific IIABC component from Vibrio parahaemolyticus RIMD 2210633
40% identity, 19% coverage
- Fis Connects Two Sensory Pathways, Quorum Sensing and Surface Sensing, to Control Motility in Vibrio parahaemolyticus
Tague, Frontiers in microbiology 2021 - “...inputs. Default settings were used to obtain putative Fis binding sites. A 130-bp sequence of VPA1424 regulatory region was used as a negative control that contains no Fis binding sites. A 229-bp sequence of gyrA regulatory region was used as a positive control for Fis binding,...”
- “...177-bp fragment of P qrr5 regulatory regions were used as probes. A 130-bp probe of VPA1424 regulatory region was used as a negative control and a 229-bp probe of P gyrA regulatory region was used as a positive control. Analysis of Fis binding to flagellum gene...”
- Quorum Sensing Regulators Are Required for Metabolic Fitness in Vibrio parahaemolyticus
Kalburge, Infection and immunity 2017 - “...binding sites (probability 90%), which included mannose (VPA1424 to VPA1425), arabinose (VPA1673 to VPA1671), and glycogen (VPA1620) transport and/or metabolism...”
- “...region for a mannose transport and metabolism cluster (VPA1424 to VPA1425). The glucose-specific phosphotransferase system (PTS) VPA1667 probe was included as a...”
- Gene expression of Vibrio parahaemolyticus growing in laboratory isolation conditions compared to those common in its natural ocean environment
García, BMC microbiology 2017 - “...207 -7.5 3.5E - 248 Hypothetical protein VP1072 1 142 -7.2 1.1E - 186 Helicase VPA1424 2 492 7.2 0 Fructose transport Overall differential expression To compare the expression of all the differentially expressed genes, they were grouped by gene ontology term using enrichGO from clusterProfiler...”
- Insights into Vibrio parahaemolyticus CHN25 response to artificial gastric fluid stress by transcriptomic analysis
Sun, International journal of molecular sciences 2014 - “...glucose-, fructose-, mannitol-, cellobiose-, ascorbate-, and N -acetylglucosamine-specific enzyme II components. One of these genes, VPA1424 encoding fructose-specific enzyme II ABC subunits, was strongly up-regulated for 27.97-fold in mRNA level, suggesting extremely active transport and utilization of the fructose in the AGF stress. In addition, interestingly,...”
- “...Encoded Protein RIMD2210633 CHN25 LGP cells Phosphotransferase system (PTS) VPA1667 Chn25A_1555 0.0384 Glucose-specific IIBC component VPA1424 Chn25A_1312 27.9696 Fructose-specific IIABC component VPA1422 Chn25A_1310 2.2688 Nitrogen regulatory IIA component VPA1421 Chn25A_1309 2.3425 Fructose-specific IIB component VPA1420 Chn25A_1308 2.8724 Fructose-specific IIABC component VPA0501 Chn25A_1196 2.6299 Mannitol-specific enzyme II...”
LMOf2365_0443 PTS system, fructose-specific, IIB component from Listeria monocytogenes str. 4b F2365
lmo0427 similar to PTS fructose-specific enzyme IIB component from Listeria monocytogenes EGD-e
45% identity, 67% coverage
- LMOf2365_0442 Encoding for a Fructose Specific PTS Permease IIA May Be Required for Virulence in L. monocytogenes Strain F2365
Liu, Frontiers in microbiology 2017 - “...( Wu et al., 2012 ). LMOf2365_0442 (encoding for the PTS system, fructose-specific, IIA component), LMOf2365_0443 (encoding for the PTS system, fructose-specific, IIB component), and LMOf2365_0444 (encoding for the PTS system, fructose-specific, IIC component) were highly induced under high hydrostatic pressure treatment ( Liu et al.,...”
- “...days to obtain almost confluent monolayers. Strains of L. monocytogenes (isogenic deletion mutants LMOf2365_0442 , LMOf2365_0443 , LMOf2365_0444 and the parental LMOf2365 ) and L. innocua grown to log-phase at 37C were used for invasion assays. HT-29 cell monolayers incubated in DMEM medium without antibiotics for...”
- Construction of Listeria monocytogenes mutants with in-frame deletions in the phosphotransferase transport system (PTS) and analysis of their growth under stress conditions
Liu, Journal of food science 2013 (PubMed)- “...deletion mutants of the PTS genes (LMOf2365_0442, LMOf2365_0443, and LMOf2365_0444) and the downstream gene LMOf2365_0445 were created in L. monocytogenes...”
- “...for PTS system, fructose-specific, IIA component), LMOf2365_0443 (encoding for PTS system, fructose-specific, IIB component), LMOf2365_0444 (encoding for PTS...”
- DegU-mediated suppression of carbohydrate uptake in Listeria monocytogenes increases adaptation to oxidative stress
Chen, Applied and environmental microbiology 2023 (secret) - Listeria monocytogenes GshF contributes to oxidative stress tolerance via regulation of the phosphoenolpyruvate-carbohydrate phosphotransferase system
Chen, Microbiology spectrum 2023 - “...fructose transporter subunit IIC lmo0426 1.75 Yes/up 2.63 Yes/down lmo0426 PTS fructose transporter subunit IIA lmo0427 1.65 Yes/up lmo0427 PTS fructose transporter subunit IIB lmo0428 1.95 Yes/up 2.82 Yes/down lmo0428 PTS fructose transporter subunit IIC lmo0503 lmo0503 PTS fructose transporter subunit IIA lmo0507 3.47 Yes/down lmo0507...”
- New Insights into the Lactic Acid Resistance Determinants of Listeria monocytogenes Based on Transposon Sequencing and Transcriptome Sequencing Analyses
Liu, Microbiology spectrum 2023 - “...fructose transporter subunit IIC 0.0261 8.89E-14 lmo0426 lmo0426 PTS fructose transporter subunit IIA 0.2280 8.76E-07 lmo0427 lmo0427 PTS fructose transporter subunit IIB 0.2581 1.04E-03 lmo0428 lmo0428 PTS fructose transporter subunit IIC 0.2212 5.17E-26 lmo0503 lmo0503 PTS fructose transporter subunit IIA 0.0411 9.05E-28 lmo0507 lmo0507 PTS galactitol...”
- Colonisation dynamics of Listeria monocytogenes strains isolated from food production environments
Gray, Scientific reports 2021 - “...PTS, EIIA 1 7453 24h lmo1719 fig|1639.4014.peg.1473 4.36 G PTS system cellobiose-specific IIA component 2.7.1.205 lmo0427 fig|1639.4014.peg.2115 4.77 G PTS system, Lactose/Cellobiose specific IIB subunit lmo0426 fig|1639.4014.peg.2116 4.02 G PEP-dependent sugar PTS, EIIA 2 lmo0024 fig|1639.4014.peg.434 4.99 G PTS system mannose/fructose/sorbose family IID component lmo0034 fig|1639.4014.peg.444...”
- Resilience in the Face of Uncertainty: Sigma Factor B Fine-Tunes Gene Expression To Support Homeostasis in Gram-Positive Bacteria
Guldimann, Applied and environmental microbiology 2016 - “...regulates other PTS components, including Lmo1997, Lmo1998, Lmo2002, Lmo0427, Lmo0484, and Lmo2648 (72). A recent study by Wang et al. (73) that used deletion...”
- Crystal Structure of Hypothetical Fructose-Specific EIIB from Escherichia coli
Park, Molecules and cells 2016 (no snippet) - Refinement of the Listeria monocytogenes σB regulon through quantitative proteomic analysis
Mujahid, Microbiology (Reading, England) 2013 - “...other proteins with lower expression levels were Lmo0427 (fructose-specific PTS system IIB 1114 component), Lmo0484 (haem-degrading monooxygenase, IsdG) and...”
- “...in three (lmo2648; lmo1998; lmo2002) or two (lmo0484; lmo0427; lmo1997) microarray studies in DsigB stationary phase cells (Oliver et al., 2010; Ollinger et...”
BAGQ_1558 PTS fructose transporter subunit IIABC from Bacillus velezensis
43% identity, 15% coverage
CD3014 PTS system, IIb component from Clostridium difficile 630
44% identity, 67% coverage
- Epidemic Clostridium difficile strains demonstrate increased competitive fitness compared to nonepidemic isolates
Robinson, Infection and immunity 2014 - “...Toxinotype PFGEa type (NAP status) Ribotype CD1014 CD2015 CD2048 CD3014 CD3017 CD4004 CD4010 CD4015 0 III 0 0 III 0 III III MI-NAP4 MI-NAP1 MI-NAP3 MI-NAP2...”
- “...as well as strains from other ribotypes (CD1014, CD3014, and CD4004) (data not shown). Based upon these results, we concluded that the communities established...”
- Fourteen-genome comparison identifies DNA markers for severe-disease-associated strains of Clostridium difficile
Forgetta, Journal of clinical microbiology 2011 - “...selected a set of 12 genes (spoIIIAG, CD0596, CD0117, CD3014, CD0279, CD1795, CD2251, CD0017, cdd1, srlE, prdB, and sspA) that displayed a high level of...”
- “...coverage (%) Maximum identity (%) sspA prdB CD0017 cdd1 srlE CD2251 CD1795 CD0596 CD0117 CD3014 CD0279 spoIIIAG 0 2 2 2 6 3 4 6 6 6 8 8 0 5 6 6 6 8 9 10 10 10...”
SAR0753 PTS transport system, fructose-specific IIABC component from Staphylococcus aureus subsp. aureus MRSA252
45% identity, 14% coverage
- The Staphylococcus aureus response to unsaturated long chain free fatty acids: survival mechanisms and virulence implications
Kenny, PloS one 2009 - “...3.03 3.00E-04 SAR0523 SNO glutamine amidotransferase family protein 2.70 3.70E-04 SAR0752 putative phosphofructokinase 2.38 3.27E-02 SAR0753 fruA fructose-specific PTS system component 2.50 3.78E-02 SAR0766 glutamine amidotransferase class-I protein 2.04 6.16E-04 SAR1088 putative pyruvate carboxylase 2.5 8.78E-04 SAR1450 tdcB putative threonine dehydratase 2.22 5.47E-03 SAR1451 ald2 alanine...”
- “...SAR0210 putative oxidoreductase 9.09 3.75E-03 SAR0527 putative phosphotransferase 4.55 7.03E-08 SAR0752 putative phosphofructokinase 2.44 3.20E-02 SAR0753 fruA fructose-specific PTS system component 3.45 1.21E-02 SAR1274 glpF putative glycerol uptake facilitator protein 3.70 3.36E-03 SAR1275 glpK glycerol kinase 4.17 6.42E-04 SAR1276 glpD glycerol-3-phosphate dehydrogenase 7.69 4.83E-06 SAR2244 mtlA...”
BB0629 PTS system, fructose-specific IIABC component (fruA-2) from Borrelia burgdorferi B31
41% identity, 15% coverage
- BosR and PlzA reciprocally regulate RpoS function to sustain Borrelia burgdorferi in ticks and mammals
Grassmann, The Journal of clinical investigation 2023 - “...bb0166 / malQ , bb0367 , bb0557 / ptsH-2 , bb0559 / crr , and bb0629 / fruA-2 ) encode components of the phosphoenolpyruvate-dependent sugar phosphotransferase system the spirochetes central pathway for carbohydrate transport ( 42 , 43 ) and could be involved in uptake of...”
- N-acetylmannosamine (ManNAc) supports the growth of Borrelia burgdorferi in the absence of N-acetylglucosamine (GlcNAc)
Schneider, FEMS microbiology letters 2018 (PubMed)- “...encoding a subunit of the chitobiose transporter, bb0629 (fruA-2) encoding a putative carbohydrate transporter and bb0644 (nanE) encoding a putative...”
- “...in this study. Symbol bb0147 flaB bb0374 pdeB bb0628 bb0629 fruA-2 bb0644 nanE bba30 bbb04 bbd22 bbg28 chbC Primer No. NC374 NC375 NC510 NC511 NC506 NC507 NC508...”
- Global Tn-seq analysis of carbohydrate utilization and vertebrate infectivity of Borrelia burgdorferi
Troy, Molecular microbiology 2016 - “...of ten genes annotated to encode EII PTS transporter subunits ( bb0116, bb0367, bb0408, bb0559, bb0629, bb0645, bbb04, bbb05, bbb06, bbb29 ) suggests that this method of importing carbohydrates plays a significant role in the enzootic cycle. Transposon mutants with insertions in eight of these genes...”
- “...burgdorferi genome predicted to encode transporters in the PTS Fructose-Mannitol (Fru) family: bb0408 (fruA1) and bb0629 (fruA2) . Both of these genes are predicted to encode all three EII domains of a PTS transporter. The PTS Fru family includes a number of fructose, mannose and mannitol...”
- Phosphoenolpyruvate Phosphotransferase System Components Modulate Gene Transcription and Virulence of Borrelia burgdorferi
Khajanchi, Infection and immunity 2015 - “...T08P02E04 T04TC008 T05TC295 BB0723 BB0723 BB0645 BB0645 BB0408 BB0629 BB0629 BB0629 BB0629 BB0116 BBB29 BBB05 cyaB cyaB ptsG ptsG fruA1 fruA2 fruA2 fruA2 fruA2...”
- Cyclic di-GMP modulates gene expression in Lyme disease spirochetes at the tick-mammal interface to promote spirochete survival during the blood meal and tick-to-mammal transmission
Caimano, Infection and immunity 2015 - “...(bb0116) glpF (bb0240) glpK (bb0241) glpD (bb0243) bb0323 bb0629 bosR (bb0647) bb0680 rpoS (bb0771) spoVG (bb0785) arcA (bb0841) bba07 ospA (bba15) dbpA (bba24)...”
- “...(PTS) sugar transporter (EII) components for mannose (bb0629), chitobiose (bbb04 to bbb06), and GlcNAc (bbb29 [malX-2]) Infection and Immunity August 2015...”
- Stage-specific global alterations in the transcriptomes of Lyme disease spirochetes during tick feeding and following mammalian host adaptation
Iyer, Molecular microbiology 2015 - “...Presumably, GlcNAc can also be transported into the cell via these EII components. BB0408 and BB0629 initially were annotated as fructose-specific ( Fraser et al. , 1997 ), but fructose does not support B. burgdorferi growth in vitro ( von Lackum and Stevenson, 2005 ; Gherardini...”
- “...9B ), a finding confirmed by qRT-PCR ( Table 1 ). The putative mannose-specific EIIABC (BB0629) also is induced in feeding ticks (23-fold [P=0.0003] in fed larvae; 10-fold [P=.01] in fed nymphs) relative to DMCs. Glucose should be abundantly available in a mammalian environment and during...”
- Transposon mutagenesis as an approach to improved understanding of Borrelia pathogenesis and biology
Lin, Frontiers in cellular and infection microbiology 2014 - “...al., 2012 ) FlgI BB0772 Non-infectious PHOSPHOTRANSFERASE SYSTEM ptsG BB0645 Non-infectious FruA1 BB0408 Non-infectious FruA2 BB0629 Variable infectivity MalX1 BB0116 Intermediate infectivity MalX2 BBB29 Intermediate infectivity ChbB BBB06 Non-infectious ABC TRANSPORT PROTEINS, BORRELIA EFFLUX SYSTEM (Bes), AND OTHER TRANSPORT SYSTEMS ProX BB0144 Intermediate infectivity MglA BB0318...”
- Analysis of an ordered, comprehensive STM mutant library in infectious Borrelia burgdorferi: insights into the genes required for mouse infectivity
Lin, PloS one 2012 - “...bb0408 , fructose-specific IIABC component). Inconsistent results were obtained with two mutants in fruA-2 ( bb0629 ), precluding interpretation in the absence of additional information. In terms of other transporter systems (Fig. 8D in File S1), mutation of the genes encoding lactose permease ( lctP ),...”
- More
BSQ49_00330 fructose-specific PTS transporter subunit EIIC from Liquorilactobacillus hordei
46% identity, 14% coverage
SEQ_1299 fructose-specific phosphotransferase system (PTS), IIABC component from Streptococcus equi subsp. equi 4047
47% identity, 15% coverage
SA0655 fructose specific permease from Staphylococcus aureus subsp. aureus N315
SAV0700 fructose specific permease from Staphylococcus aureus subsp. aureus Mu50
45% identity, 14% coverage
- Sulfide Homeostasis and Nitroxyl Intersect via Formation of Reactive Sulfur Species in Staphylococcus aureus
Peng, mSphere 2017 - “...ATP:guanido phosphotransferase NWMN_0487 SA0483 clpC 12.7 ClpC protease, ATP-binding subunit NWMN_0587 SA0572 15.5 Hypothetical NWMN_0669 SA0655 fruA 14.2 Fructose permease (NWMN_06670669, frc operon) NWMN_0815 SA0806 17.5 8.4 NADH-dependent pyridine nucleotide disulfide oxidoreductase (short-chain dehydrogenase/reductase [SDR]) Yes (229) NWMN_0826 SA0817 13.1 NADH-dependent flavin oxidoreductase NWMN_0845 SA0835 28.2...”
- Global transcriptome analysis of Staphylococcus aureus biofilms in response to innate immune cells
Scherr, Infection and immunity 2013 - “...SA1182 SA1435 SA1364 SA2553 SA1814 SA2303 SA1693 SA0655 SA1109 SA2635 SA1844 SA0308 SA2195 SA0921 SA1876 SA1309 Rhodanese-like domain protein L-Lactate permease...”
- Transcriptional signature following inhibition of early-stage cell wall biosynthesis in Staphylococcus aureus
O'Neill, Antimicrobial agents and chemotherapy 2009 - “...SA0268 SA0269 SA0270 SA0325 SA0423 SA0497 SA0498 SA0654 SA0655 SA0820 SA0905 SA0912 SA0913 SA0951 SA1056 SA1160 SA1502 SA1665 SA1850 SA1921 SA1979 SA2016 SA2093...”
- Characterization of the oxygen-responsive NreABC regulon of Staphylococcus aureus
Schlag, Journal of bacteriology 2008 - “...genes SA0187 SA0211 SA0212 SA0318 SA0580 SA0653 SA0654 SA0655 SA1014 SA1675 SA1699 SA2167 SA2209 SA2242 SA2424 SA2425 SA2426 SA2427 SA2428 fruB fruA scrA hlgB...”
- Genome-wide analysis of ruminant Staphylococcus aureus reveals diversification of the core genome
Ben, Journal of bacteriology 2008 - “...gain SA0166 Cytoplasm SA0172 Membrane SA0294 Membrane/SP SA0655 Membrane SA1156 Membrane SA0848 Cytoplasm SAR1761 Membrane/SP SA1592 Membrane SA1958 Cytoplasm...”
- Reporter metabolite analysis of transcriptional profiles of a Staphylococcus aureus strain with normal phenotype and its isogenic hemB mutant displaying the small-colony-variant phenotype
Seggewiss, Journal of bacteriology 2006 - “...SA0186 SA0639 0.00 0.00 0.01 2.19 0.38 2.04 SA0531 SA0417 SA0655 SA0374 SA2053 SA2434 0.01 0.01 0.01 0.01 0.01 0.02 2.20 2.15 2.25 0.39 2.06 2.31 a b...”
- Two novel point mutations in clinical Staphylococcus aureus reduce linezolid susceptibility and switch on the stringent response to promote persistent infection
Gao, PLoS pathogens 2010 - “...SAS1448 maltose operon transcriptional repressor 7.5 SAV0247 gatC probable PTS galactitol-specific enzyme IIC component 2.0 SAV0700 fruA PTS system, fructose-specific IIBC component 2.2 SAV1507 malA alpha-D-1,4-glucosidase 5.7 SAV1508 malR maltose operon transcriptional repressor 8.0 SAV2377 scrA PTS system, sucrose-specific IIBC component 3.0 SAV2506 gntK gluconokinase 8.5...”
- The ORFeome of Staphylococcus aureus v 1.1
Brandner, BMC genomics 2008 - “...Oligopeptide transport ATP-binding protein 530 AA SAV2029 60 kDa chaperonin 538 AA [ 41 ] SAV0700 Fructose specific permease 652 AA SAV2157 Putative uncharacterized protein 710 AA SAV1905 ATP-dependent DNA helicase pcrA 730 AA [ 42 ] Figure 3 Y2H screen for homodimers . (A) Yeast...”
EQG65_03560, RDJ18_RS03920, SAUSA300_RS03675 fructose-specific PTS transporter subunit EIIC from Staphylococcus aureus
NWMN_0669 fructose specific permease from Staphylococcus aureus subsp. aureus str. Newman
45% identity, 14% coverage
- Multiomics analysis of Staphylococcus aureus ST239 strains resistant to virulent Herelleviridae phages
Kornienko, Scientific reports 2024 - “...glucose and fructose into the cell at both early and late stages (RDJ18_RS00835, RDJ18_RS01075, RDJ18_RS01200, RDJ18_RS03920, RDJ18_RS13495, RDJ18_RS14335) (Table S4 ). The key genes encoding enzymes involved in glycolysis exhibited upregulation: pyruvate kinase (RDJ18_RS06570), L-lactate dehydrogenase (RDJ18_RS01065), phosphoglycerate kinase (RDJ18_RS04310), triose-phosphate isomerase (RDJ18_RS04315), and 2,3-bisphosphoglycerate-independent phosphoglycerate...”
- Unveiling the fructose metabolism system in Staphylococcus aureus: insights into the regulatory role of FruR and the FruRKT operon in bacterial fitness
Ge, BMC microbiology 2024 - “...gene but few significant down-regulated genes, including the proved target genes sa03670 (SAUSA300_RS03670) and sa03675 (SAUSA300_RS03675) from the fruRKT operon (Fig. 6 ). Other than that, five genes encoding RNA polymerase sigma factor SigS, sirohydrochlorin chelatase, and function unknown protein were found down-regulated in the fruR...”
- Antibacterial Activity and Components of the Methanol-Phase Extract from Rhizomes of Pharmacophagous Plant Alpinia officinarum Hance
Fu, Molecules (Basel, Switzerland) 2022 - “...GMPE treatment. Interestingly, in the PTS, two DEGs encoding fructose transporter subunit II C ( EQG65_03560 ) and 1-phosphofructokinase ( EQG65_03555 ) were highly upregulated by 24.254- and 28.586-fold, respectively. The greatly activated monosaccharide transporter and metabolism were probably more favorable to the bacterium response to...”
- Sulfide Homeostasis and Nitroxyl Intersect via Formation of Reactive Sulfur Species in Staphylococcus aureus
Peng, mSphere 2017 - “...16.1 ATP:guanido phosphotransferase NWMN_0487 SA0483 clpC 12.7 ClpC protease, ATP-binding subunit NWMN_0587 SA0572 15.5 Hypothetical NWMN_0669 SA0655 fruA 14.2 Fructose permease (NWMN_06670669, frc operon) NWMN_0815 SA0806 17.5 8.4 NADH-dependent pyridine nucleotide disulfide oxidoreductase (short-chain dehydrogenase/reductase [SDR]) Yes (229) NWMN_0826 SA0817 13.1 NADH-dependent flavin oxidoreductase NWMN_0845 SA0835...”
TC 4.A.2.1.22 / Q3JZE2 PTS system, fructose-specific, IIB component, component of D-allose/D-ribose transporting Enzyme II complex (Fru2; IIA/IIB/IIC) (Patron et al. 2017). This system is similar to Frz of E. coli (TC#4.A.2.1.9) which is involved in environmental sensing, host adaptation and virulence from Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
ID870_00990 PTS fructose transporter subunit IIB from Streptococcus agalactiae CJB111
41% identity, 67% coverage
- substrates: D-allose, D-ribose
tcdb comment: The regulatory mechanism has been studied (Patron et al. 2017) - Genomic Analyses Identify Manganese Homeostasis as a Driver of Group B Streptococcal Vaginal Colonization
Burcham, mBio 2022 - “...subunit IIA 6.35 7.73 8.63 5.88 ID870_00430 PTS system mannose/fructose/ N -acetylgalactosamine-transporter subunit IIB 7.30 ID870_00990 PTS fructose transporter subunit IIB 9.43 19.55 21.30 ID870_00995 PTS sugar transporter subunit IIA 7.71 6.94 6.60 ID870_01290 PTS glucose transporter subunit IIA 3.29 3.53 3.21 ID870_01665 Transporter substrate-binding domain-containing...”
VPA1421 PTS system, fructose-specific IIB component from Vibrio parahaemolyticus RIMD 2210633
46% identity, 62% coverage
EP10_002551 PTS fructose transporter subunit IIABC from Geobacillus icigianus
48% identity, 15% coverage
- The Transcriptomic Response of Cells of the Thermophilic Bacterium <i>Geobacillus icigianus</i> to Terahertz Irradiation
Peltek, International journal of molecular sciences 2024 - “...(EP10_000465) [ 24 ], the operon encoding the system of transport and utilization of fructose (EP10_002551, EP10_002552, and EP10_002553), a lactic-acid synthesis gene (EP10_003019), and genes of enzymes related to the biosynthesis of bacterial cell wall components (EP10_002881) [ 25 , 26 , 27 ] and...”
- “...the genes of the PTS system, glycolysis enzyme phosphofructokinase FruB, and a TF called FruR (EP10_002551, EP10_002552, and EP10_002553) (which is a positive regulator of genes of pentose phosphate pathway enzymes and a repressor of glycolysis enzyme genes) indicates, on the one hand, an attempt by...”
t3175 sugar phosphotransferase enzyme IIBC component of PTS system from Salmonella enterica subsp. enterica serovar Typhi Ty2
STY3437 PTS system, sugar phosphotransferase enzyme IIBC component from Salmonella enterica subsp. enterica serovar Typhi str. CT18
T_RS16100 PTS fructose transporter subunit IIC from Salmonella enterica subsp. enterica serovar Typhi str. Ty2
43% identity, 22% coverage
STM3255 putative phosphotransferase system fructose-specific component IIB from Salmonella typhimurium LT2
43% identity, 22% coverage
- Genome-scale metabolic reconstructions of multiple Salmonella strains reveal serovar-specific metabolic traits
Seif, Nature communications 2018 - “...transport in via proton symport (C-O2+/) d -Xylose STM3354 l (+)-tartrate dehydratase (C-O2+/) l -tartrate STM3255 ( tagT ) d Tagatose transport via PEPPyr PTS (C-O2+/) d Tagatose STM3792 ( deoP ) Deoxy D ribose transport via proton symport (C-O2+/) Deoxy D Ribose STM3793 ( deoK...”
- Genetic Characterization of the Galactitol Utilization Pathway of Salmonella enterica Serovar Typhimurium
Nolle, Journal of bacteriology 2017 - “...STM3254, gatD, and gatR but only the first 682 bp of STM3255 and the last 121 bp of gatC, while the genes STM2356, gatZ (STM3257), gatA, and gatB are missing...”
- “...aldolase subunits; STM3254, putative phosphofructokinase; STM3255, putative tagatose-specific EIIBC component; STM3256, phosphoryl transfer protein; HPr,...”
- The salmonella transcriptome in lettuce and cilantro soft rot reveals a niche overlap with the animal host intestine
Goudeau, Applied and environmental microbiology 2013 - “...levels of fruB and fruK and the STM3255 gene, encoding fructose-specific component IIB of a putative phosphotransferase system (PTS) (increased levels...”
- “...cbiP-Bb dpiBA dgoD, dgoK, dgoT eutS-Rc fruB, fruK; STM3255 fucAO gntU, kdgT, kduD idnK-T pduA-W, pduFc prpC, prpB rhaB-D, rhaT yjfR-sgaT-Uc 2.5-3.0 29.5-131.7...”
SCO3196 fructose-specific permease from Streptomyces coelicolor A3(2)
40% identity, 21% coverage
SEN2197 PTS system, fructose-specific IIBC component from Salmonella enterica subsp. enterica serovar Enteritidis str. P125109
36% identity, 23% coverage
- Global transcriptomic analysis of ethanol tolerance response in Salmonella Enteritidis
He, Current research in food science 2022 - “...5.13 Phosphotransferase enzyme II, C component SEN2673 srlA 2.83 PTS system glucitol/sorbitol-specific transporter subunit IIBC SEN2197 fruA 3.09 Fructose PTS system EIIA component SEN2675 slrB 5.09 PTS system glucitol/sorbitol-specific transporter subunit IIA SEN2674 srlE 4.91 PTS system glucitol/sorbitol-specific transporter subunit IIBC SEN3875 glpX 2.11 Fructose-1,6-bisphosphatase I...”
- “...5.13 Phosphotransferase enzyme II, C component SEN1205 manZ 6.52 PTS system mannose-specific transporter subunit IID SEN2197 fruA 3.09 Fructose PTS system EIIA component SEN2673 srlA 2.83 PTS system glucitol/sorbitol-specific transporter subunit IIBC SEN2675 slrB 5.09 PTS system glucitol/sorbitol-specific transporter subunit IIA SEN2674 srlE 4.91 PTS system...”
FrvB / b3899 putative PTS enzyme IIBC component FrvB from Escherichia coli K-12 substr. MG1655 (see 4 papers)
frvB / P32154 putative PTS enzyme IIBC component FrvB from Escherichia coli (strain K12) (see 3 papers)
TC 4.A.2.1.25 / P32154 Fructose-like PTS system EIIBC component, component of Fructose-like PTS Enzyme II complex, FrvA (IIA of 148 aas) - FrvB (IIBC of 483 aas and 9 predicted TMSs) from Escherichia coli (strain K12)
45% identity, 19% coverage
A0J47_RS05670 fructose-specific PTS transporter subunit EIIC from Photobacterium damselae subsp. damselae
36% identity, 17% coverage
c2702 PTS system, fructose-specific IIBC component from Escherichia coli CFT073
40% identity, 19% coverage
CTK_C06320 fructose-specific PTS transporter subunit EIIC from Clostridium tyrobutyricum
44% identity, 15% coverage
- Deciphering Clostridium tyrobutyricum Metabolism Based on the Whole-Genome Sequence and Proteome Analyses
Lee, mBio 2016 - “...ATPase domain 3 0.99 4.67 2 CTK_C29270 Transcription elongation factor GreA 2 0.65 3.90 3 CTK_C06320 Fructose-specific PTS (phosphotransferase system) system enzyme IIABC component 4 3.16 3.70 4 CTK_C06300 Predicted transcriptional regulator, DeoR family 2 3.23 3.63 5 CTK_C06310 1-Phosphofructokinase 5 3.27 3.33 6 CTK_C21760 Anaerobic-type...”
- “...major route for glucose transport in C.tyrobutyricum . In addition to glucose transporters, fructose-specific PTS (CTK_C06320; enzyme IIABC [EIIABC]) was abundantly expressed at the early exponential phase (C2), but its expression level decreased dramatically at the later phases ( Table3 ). This transient expression of the...”
Q5A_017065 PTS fructose transporter subunit IIBC from Serratia inhibens PRI-2C
47% identity, 14% coverage
ESA_03303 hypothetical protein from Enterobacter sakazakii ATCC BAA-894
ESA_03303 fructose-specific PTS transporter subunit EIIC from Cronobacter sakazakii ATCC BAA-894
39% identity, 17% coverage
Z3425 PTS system, fructose-specific transport protein from Escherichia coli O157:H7 EDL933
40% identity, 20% coverage
T256_00805 fructose-specific PTS transporter subunit EIIC from Pediococcus pentosaceus SL4
41% identity, 15% coverage
SF5M90T_2185 PTS fructose transporter subunit IIBC from Shigella flexneri 5a str. M90T
39% identity, 20% coverage
- RNA-seq analysis of the influence of anaerobiosis and FNR on Shigella flexneri
Vergara-Irigaray, BMC genomics 2014 - “...fructose-1-phosphate kinase -1.75 SF5M90T_3161 ptsO phosphocarrier protein NPr -1.76 SF5M90T_1637 putative transport protein -1.93 1.58 SF5M90T_2185 fruA PTS system, fructose-specific transport protein -1.99 Aminoacid transport and metabolism SF5M90T_2823 argA N-acetylglutamate synthase 1.94 SF5M90T_1910 fliY putative periplasmic binding transport protein 1.80 SF5M90T_625 ybgH peptide transporter 1.64 -1.60...”
MGA_0508 PTS system fructose-specific transporter subunit EIIABC from Mycoplasma gallisepticum str. R(low)
40% identity, 14% coverage
- Comparative genomic analyses of attenuated strains of Mycoplasma gallisepticum
Szczepanek, Infection and immunity 2010 - “...the fructose/mannose-specific IIABC component gene fruA (MGA_0508) (60) of the phosphoenolpyruvate:fructose phosphotransferase system (PTS) are likely inactive,...”
- “...promoter region Intergenic, VlhA3.09 promoter region MGA_0508, fructose-specific PTS component CRISPR CRISPR Intergenic, MGA_0536 ATPase and MGA_0537 hsdM...”
FruA / b2167 fructose-specific PTS multiphosphoryl transfer protein FruA from Escherichia coli K-12 substr. MG1655 (see 4 papers)
fruA / P20966 fructose-specific PTS multiphosphoryl transfer protein FruA from Escherichia coli (strain K12) (see 2 papers)
PTFBC_ECOLI / P20966 PTS system fructose-specific EIIB'BC component; EIIB'BC-Fru; EC 2.7.1.202 from Escherichia coli (strain K12) (see 3 papers)
TC 4.A.2.1.1 / P20966 PTFB aka FRUA aka PTSF aka B2167, component of Fructose porter (FruAB) (fructose-1-P forming) from Escherichia coli (see 6 papers)
NP_416672 fructose-specific PTS multiphosphoryl transfer protein FruA from Escherichia coli str. K-12 substr. MG1655
b2167 fused fructose-specific PTS enzymes: IIBcomponent/IIC components from Escherichia coli str. K-12 substr. MG1655
38% identity, 20% coverage
- function: The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. The enzyme II FruAB PTS system is involved in fructose transport.
catalytic activity: D-fructose(out) + N(pros)-phospho-L-histidyl-[protein] = D- fructose 1-phosphate(in) + L-histidyl-[protein] (RHEA:49252) - substrates: fructose
- A preliminary X-ray study of a refolded PTS EIIBfruc protein from Escherichia coli.
Shin, Protein and peptide letters 2008 (PubMed)- GeneRIF: The synchrotron data were collected to 2.6 A from the crystal of a selenomethionine substitute PTS EIIB(fruc) protein.
- Transcriptomic analysis of multi-drug resistant Escherichia coli K-12 strain in response to Lavandula angustifolia essential oil
Lai, 3 Biotech 2020 - “...of occurrence Gene expression changes 1 2 3 4 5 6 P20966 P05706 P56580 P56579 P05707 P27128 fruA srlB srlE srlA srlD waaO 5 5 5 5 3 1 Up-regulation...”
- Cloning, sequencing, and characterization of genomic subtracted sequences from Listeria monocytogenes
Wu, Applied and environmental microbiology 1999 - “...components from E. coli (accession no. P20966), Xanthomonas campestris (P23355), Rhodobacter capsulatus (P23387), and Bacillus amyloliquefaciens (P41029). (B)...”
- The two-component system histidine kinase EnvZ contributes to Avian pathogenic Escherichia coli pathogenicity by regulating biofilm formation and stress responses
Fu, Poultry science 2023 - “...srlB PTS system, glucitol/sorbitol-specific IIA component 2.00 b2702 srlA PTS system, glucitol/sorbitol-specific IIC2 component 1.19 b2167 fruA PTS system, fructose-specific IIBC component 1.93 b1737 celB PTS system, cellobiose-specific IIC component 1.59 b3599 mtlA Fused mannitol-specific PTS enzymes: IIA components/IIB components/IIC components 1.61 b1738 celA PTS system,...”
- Escherichia coli gene expression responsive to levels of the response regulator EvgA
Masuda, Journal of bacteriology 2002 - “...proP b4113 basR b4115 yjdE Decreased expression b0553 nmpC b2167 b2168 b2169 fruA fruK fruB b2943 galP Mean Outer membrane porin protein; locus of qsr prophage...”
SE0472 PTS system fructose-specific IIABC component from Staphylococcus epidermidis ATCC 12228
F1613_RS05160 PTS fructose transporter subunit IIABC from Staphylococcus epidermidis
44% identity, 14% coverage
- Identification of antigenic components of Staphylococcus epidermidis expressed during human infection
Pourmand, Infection and immunity 2006 - “...hypothetical protein Dehydrogenase 40 465589-467653 SE0472 (591-650) SE0473 (1-390) Phosphotransferase system fructose-specific IIABC component...”
- Genome-wide transcription response of Staphylococcus epidermidis to heat shock and medically relevant glucose levels
Benjamin, Frontiers in microbiology 2024 - “...kinase), lacB , and lacA ), ribose transport ( rbsU , rbsD ), fructose utilization (F1613_RS05160 (PTS fructose transporter subunit IIABC), pfkB , and F1613_RS05150 (DeoR/GlpR family DNA-binding transcription regulator)), proline catabolism (F1613_RS09950 (proline dehydrogenase)), the glyoxalase pathway (F1613_RS05685 (glyoxalase)), the succinate dehydrogenase complex (F1613_RS07025 (succinate...”
- “...role in the utilization of fructose, (F1613_RS05150 (DeoR/GlpR family DNA-binding transcription regulator), pfkB , and F1613_RS05160 (PTS fructose transporter subunit IIABC)) ( Ge et al., 2024 ; Supplementary Table S6 ). We found that L-serine ammonia-lyase ironsulfur-dependent subunits alpha and beta ( sdaAA and sdaAB ),...”
VC1823 PTS system, fructose-specific IIB component from Vibrio cholerae O1 biovar eltor str. N16961
45% identity, 62% coverage
APJL_0359 phosphotransferase system, fructose-specific IIC component from Actinobacillus pleuropneumoniae serovar 3 str. JL03
40% identity, 20% coverage
Ldb2040 PTS system, fructose-specific enzyme IIABC component from Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842
36% identity, 19% coverage
D9QAX8 PTS transporter subunit EIIA from Corynebacterium pseudotuberculosis (strain C231)
47% identity, 15% coverage
- Changes in protein abundance are observed in bacterial isolates from a natural host
Rees, Frontiers in cellular and infection microbiology 2015 - “...transport and metabolism D9QAU4 rnd CpC231_1194 Ribonuclease D 1.427 * Translation ribosomal structure and biogenesis D9QAX8 ptsF CpC231_1229 PTS system fructose-specific EIIABC component 0.108 2.542 * 2.665 * Carbohydrate transport and metabolism D9QBD3 ftsQ CpC231_1388 Cell division protein FtsQ 1.030 * 0.029 Cell wall/membrane/envelope biogenesis D9QBF3...”
SEN3672 probable PTS system permease from Salmonella enterica subsp. enterica serovar Enteritidis str. P125109
54% identity, 16% coverage
- Whole genome sequencing provides insights into the genetic determinants of invasiveness in Salmonella Dublin
Mohammed, Epidemiology and infection 2016 - “...S. Enteritidis. encoding probable phosphotransferase system permease (SEN3672). In addition mglA (SEN2182) appear to be inactive in all host-adapted typhoidal...”
- “...system permease SEN0784 SEN2182* SEN2783 SEN2806 SEN3461 SEN3672 Enteritidis (PT4) Dublin (Irish isolates) Gallinarum (287/91) Cholerasuis (C500) Typhi (CT18)...”
- Genomic Comparison of the Closely Related Salmonella enterica Serovars Enteritidis and Dublin
Betancor, The open microbiology journal 2012 - “...the gene encoding the outer membrane usher protein LpfC (SEN3461), one probable phosphotransferase system permease (SEN3672), one gene encoding a putative Type I restriction modification system protein (SEN4290), and the gene encoding a probable glucarate dehydratase 2 (SEN2806 or ygcY ). The other two genes that...”
- “...CTTCCCGGACGCGCGTAT Forward2 AACCTGCATTTCAGTCACTACAG Reverse SEN3461 TTTGGCACGGCTGGCGACAT Forward GAATGCCCTGCTGGTGGATT Forward2 CGTGCCGGGAACTATAACAG Forward3 AGCACCGACCCGCCCAACA Reverse GCCGCGCAAACCGTAGTTCA Reverse2 SEN3672 GGCCTGGTCACGTCTGTAAC Forward CTCTCTTTTGTCTTCGGTATCC Forward2 TATGACGGTTTGATGACAATGG Reverse SEN4290 AACGCTTGAGGATTTAATAGAA Forward CTGATTCAGTACCGTCAGTG Reverse Table 3. Regions (Reg) and Single Genes (Sing) that form the S. Enteritidis Core Genome but Appear as Absent/Divergent...”
LBA1777 PTS system, fructose-specific enzyme II from Lactobacillus acidophilus NCFM
36% identity, 18% coverage
VC1826 PTS system, fructose-specific IIABC component from Vibrio cholerae O1 biovar eltor str. N16961
37% identity, 18% coverage
- A mannose-sensing AraC-type transcriptional activator regulates cell-cell aggregation of Vibrio cholerae
Lee, NPJ biofilms and microbiomes 2022 - “...carbohydrates, including glucose, fructose, mannose, and N-acetylglucosamine 12 15 . The PTS transporter encoded by VC1826 has been annotated as a putative fructose PTS transporter as it comprises the fructose-family EIIABC domains. However, recent reports suggest that VC1826 is a mannose PTS transporter as the deletion...”
- “...13 . According to the transcriptome analysis of V. cholerae , the transcription level of VC1826 was significantly higher than that of genes encoding other PTS transporters during infection in rabbits and mice 16 . Moreover, a transposon insertion mutation in VC1826 decreases virulence in the...”
- Vibrio cholerae FruR facilitates binding of RNA polymerase to the fru promoter in the presence of fructose 1-phosphate
Yoon, Nucleic acids research 2021 - “...then channeled towards glycolysis following the activity of 1-phosphofructokinase (FruK) to yield fructose 1,6-bisphosphate (FBP). VC1826 was also shown to transport fructose ( 28 ). ( B ) Growth curves of in-frame deletion mutants of fruB , fruK , fruA , and fruR in M9 medium...”
- “...(TECAN). ( C ) The relative mRNA expression of fru operon genes, fruR , and VC1826 in the wild-type V. cholerae N16961 (left) and a fruR mutant (right) grown on fructose. The mRNA expression levels of indicated genes are shown as relative values (log 2 scale)...”
- Identification of Small Molecule Inhibitors of the Pathogen Box against Vibrio cholerae
Kim, Microbiology spectrum 2021 - “...was genes involved in carbon metabolism/transport. A few of the most downregulated genes, vc1820 , vc1826 , and vc1821 , are involved in the uptake of fructose. Iron homeostasis/transport showed the most upregulated number of genes along with ribosomal proteins ( Fig.2A ). These include vca0676...”
- Cra and cAMP Receptor Protein Have Opposing Roles in the Regulation of fruB in Vibrio cholerae
Beck, Journal of bacteriology 2021 - “...-specific components in V. cholerae are encoded by genes located at two distinct loci. First, VC1826 encodes an EIIABC fusion protein that is capable of both fructose and mannose transport ( 7 , 11 ). VCA0516, VCA0517, and VCA0518 make up the second locus encoding PTS...”
- Systematic genetic dissection of PTS in Vibrio cholerae uncovers a novel glucose transporter and a limited role for PTS during infection of a mammalian host
Hayes, Molecular microbiology 2017 - “...sources as well as redundancy amongst PTS transporters. For example, we find that VC2013 and VC1826 are independently capable of supporting growth in minimal medium supplemented with mannose as the sole carbon source ( Fig. 1D and Table 1 ) ( Houot et al ., 2010a...”
- “...such, also supports growth on glucose as the sole carbon source ( Table 1 ). VC1826 on the other hand is also capable of supporting growth when fructose is supplied as the sole carbon source ( Fig. 1E and Table 1 ). Thus, this analysis has...”
- A novel phase variant of the cholera pathogen shows stress-adaptive cryptic transcriptomic signatures
Lambert, BMC genomics 2016 - “...phosphotransferase system (PTS), including VCA0653 ( srcA ), which encodes a sucrose-specific PTS component and VC1826, which encodes a putative fructose-specific PTS component, were both down-regulated at least 30 fold on the N16961 to N16961R switch and then up-regulated in the N16961R to N16961SD switch (Additional...”
- Mannitol and the mannitol-specific enzyme IIB subunit activate Vibrio cholerae biofilm formation
Ymele-Leki, Applied and environmental microbiology 2013 - “...EII components of the PTS. In particular, VC1826 encoding the IIABC mannose permease (EIIMan), mtlA (VCA1045) encoding the IIABC mannitolspecific transporter...”
- Phase variable O antigen biosynthetic genes control expression of the major protective antigen and bacteriophage receptor in Vibrio cholerae O1
Seed, PLoS pathogens 2012 - “...hereafter designated manA-2 . manA-2 is located immediately downstream of a mannose permease encoded by VC1826 [46] , but is not linked to the O1 antigen biosynthetic cluster. manA and manA-2 are 65% identical at the nucleotide level over 70% of their sequence, and at the...”
- More
MSMEG_0085 PTS system, Fru family protein, IIABC components from Mycobacterium smegmatis str. MC2 155
44% identity, 18% coverage
lp_2097 fructose-specific PTS transporter subunit EIIC from Lactiplantibacillus plantarum WCFS1
lp_2097 fructose PTS, EIIABC from Lactobacillus plantarum WCFS1
41% identity, 15% coverage
- Butanol Tolerance of Lactiplantibacillus plantarum: A Transcriptome Study
Petrov, Genes 2021 - “...in Ym1 FC * in 8-1 lp_0230, pts2CB PTS mannitol transporter subunit IICBA +6.48 3.22 lp_2097, fruA PTS transporter subunit EIIA +4.35 +2.48 lp_3654, pts38C PTS sorbitol transporter subunit IIC +2.29 NC lp_0286, pts6C PTS cellobiose transporter subunit IIC +2.55 NC lp_2531, pts18CBA PTS transporter subunit...”
- Oleuropein Transcriptionally Primes Lactobacillus plantarum to Interact With Plant Hosts
Santamaría, Frontiers in microbiology 2019 - “...lp_0286 , pts20A or lp_2780 , pts20B or lp_2781 ) and fructose ( pts16ABC or lp_2097 ) were all induced in presence of OLE. In addition, the maltose proton transporter ( malT or lp_1729 ) was also up-regulated. In contrast, two PTS systems involved in the...”
- Identification of prebiotic fructooligosaccharide metabolism in Lactobacillus plantarum WCFS1 through microarrays
Saulnier, Applied and environmental microbiology 2007 - “...lp_1273 lp_1274 lp_1398 lp_1481 lp_1498 lp_1499 lp_2096 lp_2097 lp_2151 lp_2152 lp_2153 lp_2154 lp_2371 lp_2757 lp_2684 lp_2776 lp_2794 lp_2920 lp_2969 lp_3010...”
NJ74_RS03620 PTS 2-O-a-mannosyl-D-glycerate transporter subunit IIABC from Escherichia coli DH5[alpha]
41% identity, 15% coverage
MngA 2-O-α-mannosyl-D-glycerate specific PTS enzyme II (EC 2.7.1.195) from Escherichia coli K-12 substr. MG1655 (see 6 papers)
MngA / P54745 2-O-α-mannosyl-D-glycerate specific PTS enzyme II (EC 2.7.1.195) from Escherichia coli (strain K12) (see 5 papers)
MNGA_ECOLI / P54745 PTS system 2-O-alpha-mannosyl-D-glycerate-specific EIIABC component; 2-O-alpha-mannosyl-D-glycerate-specific phosphotransferase enzyme MngA; Protein-Npi-phosphohistidine--2-O-alpha-mannosyl-D-glycerate phosphotransferase; EC 2.7.1.195 from Escherichia coli (strain K12) (see 2 papers)
P54745 protein-Npi-phosphohistidine-2-O-alpha-mannosyl-D-glycerate phosphotransferase (EC 2.7.1.195) from Escherichia coli (see paper)
TC 4.A.2.1.3 / P54745 The 2-O-α-mannosyl D-glycerate porter (2-O-α-mannosyl D-glycerate-6-P forming), MngA (HrsA) from Escherichia coli (see 5 papers)
41% identity, 14% coverage
- function: The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane (PubMed:14645248, PubMed:9063979). This system is involved in mannosyl- D-glycerate transport (PubMed:14645248). Also involved in thermoinduction of ompC (PubMed:9063979).
catalytic activity: (2R)-2-O-(alpha-D-mannosyl)-glycerate(out) + N(pros)-phospho- L-histidyl-[protein] = (2R)-2-O-(6-phospho-alpha-D-mannosyl)- glycerate(in) + L-histidyl-[protein] (RHEA:33307)
disruption phenotype: Cells lacking this gene are unable to transport mannosyl-D-glycerate. - substrates: 2-O-alpha-mannosyl D-glycerate
tcdb comment: The phosphorylated product is hydrolyzed to manose-6-P and glycerate by MngB, an α-mannosidase
D8ID87 PTS system, fructose-specific, IIABC component from Brachyspira pilosicoli (strain ATCC BAA-1826 / 95/1000)
43% identity, 15% coverage
- The Exposed Proteomes of Brachyspira hyodysenteriae and B. pilosicoli
Casas, Frontiers in microbiology 2016 - “...system glucose subfamily IIA subunit 90 D8IBR5 ptsG BRAPL PTS system fructose-specific IIABC component 88 D8ID87 fruA BRAPL Transcriptional regulator XRE family 86 J9TSW8 B2904_orf609 BRAPL PTS system fructose specific transporter subunit IIABC 83 K0JLH4 WESB_2470 BRAPL Methyl-accepting protein 80 D8IBS9 , C0R060 BP951000_0603, tar5 C...”
WESB_2470 fructose-specific PTS transporter subunit EIIC from Brachyspira pilosicoli WesB
K0JLH4 PTS system fructose-specific transporter subunit IIABC from Brachyspira pilosicoli WesB
43% identity, 15% coverage
- The Exposed Proteomes of Brachyspira hyodysenteriae and B. pilosicoli
Casas, Frontiers in microbiology 2016 - “...XRE family 86 J9TSW8 B2904_orf609 BRAPL PTS system fructose specific transporter subunit IIABC 83 K0JLH4 WESB_2470 BRAPL Methyl-accepting protein 80 D8IBS9 , C0R060 BP951000_0603, tar5 C Unchar J9UB61 79 J9UB61 B2904_orf310 BRAPL Transcriptional regulator CarD family 71 D8ID15 carD BRAPL * The members column lists protein...”
- The Exposed Proteomes of Brachyspira hyodysenteriae and B. pilosicoli
Casas, Frontiers in microbiology 2016 - “...regulator XRE family 86 J9TSW8 B2904_orf609 BRAPL PTS system fructose specific transporter subunit IIABC 83 K0JLH4 WESB_2470 BRAPL Methyl-accepting protein 80 D8IBS9 , C0R060 BP951000_0603, tar5 C Unchar J9UB61 79 J9UB61 B2904_orf310 BRAPL Transcriptional regulator CarD family 71 D8ID15 carD BRAPL * The members column lists...”
VSAL_II0894 fructose-specific PTS transporter subunit EIIC from Aliivibrio salmonicida LFI1238
VSAL_II0894 PTS system, IIBC component from Vibrio salmonicida LFI1238
35% identity, 17% coverage
HGB56_02940 fructose-specific PTS transporter subunit EIIC from Lactiplantibacillus plantarum
41% identity, 15% coverage
- The Carbohydrate Metabolism of Lactiplantibacillus plantarum
Cui, International journal of molecular sciences 2021 - “...LP-F1 contained multiple phosphotransferase systems (PTSs) responsible for fructose transport, which were encoded by fruA (HGB56_02940), fruA1-fruA2-fruB (HGB56_07725, HGB56_07730, HGB56_07735), pts9ABCD (HGB56_11950, HGB56_11955, HGB56_11960) and pts10AB (HGB56_11975, HGB56_11980) genes, respectively ( Supplementary Table S3-4 ). Fructose enters cells in the form of 6-phosphate-fructose through these PTSs,...”
LGG_02647 PTS system, fructose-specific IIABC component from Lactobacillus rhamnosus GG
42% identity, 15% coverage
YP_003171105 PTS system, mannitol/fructose-specific IIABC component from Lactobacillus rhamnosus GG
44% identity, 14% coverage
- Growth Mode and Carbon Source Impact the Surfaceome Dynamics of Lactobacillus rhamnosus GG
Savijoki, Frontiers in microbiology 2019 - “...secretion (MFP/HlyD), amino acid (OppA)/metal ion intake/output proteins (YP_003172665.1, YP_003169947.1, YP_003169947.1, YP_003170942.1, YP_003172169.1, YP_003170075.1, and YP_003171105) and two penicillin-binding proteins (PbP2 and PbP2X-like/FtsI). In addition, two phosphoglycerol transferase (MdoB) paralogs of different sizes (78 and 84 kDa) and an r-protein, RplX, were detected as candidate moonlighting...”
T256_05730 fructose-specific PTS transporter subunit EIIC from Pediococcus pentosaceus SL4
38% identity, 20% coverage
LMOf6854_2852 PTS system, fructose-specific, IIABC component from Listeria monocytogenes str. 1/2a F6854
LMRG_01963 PTS system, fructose-specific, IIABC component from Listeria monocytogenes 10403S
37% identity, 18% coverage
- In vivo transcriptional profiling of Listeria monocytogenes and mutagenesis identify new virulence factors involved in infection
Camejo, PLoS pathogens 2009 - “...transcription regulator LMOf6854_2788 LMOf2365_2652 LMOh7858_2935 2,31 lmo2733 lmo2733 similar to PTS system, fructose-specific IIABC component LMOf6854_2852 LMOf2365_2720 LMOh7858_2997 2,35 lmo2736 lmo2736 unknown protein LMOf6854_2855 LMOf2365_2723 LMOh7858_3000 2,48 lmo1081 lmo1081 similar to glucose-1-phosphate thymidyl transferase LMOf6854_1134 8,25 5,99 5,17 lmo1082 lmo1082 similar to dTDP-sugar epimerase LMOf6854_1135 47,21...”
- Home Alone: Elimination of All but One Alternative Sigma Factor in Listeria monocytogenes Allows Prediction of New Roles for σB
Liu, Frontiers in microbiology 2017 - “...GATT GATT GTTT NF ATTT NF 10 signal TGGAAT TGGAAT TGGAAT TGGAGT NF TGGAAT NF LMRG_01963 35 signal GTTT GTTT GTTT NF NF NF NF 10 signal AGCAAT GGCAAT GGCAAT NF NF NF NF LMRG_01913 35 signal GTTT GTTT GTTT GTTT GTTT GTTT NF 10 signal...”
- Deep RNA sequencing of L. monocytogenes reveals overlapping and extensive stationary phase and sigma B-dependent transcriptomes, including multiple highly transcribed noncoding RNAs
Oliver, BMC genomics 2009 - “...proteins 2.63 4.87 1.79 LMRG_01151 lmo2003 similar to transcription regulator GntR family 14.67 3.15 0.32 LMRG_01963 lmo2733 similar to PTS system, fructose-specific IIABC component 7.95 1.35 0.32 Noncoding ND putative ncRNA, sbrE 186.09 2359.89 20.95 B -dependent genes with Average GEI 25 in 10403S Noncoding ND...”
LMOf2365_2720 PTS system, fructose-specific, IIABC component from Listeria monocytogenes str. 4b F2365
LMOh7858_2997 PTS system, fructose-specific, IIABC component from Listeria monocytogenes str. 4b H7858
37% identity, 18% coverage
- In vivo transcriptional profiling of Listeria monocytogenes and mutagenesis identify new virulence factors involved in infection
Camejo, PLoS pathogens 2009 - “...regulator LMOf6854_2788 LMOf2365_2652 LMOh7858_2935 2,31 lmo2733 lmo2733 similar to PTS system, fructose-specific IIABC component LMOf6854_2852 LMOf2365_2720 LMOh7858_2997 2,35 lmo2736 lmo2736 unknown protein LMOf6854_2855 LMOf2365_2723 LMOh7858_3000 2,48 lmo1081 lmo1081 similar to glucose-1-phosphate thymidyl transferase LMOf6854_1134 8,25 5,99 5,17 lmo1082 lmo1082 similar to dTDP-sugar epimerase LMOf6854_1135 47,21 24,06...”
- In vivo transcriptional profiling of Listeria monocytogenes and mutagenesis identify new virulence factors involved in infection
Camejo, PLoS pathogens 2009 - “...LMOf6854_2788 LMOf2365_2652 LMOh7858_2935 2,31 lmo2733 lmo2733 similar to PTS system, fructose-specific IIABC component LMOf6854_2852 LMOf2365_2720 LMOh7858_2997 2,35 lmo2736 lmo2736 unknown protein LMOf6854_2855 LMOf2365_2723 LMOh7858_3000 2,48 lmo1081 lmo1081 similar to glucose-1-phosphate thymidyl transferase LMOf6854_1134 8,25 5,99 5,17 lmo1082 lmo1082 similar to dTDP-sugar epimerase LMOf6854_1135 47,21 24,06 21,01...”
lmo2733 similar to PTS system, fructose-specific IIABC component from Listeria monocytogenes EGD-e
37% identity, 18% coverage
- DegU-mediated suppression of carbohydrate uptake in Listeria monocytogenes increases adaptation to oxidative stress
Chen, Applied and environmental microbiology 2023 (secret) - Listeria monocytogenes GshF contributes to oxidative stress tolerance via regulation of the phosphoenolpyruvate-carbohydrate phosphotransferase system
Chen, Microbiology spectrum 2023 - “...cellbiose transporter subunit IIA lmo2708 2.68 Yes/down 7.10 Yes/down lmo2708 PTS cellbiose transporter subunit IIC lmo2733 1.13 Yes/up 1.24 Yes/down lmo2733 PTS fructose transporter subunit IIABC lmo2762 2.93 Yes/down lmo2762 PTS cellbiose transporter subunit IIB lmo2763 2.32 Yes/down lmo2763 PTS cellbiose transporter subunit IIC lmo2765 2.78...”
- New Insights into the Lactic Acid Resistance Determinants of Listeria monocytogenes Based on Transposon Sequencing and Transcriptome Sequencing Analyses
Liu, Microbiology spectrum 2023 - “...cellobiose transporter subunit IIA 0.0828 6.78E-50 lmo2708 lmo2708 PTS cellobiose transporter subunit IIC 0.4097 3.16E-10 lmo2733 lmo2733 PTS fructose transporter subunit IIABC 0.4917 9.23E-05 lmo2762 lmo2762 PTS cellobiose transporter subunit IIB 0.0644 3.57E-06 lmo2763 lmo2763 PTS cellobiose transporter subunit IIC 0.1640 1.13E-16 lmo2765 lmo2765 PTS cellobiose...”
- YjbH mediates the oxidative stress response and infection by regulating SpxA1 and the phosphoenolpyruvate-carbohydrate phosphotransferase system (PTS) in Listeria monocytogenes
Cheng, Gut microbes 2021 - “...Yes lmo2685 PTS cellbiose-specific enzyme IIB 2.16 Yes lmo2683 PTS cellbiose-specific enzyme IIB 2.09 Yes lmo2733 PTS fructose-specific enzyme IIABC 2.00 Yes lmo0914 PTS cellbiose-specific enzyme IIB 1.79 Yes lmo2373 PTS beta-glucoside-specific enzyme IIB 1.65 Yes lmo2772 PTS glucose/sucrose-specific enzyme IIB 1.52 Yes lmo1035 PTS beta-glucoside-specific...”
- Phosphotransferase system-dependent extracellular growth of listeria monocytogenes is regulated by alternative sigma factors σL and σH
Wang, Applied and environmental microbiology 2014 - “...pts genes, including lmo0021, lmo0027, lmo0398 to lmo0400, lmo2733, lmo0631, and lmo2665 (13, 14). The growth of L. monocytogenes is positively affected by the...”
- Comparative genomics and transcriptomics of lineages I, II, and III strains of Listeria monocytogenes
Hain, BMC genomics 2012 - “...systems ( lmo0021-lmo0024 , lmo0781-lmo0784 , lmo1997-lmo2002 ), two fructose specific systems ( lmo2335 and lmo2733 ), two galacitol specific systems ( lmo0503 , lmo0507 , lmo0508 and lmo2665-lmo2667 ), two beta-glucoside systems (the partial system lmo0373-lmo0374 and lmo0874-lmo0876 ), and two cellobiose specific systems (the...”
- Probing the pan-genome of Listeria monocytogenes: new insights into intraspecific niche expansion and genomic diversification
Deng, BMC genomics 2010 - “...associated with fructose-specific PTS enzyme II components ( lmo0357-0358 , lmo0631-0633 , lmo2135-2137 , and lmo2733 ). We surveyed the distribution of 978 annotated PTS genes and their homologs in all 26 L. monocytogenes genomes, and found 965 (99%) PTS genes are conserved in all LI...”
- “...fructose-specific enzyme IIA component IIIA + - lmo2143 Similar to mannose-6-phosphate isomerase IIIA - - lmo2733 Similar to PTS system, fructose-specific IIABC component IIIA + 494 lmo2734 Similar to sugar hydrolase IIIA + 494 lmo2735 Similar to Sucrose phosphorylase IIIA + 494 lmo2736 Hypothetical protein IIIA...”
- In vivo transcriptional profiling of Listeria monocytogenes and mutagenesis identify new virulence factors involved in infection
Camejo, PLoS pathogens 2009 - “...LMOf2365_2290 LMOh7858_2400 4,62 3,99 lmo2672 lmo2672 weakly similar to transcription regulator LMOf6854_2788 LMOf2365_2652 LMOh7858_2935 2,31 lmo2733 lmo2733 similar to PTS system, fructose-specific IIABC component LMOf6854_2852 LMOf2365_2720 LMOh7858_2997 2,35 lmo2736 lmo2736 unknown protein LMOf6854_2855 LMOf2365_2723 LMOh7858_3000 2,48 lmo1081 lmo1081 similar to glucose-1-phosphate thymidyl transferase LMOf6854_1134 8,25 5,99...”
- “...) -specific PTS encoding genes [63] were up regulated in vivo . Inversely, fructose ( lmo2733 ), galactitol ( lmo2665 ) and mannitol ( lmo2649 ) -specific PTS encoding genes appeared down regulated. Among the genes involved in bacterial ion uptake systems, a potassium-transporting ATPase encoding...”
- More
TC 4.A.2.1.13 / Q0S1N2 The fructose-specific PTS Enzyme IIABC FruA from Rhodococcus sp. (strain RHA1) (see paper)
42% identity, 16% coverage
lmo2136 similar to PTS system, fructose-specific enzyme IIB component from Listeria monocytogenes EGD-e
43% identity, 54% coverage
HGB56_07730 PTS fructose transporter subunit IIB from Lactiplantibacillus plantarum
41% identity, 66% coverage
- The Carbohydrate Metabolism of Lactiplantibacillus plantarum
Cui, International journal of molecular sciences 2021 - “...phosphotransferase systems (PTSs) responsible for fructose transport, which were encoded by fruA (HGB56_02940), fruA1-fruA2-fruB (HGB56_07725, HGB56_07730, HGB56_07735), pts9ABCD (HGB56_11950, HGB56_11955, HGB56_11960) and pts10AB (HGB56_11975, HGB56_11980) genes, respectively ( Supplementary Table S3-4 ). Fructose enters cells in the form of 6-phosphate-fructose through these PTSs, then 6-phosphate-fructose is...”
HI0446 PTS system, fructose-specific IIBC component (fruA) from Haemophilus influenzae Rd KW20
40% identity, 17% coverage
LMRG_00049 hypothetical protein from Listeria monocytogenes 10403S
lmo0358 similar to PTS system, fructose-specific enzyme IIBC component from Listeria monocytogenes EGD-e
36% identity, 25% coverage
- Identification of Listeria monocytogenes determinants required for biofilm formation
Alonso, PloS one 2014 - “...General growth-defective plsX lmrg_00956 840.21 2 1 Catalase lmrg_01912 970.47 5 3 Unknown functions Hypothetical lmrg_00049 850.42 1 1 Hypothetical lmrg_02457 890.03 1 1 Adenyl synthase lmrg_02487 1000.35 1 1 Efflux protein lmrg_01872 950.12 1 1 Hypothetical protein lmrg_01206 870.14 1 1 Motility fliQ lmrg_00365 1000.20...”
- DegU-mediated suppression of carbohydrate uptake in Listeria monocytogenes increases adaptation to oxidative stress
Chen, Applied and environmental microbiology 2023 (secret) - Listeria monocytogenes GshF contributes to oxidative stress tolerance via regulation of the phosphoenolpyruvate-carbohydrate phosphotransferase system
Chen, Microbiology spectrum 2023 - “...IIB lmo0301 lmo0301 PTS beta-glucoside transporter subunit IIA lmo0357 lmo0357 PTS sugar transporter subunit IIA lmo0358 1.89 Yes/down lmo0358 PTS fructose transporter subunit IIBC lmo0373 2.47 Yes/down lmo0373 PTS beta-glucoside transporter subunit IIC lmo0374 2.43 Yes/down lmo0374 PTS beta-glucoside transporter subunit IIB lmo0398 3.27 Yes/down 3.27...”
- New Insights into the Lactic Acid Resistance Determinants of Listeria monocytogenes Based on Transposon Sequencing and Transcriptome Sequencing Analyses
Liu, Microbiology spectrum 2023 - “...beta-glucoside transporter subunit IIA 0.0549 2.20E-06 lmo0357 lmo0357 PTS sugar transporter subunit IIA 0.3374 1.68E-03 lmo0358 lmo0358 PTS fructose transporter subunit IIBC 0.2495 2.06E-04 lmo0374 lmo0374 PTS beta-glucoside transporter subunit IIB 0.2696 4.37E-03 lmo0399 lmo0399 PTS fructose transporter subunit IIB 0.1191 4.36E-10 lmo0400 lmo0400 PTS fructose...”
- Transcriptomic Analysis of the Adaptation of Listeria monocytogenes to Lagoon and Soil Matrices Associated with a Piggery Environment: Comparison of Expression Profiles
Vivant, Frontiers in microbiology 2017 - “...involved in glycerol ( lmo1539 ), galactitol ( lmo2667 ), fructose ( lmo0039, lmo0400 and lmo0358 ), and maltose-maltodextrin ( lmo2123-24-25 ) uptake. Moreover, arabinose and lactose transcriptional regulators ( lmo2851 and lmo1727 , respectively) and a xylose repressor ( lmo0178 ) were identified in the...”
- Probing the pan-genome of Listeria monocytogenes: new insights into intraspecific niche expansion and genomic diversification
Deng, BMC genomics 2010 - “...Carbohydrate transport and metabolism lmo0357 Similar to PTS system, enzyme IIA component IIIA + 059 lmo0358 Similar to PTS system, fructose-specific enzyme IIBC component IIIA + 059 lmo0359 Similar to D-fructose-1,6-biphosphate aldolase" IIIA + - lmo0631 Similar to PTS system, fructose-specific IIA component IIIA - -...”
- Glycerol metabolism and PrfA activity in Listeria monocytogenes
Joseph, Journal of bacteriology 2008 - “...lmo0343 lmo0344 lmo0345 lmo0346 lmo0347 lmo0348 lmo0358 lmo0384a,b lmo0385 lmo0386b lmo0400 lmo0405 lmo0415 lmo0426a,b lmo0427a,b lmo0428a,b lmo0429a,b lmo0431...”
NCgl1861 fructose-specific PTS transporter subunit EIIC from Corynebacterium glutamicum ATCC 13032
cg2120 sugar specific PTS system, fructose/mannitol-specific transport protein from Corynebacterium glutamicum ATCC 13032
45% identity, 14% coverage
- The DeoR-type transcriptional regulator SugR acts as a repressor for genes encoding the phosphoenolpyruvate:sugar phosphotransferase system (PTS) in Corynebacterium glutamicum
Gaigalat, BMC molecular biology 2007 - “...- 264 28.0 Putative transcriptional regulator protein, DeoR-family cg2119 NCgl1860 fruK 330 34.0 1-phosphofructokinase cg2120 NCgl1861 ptsF 688 70.5 Fructose-specific PTS component, enzyme IIABC cg2121 NCgl1862 ptsH 89 9.1 Phosphocarrier protein HPr, PTS component non clustered cg1537 NCgl1305 ptsG 683 72.6 Glucose-specific PTS component, enzyme IIBCA...”
- “...Hypothetical protein cg2925 NCgl2553 ptsS 3.39 11.87 Phosphotransferase system (PTS), sucrose-specific enzyme IIBCA component cg2120 NCgl1861 ptsF 3.27 12.04 Phosphotransferase system (PTS), fructose-specific enzyme IIABC component cg3107 NCgl2709 adhA 3.23 13.00 Alcohol dehydrogenase cg2118 NCgl1859 - 3.00 12.00 Transcriptional regulator protein, DeoR-family cg1537 NCgl1305 ptsG 2.70...”
- The DeoR-type regulator SugR represses expression of ptsG in Corynebacterium glutamicum
Engels, Journal of bacteriology 2007 - “...the gene of the fructose-specific enzyme II permease ptsF (NCgl1861) and might therefore be involved in the regulation of sugar uptake via the PTS and/or the...”
- Two-component systems of Corynebacterium glutamicum: deletion analysis and involvement of the PhoS-PhoR system in the phosphate starvation response
Kocan, Journal of bacteriology 2006 - “...cg2846 NCgl1444 NCgl1482 NCgl1521 NCgl1646 NCgl1859 NCgl1861 NCgl1915 NCgl1917 NCgl1959 NCgl2001 NCgl2127 NCgl2128 NCgl2393 NCgl2409 NCgl2434 NCgl2439 NCgl2483...”
- Substrate-dependent cluster density dynamics of Corynebacterium glutamicum phosphotransferase system permeases
Martins, Molecular microbiology 2019 - “...the glucosespecific membrane integral EIIBCA transporter, while ptsS (cg2925) encodes the sucrosespecific EIIBCA, and ptsF (cg2120) the fructosespecific EIIABC (Fig. 1 ). A fourth putative PTS belongs to the Lascorbatetype family and is encoded by rmpC (cg3365) (not depicted in the graphic), but no function has...”
- Elastase digests: new ammunition for shotgun membrane proteomics
Rietschel, Molecular & cellular proteomics : MCP 2009 - “...6 74 71 65 62 72 46 22 10 Cg0446 Cg2705 Cg3009 Cg2181 7 47 3 Cg2120 8 9 10 39 8 44 47 46 22 Cg2409 Cg0587 Cg2911 11 12 13 14 15 41 39 30 29 28 22 2 17 9 26...”
- The global repressor SugR controls expression of genes of glycolysis and of the L-lactate dehydrogenase LdhA in Corynebacterium glutamicum
Engels, Journal of bacteriology 2008 - “...gene product, and/or deduced function cg2925 cg2119 cg2120 cg2118 cg2117 cg2121 cg3219 ptsS, sucrose-specific enzyme II of the PTS pfkB, 1-phosphofructokinase...”
- The DeoR-type transcriptional regulator SugR acts as a repressor for genes encoding the phosphoenolpyruvate:sugar phosphotransferase system (PTS) in Corynebacterium glutamicum
Gaigalat, BMC molecular biology 2007 - “...NCgl1859 - 264 28.0 Putative transcriptional regulator protein, DeoR-family cg2119 NCgl1860 fruK 330 34.0 1-phosphofructokinase cg2120 NCgl1861 ptsF 688 70.5 Fructose-specific PTS component, enzyme IIABC cg2121 NCgl1862 ptsH 89 9.1 Phosphocarrier protein HPr, PTS component non clustered cg1537 NCgl1305 ptsG 683 72.6 Glucose-specific PTS component, enzyme...”
- “...to this, all genes of the fructose-PTS gene cluster from cg2117 ( ptsI ) to cg2120 ( ptsH ) showed significantly higher mRNA levels during growth on glucose and fructose. The levels of the genes ptsI and ptsH did not differ between cells grown on glucose...”
- Two-component systems of Corynebacterium glutamicum: deletion analysis and involvement of the PhoS-PhoR system in the phosphate starvation response
Kocan, Journal of bacteriology 2006 - “...NCgl1209 NCgl1210 NCgl1232 cg1695 cg1737 cg1785 cg1930 cg2118 cg2120 cg2181 cg2183 cg2234 cg2283 cg2422 cg2423 cg2726 cg2743 cg2777 cg2782 cg2843 cg2844 cg2845...”
- Global gene expression during stringent response in Corynebacterium glutamicum in presence and absence of the rel gene encoding (p)ppGpp synthase
Brockmann-Gretza, BMC genomics 2006 - “...1.79 sigB RNA polymerase sigma factor K cg2114 1.59 lexA LexA repressor transcriptional regulator KT cg2120 1.53 ptsF PTS system, fructose/mannitol-specific enzyme II G cg2291 1.53 pyk pyruvate kinase G cg2398 1.55 plsC 1-acyl-SN-glycerol-3-phosphate acetyltransferase I cg2403 2.61 qcrB cytochrome B C cg2405 1.69 qcrC cytochrome...”
MG_062 PTS system, fructose-specific IIABC component from Mycoplasma genitalium G37
P47308 PTS system fructose-specific EIIABC component from Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
38% identity, 16% coverage
HMPREF0397_0483, HMPREF0397_RS07860 fructose-specific PTS transporter subunit EIIC from Fusobacterium nucleatum subsp. nucleatum ATCC 23726
36% identity, 15% coverage
MS2178 FruA protein from Mannheimia succiniciproducens MBEL55E
43% identity, 13% coverage
- Mannheimia succiniciproducens phosphotransferase system for sucrose utilization
Lee, Applied and environmental microbiology 2010 - “...ND ND ND 80.9 1.1 22.9 1.07 29.1 1.23 Fructose PTS MS2178 MS0784 MBEL55E2178 (Scr ) MBEL55E0784 (Scr) d d d ND 38.8 1.4 38.8 1.4 Scr and Scr, respectively,...”
- “...hydrolysis of sucrose 6-phosphate. The enzyme encoded by the MS2178 gene showed 58% and 36% homologies to E. coli K-12 and C. glutamicum fructose PTS IIBC...”
YPTB0542 PTS system fructose-like IIB component 2 from Yersinia pseudotuberculosis IP 32953
YPO0402 PTS system, IIB component from Yersinia pestis CO92
38% identity, 62% coverage
LJ0146 phosphoenolpyruvate-dependent sugar phosphotransferase system EIIABC, probable fructose specific from Lactobacillus johnsonii NCC 533
37% identity, 19% coverage
A0KI69 protein-N(pi)-phosphohistidine--D-fructose phosphotransferase from Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
AHA_1431 pts system, fructose-specific iiabc component from Aeromonas hydrophila subsp. hydrophila ATCC 7966
37% identity, 12% coverage
TC 4.A.2.1.9 / Q8FC73 PTS system, fructose-like-2 IIB component 1, component of The FrzABC PTS putative transporter (promotes bacterial fitness under stress conditions and promotes fimbrial (fim) gene expression indirectly (Rouquet et al., 2009). Might transport D-tagatose, D-psicose and/or D-sorbose, or a disaccharide of these (Rouquet et al. 2009); involved in environmental sensing, host adaptation and virulence from Escherichia coli O6 (see paper)
38% identity, 64% coverage
- substrates: Sorbose, Tagatose, psicose
FN1441 PTS system, fructose-specific IIABC component from Fusobacterium nucleatum subsp. nucleatum ATCC 25586
36% identity, 16% coverage
- Fusobacterium nucleatum extracellular vesicles are enriched in colorectal cancer and facilitate bacterial adhesion
Zheng, Science advances 2024 - “...on recipient cell surfaces. Given its ability to facilitate F. nucleatum autoaggregation through interaction with FN1441, the presence of FomA on CRC cell surfaces presents a target for bacterial adhesion. Collectively, the findings unveil a mechanism used by EVs to prepare a niche conducive for bacterial...”
- “...that FomA mediates autoaggregation of F. nucleatum likely through its interaction with another surface protein FN1441, the retention of FomA on the surface of CRC cells serves as an adhesive target for F. nucleatum . Together, we revealed that the enrichment of FnEVs in CRC promotes...”
- Oral Pathobiont-Derived Outer Membrane Vesicles in the Oral-Gut Axis
Catalan, International journal of molecular sciences 2024 - “...surface upon membrane fusion, enhancing Fn adhesion and autoaggregation by binding to the surface protein FN1441 (FruA). This adhesion was significantly reduced when using OMVs from a FomA-deficient Fn mutant strain [ 25 ]. FomA-containing Fn OMVs are also enriched in clinical CRC samples, further promoting...”
- Proteomics of Fusobacterium nucleatum within a model developing oral microbial community
Hendrickson, MicrobiologyOpen 2014 - “...Thompson 1990 ) and the ATCC 25586 genome encodes for a fructose-specific PTS component homolog (FN1441). Because of the amino acid dependence, glucose and galactose were not utilized strongly in the absence of amino acids. In the presence of amino acids, F. nucleatum ATCC 10953 utilized...”
YpdH / b2387 putative PTS enzyme IIB component FryB from Escherichia coli K-12 substr. MG1655 (see 4 papers)
ECs3267 putative PTS system enzyme IIB component from Escherichia coli O157:H7 str. Sakai
Z3653 putative PTS system enzyme IIB component from Escherichia coli O157:H7 EDL933
40% identity, 58% coverage
MPN078 fructose-permease IIBC component from Mycoplasma pneumoniae M129
34% identity, 16% coverage
ETAE_2301 fructose-specific PTS system IIBC component from Edwardsiella tarda EIB202
40% identity, 17% coverage
CD2487 PTS system, IIb component from Clostridium difficile 630
41% identity, 62% coverage
- Vegetative Cell and Spore Proteomes of Clostridioides difficile Show Finite Differences and Reveal Potential Protein Markers
Abhyankar, Journal of proteome research 2019 - “...Additionally, specific cell and spore surface proteins, vegetative cell proteins CD1228, CD3301 and spore proteins CD2487, CD2434, and CD0684 are identified as potential protein markers for C.difficile infection. Clostridioides difficile vegetative cells endospores proteomes quantitative proteomics protein markers document-id-old-9 pr9b00413 document-id-new-14 pr9b00413 ccc-price Introduction Clostridioides (previously...”
- “...are downregulated, whereas those of fruABC and cd2486 -87 are upregulated. 50 In mouse infections, cd2487 is upregulated 14 h postinfection, whereas proteins XynB, CD3027, and PtsI are seen to be downregulated 38 h postinfection. 11 In pig infections of C.difficile , PtsI, BglF5 (412 h...”
XNRR2_0028 fructose-specific PTS transporter subunit EIIC from Streptomyces albidoflavus
46% identity, 14% coverage
- Superior production of heavy pamamycin derivatives using a bkdR deletion mutant of Streptomyces albus J1074/R2
Gläser, Microbial cell factories 2021 - “...l -valine, cells exhibited a down-regulation of sugar transport genes encoding: the fructose-specific IIA/B/C component (XNRR2_0028) and the phosphor carrier protein HPr (XNRR2_0029) of the phosphotransferase system (PTS), and a sugar transporter with presumed function as mannitol permease (XNRR2_0970) (Additional file 1 : Table S3). Additionally,...”
- “...Notably, the repressing effects of l -valine on sugar uptake was diminished. The PTS genes (XNRR2_0028, XNRR2_0029), and the mannitol permease encoding gene (XNRR2_0970) were not downregulated in bkdR , different to the wild type. In addition, other PTS components (XNRR2_5450, XNRR2_5451) were slightly upregulated (Additional...”
VIBHAR_05188 PTS system fructose-specific IIABC component from Vibrio harveyi ATCC BAA-1116
40% identity, 15% coverage
GMI18_RS08780 fructose-specific PTS transporter subunit EIIC from Spiroplasma citri
37% identity, 14% coverage
VPA1420 PTS system, fructose-specific IIABC component from Vibrio parahaemolyticus RIMD 2210633
40% identity, 15% coverage
- Insights into Vibrio parahaemolyticus CHN25 response to artificial gastric fluid stress by transcriptomic analysis
Sun, International journal of molecular sciences 2014 - “...IIABC component VPA1422 Chn25A_1310 2.2688 Nitrogen regulatory IIA component VPA1421 Chn25A_1309 2.3425 Fructose-specific IIB component VPA1420 Chn25A_1308 2.8724 Fructose-specific IIABC component VPA0501 Chn25A_1196 2.6299 Mannitol-specific enzyme II component VPA0500 Chn25A_1197 2.6362 Mannitol-specific enzyme II component VPA0297 Chn25A_0302 8.029 fructose-specific IIBC component VPA0298 Chn25A_0303 2.8846 Fructose-specific IIA...”
KP1_1987 fructose-specific PTS family enzyme IIB component 2 from Klebsiella pneumoniae NTUH-K2044
KP1_RS09370, VK055_1472 PTS fructose-like transporter subunit IIB from Klebsiella pneumoniae subsp. pneumoniae
34% identity, 63% coverage
- The Fructose-Specific Phosphotransferase System of Klebsiella pneumoniae Is Regulated by Global Regulator CRP and Linked to Virulence and Growth
Lin, Infection and immunity 2018 - “...pneumoniae, a putative Frw fructose PTS gene cluster from KP1_1987 to KP1_1993 was identified through a genomic view of the PTS. This fructose PTS cluster...”
- “...(24). The putative Frw fructose PTS gene clusters from KP1_1987 to KP1_1993 produce proteins similar to those produced by the Fru operon in E. coli. This Frw...”
- Identification of Pathogenicity-Associated Loci in Klebsiella pneumoniae from Hospitalized Patients
Martin, mSystems 2018 - “..., KP1_RS09385 f PTS fructose transporter subunit IIB 6 (15.8) 32 (42.1) 0.008326 KPK_RS16835, VK055_1472, KP1_RS09370 PTS fructose transporter subunit IIB 6 (15.8) 32 (42.1) 0.008326 KP1_RS12840 , KPNJ1_RS13410 , KPN_01702 g Deoxyribose-phosphate aldolase 31 (81.5) 43 (56.6) 0.009493 KP1_RS12835, KPNJ1_RS13415, KPN_01701 Alkaline phosphatase/deoR 31 (81.5)...”
- “...VK055_1469 , KP1_RS09385 f PTS fructose transporter subunit IIB 6 (15.8) 32 (42.1) 0.008326 KPK_RS16835, VK055_1472, KP1_RS09370 PTS fructose transporter subunit IIB 6 (15.8) 32 (42.1) 0.008326 KP1_RS12840 , KPNJ1_RS13410 , KPN_01702 g Deoxyribose-phosphate aldolase 31 (81.5) 43 (56.6) 0.009493 KP1_RS12835, KPNJ1_RS13415, KPN_01701 Alkaline phosphatase/deoR 31...”
KPK_RS16835 PTS fructose-like transporter subunit IIB from Klebsiella variicola
34% identity, 61% coverage
VC1822 PTS system, fructose-specific IIABC component from Vibrio cholerae O1 biovar eltor str. N16961
38% identity, 15% coverage
- A Genome-Wide Screen Reveals that the Vibrio cholerae Phosphoenolpyruvate Phosphotransferase System Modulates Virulence Gene Expression
Wang, Infection and immunity 2015 - “...fpr (VCA0518) C6706 VC1820 C6706 VCA0245 C6706 VC1822 C6706 VC2013 C6706 VC0995 C6706 VCA1045 C6706 VC0910 PtsI(H189A) VC0964(H91D) PtsH(H15A) Lab collection...”
- “...pCVD442 carrying an unmarked, in-frame deletion in VC1822 pCVD442 carrying an unmarked, in-frame deletion in VC2013 pCVD442 carrying an unmarked, in-frame...”
- Vibrio cholerae phosphoenolpyruvate phosphotransferase system control of carbohydrate transport, biofilm formation, and colonization of the germfree mouse intestine
Houot, Infection and immunity 2010 - “...of each of the following targeted genes (VC0672, VC1820, VC1822, VC1826, VCA1045, VCA0245, and VC1283) was amplified by PCR using the primer sets listed in...”
- “...fragment fragment of of of of of of of VC1820 VC1822 VC1826 VCA1045 VCA0245 VC0672 VC1283 the coding sequence of VC0965 the coding sequence of VC0966 a VC0966...”
- Genes induced late in infection increase fitness of Vibrio cholerae after release into the environment
Schild, Cell host & microbe 2007 - “...hypothetical protein 6.6 ND 4.3 53.9 8.2 12.6 ND VC1822 PTS system, fructose-specific IIABC component ( frwABC ) 20.4 ND 19.9 85.3 4.2 4.3 ND VC1906...”
TC 4.A.2.1.17 / Q9HY57 Phosphotransferase system transporter fructose-specific IIBC component, FruA, component of Fructose-specific PTS permease, FruIIBC/FruI-HPr-IIA from Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)
EIP97_RS07570 PTS fructose-like transporter subunit IIB from Pseudomonas aeruginosa UCBPP-PA14
PA3560 phosphotransferase system, fructose-specific IIBC component from Pseudomonas aeruginosa PAO1
44% identity, 17% coverage
- substrates: fructose
- Unveiling Co-Infection in Cystic Fibrosis Airways: Transcriptomic Analysis of Pseudomonas aeruginosa and Staphylococcus aureus Dual-Species Biofilms
Magalhães, Frontiers in genetics 2022 - “...Carbohydrate transport and metabolism 9.87 1.64E-02 pfkB 1-Phosphofructokinase [G] Carbohydrate transport and metabolism 9.69 0.00 EIP97_RS07570 PTS fructose-like transporter subunit IIB [G] Carbohydrate transport and metabolism 9.50 0.00 ptsP_3 Phosphoenolpyruvateprotein phosphotransferase [G] Carbohydrate transport and metabolism and [T] signal transduction mechanisms 9,30 0.00 edd Phosphogluconate dehydratase...”
- Full Transcriptomic Response of Pseudomonas aeruginosa to an Inulin-Derived Fructooligosaccharide
Rubio-Gómez, Frontiers in microbiology 2020 - “...import ATP-binding protein 0.9 0.000 0.9 0.000 PA3496 nd Uncharacterized protein 0.5 0.002 0.5 0.007 PA3560 fruA Phosphotransferase system transporter 1.1 0.000 1.3 0.000 PA3561 fruK 1-phosphofructokinase 1.8 0.000 1.8 0.000 PA3562 fruI Phosphotransferase system transporter enzyme I 2.0 0.000 2.0 0.000 PA3623 nd Uncharacterized protein...”
- “...0.6 0.001 PA3384 phnC Phosphonates import ATP-binding protein 0.9 0.000 PA3496 Uncharacterized protein 0.5 0.007 PA3560 fruA Phosphotransferase system transporter 1.3 0.000 PA3561 fruK 1-phosphofructokinase 1.8 0.000 PA3562 fruI Phosphotransferase system transporter enzyme I. 2.0 0.000 PA3563 Uncharacterized protein 0.7 0.004 PA3623 Uncharacterized protein 0.6 0.002...”
- High-throughput phenotypic characterization of Pseudomonas aeruginosa membrane transport genes
Johnson, PLoS genetics 2008 - “...acid APC family transporter ( AroP1 ) PA3176 PA01 glutamate/sodium ion symporter ( GltS ) PA3560 PAK phosphotransferase system transporter fructose-specific IIBC component ( FruA ) PA3562 PAK phosphotransferase system transporter enzyme I ( FruI ) PA3597 PAK amino acid APC family transporter PA3641 PAK alanine/sodium...”
- “...Acid -C +/ PA3176 glutamate/sodium ion symporter ( GltS ) N-Acetyl-L-Glutamic Acid - N +/ PA3560 phosphotransferase system transporter fructose-specific IIBC component ( FruA ) D-Fructose C - PA3562 phosphotransferase system transporter enzyme I ( FruI ) D-Fructose C - PA3760 N-Acetyl-D-Glucosamine phosphotransferase system transporter N-Acetyl-D-Glucosamine...”
TC 4.A.2.1.16 / Q9RMF5 Fructose-specific Enzyme IIABC from Spiroplasma citri
36% identity, 14% coverage
NO343_01610 fructose-specific PTS transporter subunit EIIC from Mycoplasma capricolum subsp. capricolum
34% identity, 13% coverage
STM4116 PTS system fructose-like IIB component 2 from Salmonella typhimurium LT2
42% identity, 47% coverage
VC1821 PTS system, fructose-specific IIBC component from Vibrio cholerae O1 biovar eltor str. N16961
38% identity, 19% coverage
- A mannose-sensing AraC-type transcriptional activator regulates cell-cell aggregation of Vibrio cholerae
Lee, NPJ biofilms and microbiomes 2022 - “...previously reported that ManR is required for the expression of FdgA (facilitated diffusion of glucose, VC1821 coding for a fructose-family EIIBC protein), and acts downstream of FruR 12 . However, our data showed that FruR did not bind to either the man operon promoter (Supplementary Fig....”
- Identification of Small Molecule Inhibitors of the Pathogen Box against Vibrio cholerae
Kim, Microbiology spectrum 2021 - “...in carbon metabolism/transport. A few of the most downregulated genes, vc1820 , vc1826 , and vc1821 , are involved in the uptake of fructose. Iron homeostasis/transport showed the most upregulated number of genes along with ribosomal proteins ( Fig.2A ). These include vca0676 and vc1184 ,...”
- Systematic genetic dissection of PTS in Vibrio cholerae uncovers a novel glucose transporter and a limited role for PTS during infection of a mammalian host
Hayes, Molecular microbiology 2017 - “...were three PTS transporters that were individually sufficient for growth on glucose: VC2013, VC0995, and VC1821. VC2013 is the V. cholerae PtsG homolog and is a predicted high-affinity glucose transporter, VC0995 is the sole GlcNAc PTS transporter ( Table 1 ), while VC1821 is a predicted...”
- “...glucose requires the additive function of both of these transporters, we compared growth of the VC1821 single mutant to the wildtype. These strains grew similarly ( Fig. S1 ), thus, these transporters do not function additively. Reduced growth of the pts2013 strain compared to wildtype may...”
- Mannitol and the mannitol-specific enzyme IIB subunit activate Vibrio cholerae biofilm formation
Ymele-Leki, Applied and environmental microbiology 2013 - “...VC1281 CGACCGCATATGAAAAAGATCCTACTC CTGCAAGAATTCGTTAATTAAATCTAAAGC VC1821 CGACCGCATATGGACGAAATCGC CTGCAAGAATTCAGCTTGGATAAGTTC MtlR CGACCGCATATGTCGAGAGCTGTC...”
- “...a wild-type VC1281 allele (pVC1281), and a wild-type VC1821 allele (pVC1821). Protein expression was induced by addition of 1 mM IPTG. The star indicates...”
- Regulation of rugosity and biofilm formation in Vibrio cholerae: comparison of VpsT and VpsR regulons and epistasis analysis of vpsT, vpsR, and hapR
Beyhan, Journal of bacteriology 2007 - “...2.15 1.83 Transport and binding proteins VC1820 VC1821 VC1826 VCA0612 PTS system; fructose-specific IIA component; frvA PTS system; fructose-specific IIBC...”
PP0795, PP_0795 phosphotransferase system, fructose-specific IIBC component from Pseudomonas putida KT2440
45% identity, 18% coverage
- Biosynthesis of Polyhydroalkanoates Doped with Silver Nanoparticles Using Pseudomonas putida and Pseudomonas aeruginosa for Antibacterial Polymer Applications
Cruz-Romero, International journal of molecular sciences 2024 - “...has at least four. Additionally, Pseudomonas putida has only one sugar transporter, PTS for fructose (PP0795, PP0792793). A low amount of PHAs was extracted from both strains and from the two carbon sources, consistent with literature reports [ 11 , 25 , 26 , 27 ],...”
- UEG Week 2024 Poster Presentations
, United European gastroenterology journal 2024 - UEG Week 2023 Poster Presentations
, United European gastroenterology journal 2023 - Computational prediction of the Crc regulon identifies genus-wide and species-specific targets of catabolite repression control in Pseudomonas bacteria
Browne, BMC microbiology 2010 - “...membrane ferric siderophore receptor nd 1.6 fruR NM PP_0792 FruR transcriptional regulator nd 2.3 fruA PP_0795 PP_0795 PTS fructose IIC component 2.1 nd gap-1 PP_1009 PP_1009 glyceraldehyde-3-phosphate dehydrogenase, type I 2.7 3.3 PP_1015 PP_1015 probable binding protein component of ABC sugar transporter 2.3 4.9 oprB-1 PP_1019...”
VPA0297 PTS system, fructose-specific IIBC component from Vibrio parahaemolyticus RIMD 2210633
39% identity, 20% coverage
- Insights into Vibrio parahaemolyticus CHN25 response to artificial gastric fluid stress by transcriptomic analysis
Sun, International journal of molecular sciences 2014 - “...component VPA0501 Chn25A_1196 2.6299 Mannitol-specific enzyme II component VPA0500 Chn25A_1197 2.6362 Mannitol-specific enzyme II component VPA0297 Chn25A_0302 8.029 fructose-specific IIBC component VPA0298 Chn25A_0303 2.8846 Fructose-specific IIA component VPA0231 Chn25A_0232 2.0079 Phosphotransferase enzyme II, A component VPA0230 Chn25A_0231 5.501 Putative sugar phosphotransferase component II B VP2637 Chn25_2566...”
- “...periplasmic Iron-compound-binding protein VPA0310 Chn25A_0316 2.1424 Hypothetical protein PTS VP2674 Chn25_2602 2.2237 Phosphocarrier protein NPr VPA0297 Chn25A_0302 0.4786 PTS system, fructose-specific IIBC component VPA0298 Chn25A_0303 0.4004 PTS system, fructose-specific IIA component VPA1424 Chn25A_1312 0.3946 PTS system, fructose-specific IIABC component Quaternary ammonium group transport VPA1111 Chn25A_0571 0.453...”
OKIT_0248 PTS fructose transporter subunit IIB from Oenococcus kitaharae DSM 17330
41% identity, 63% coverage
PMSV_2243 fructose-specific PTS transporter subunit EIIC from Photobacterium leiognathi subsp. mandapamensis svers.1.1.
35% identity, 19% coverage
FrwD / b3953 putative PTS enzyme IIB component FrwD from Escherichia coli K-12 substr. MG1655 (see 4 papers)
NP_418388 putative PTS enzyme IIB component FrwD from Escherichia coli str. K-12 substr. MG1655
37% identity, 53% coverage
- Crystal Structure of Hypothetical Fructose-Specific EIIB from Escherichia coli.
Park, Molecules and cells 2016 - GeneRIF: Results reveal a alpha-beta-alpha sandwich fold with a unique beta-sheet topology of the hypothetical fructose-specific EIIB. Its C-terminus is longer than its closest relatives and forms an additional beta-strand whereas the shorter C-terminus is random coil in the relatives. In the active site of the closest EcEIIBfruc homologues, a unique motif CXXGXAHT comprising a P-loop like architecture including a histidine res...
VSAL_II0995 PTS system, fructose-like permease IIC component from Vibrio salmonicida LFI1238
VSAL_II0995 fructose-specific PTS transporter subunit EIIC from Aliivibrio salmonicida LFI1238
37% identity, 19% coverage
stu0401 fructose PTS system component IIABC, truncated from Streptococcus thermophilus LMG 18311
44% identity, 31% coverage
For advice on how to use these tools together, see
Interactive tools for functional annotation of bacterial genomes.
The PaperBLAST database links 793,807 different protein sequences to 1,259,118 scientific articles. Searches against EuropePMC were last performed on March 13 2025.
PaperBLAST builds a database of protein sequences that are linked
to scientific articles. These links come from automated text searches
against the articles in EuropePMC
and from manually-curated information from GeneRIF, UniProtKB/Swiss-Prot,
BRENDA,
CAZy (as made available by dbCAN),
BioLiP,
CharProtDB,
MetaCyc,
EcoCyc,
TCDB,
REBASE,
the Fitness Browser,
and a subset of the European Nucleotide Archive with the /experiment tag.
Given this database and a protein sequence query,
PaperBLAST uses protein-protein BLAST
to find similar sequences with E < 0.001.
To build the database, we query EuropePMC with locus tags, with RefSeq protein
identifiers, and with UniProt
accessions. We obtain the locus tags from RefSeq or from MicrobesOnline. We use
queries of the form "locus_tag AND genus_name" to try to ensure that
the paper is actually discussing that gene. Because EuropePMC indexes
most recent biomedical papers, even if they are not open access, some
of the links may be to papers that you cannot read or that our
computers cannot read. We query each of these identifiers that
appears in the open access part of EuropePMC, as well as every locus
tag that appears in the 500 most-referenced genomes, so that a gene
may appear in the PaperBLAST results even though none of the papers
that mention it are open access. We also incorporate text-mined links
from EuropePMC that link open access articles to UniProt or RefSeq
identifiers. (This yields some additional links because EuropePMC
uses different heuristics for their text mining than we do.)
For every article that mentions a locus tag, a RefSeq protein
identifier, or a UniProt accession, we try to select one or two
snippets of text that refer to the protein. If we cannot get access to
the full text, we try to select a snippet from the abstract, but
unfortunately, unique identifiers such as locus tags are rarely
provided in abstracts.
PaperBLAST also incorporates manually-curated protein functions:
- Proteins from NCBI's RefSeq are included if a
GeneRIF
entry links the gene to an article in
PubMed®.
GeneRIF also provides a short summary of the article's claim about the
protein, which is shown instead of a snippet.
- Proteins from Swiss-Prot (the curated part of UniProt)
are included if the curators
identified experimental evidence for the protein's function (evidence
code ECO:0000269). For these proteins, the fields of the Swiss-Prot entry that
describe the protein's function are shown (with bold headings).
- Proteins from BRENDA,
a curated database of enzymes, are included if they are linked to a paper in PubMed
and their full sequence is known.
- Every protein from the non-redundant subset of
BioLiP,
a database
of ligand-binding sites and catalytic residues in protein structures, is included. Since BioLiP itself
does not include descriptions of the proteins, those are taken from the
Protein Data Bank.
Descriptions from PDB rely on the original submitter of the
structure and cannot be updated by others, so they may be less reliable.
(For SitesBLAST and Sites on a Tree, we use a larger subset of BioLiP so that every
ligand is represented among a group of structures with similar sequences, but for
PaperBLAST, we use the non-redundant set provided by BioLiP.)
- Every protein from EcoCyc, a curated
database of the proteins in Escherichia coli K-12, is included, regardless
of whether they are characterized or not.
- Proteins from the MetaCyc metabolic pathway database
are included if they are linked to a paper in PubMed and their full sequence is known.
- Proteins from the Transport Classification Database (TCDB)
are included if they have known substrate(s), have reference(s),
and are not described as uncharacterized or putative.
(Some of the references are not visible on the PaperBLAST web site.)
- Every protein from CharProtDB,
a database of experimentally characterized protein annotations, is included.
- Proteins from the CAZy database of carbohydrate-active enzymes
are included if they are associated with an Enzyme Classification number.
Even though CAZy does not provide links from individual protein sequences to papers,
these should all be experimentally-characterized proteins.
- Proteins from the REBASE database
of restriction enzymes are included if they have known specificity.
- Every protein with an evidence-based reannotation (based on mutant phenotypes)
in the Fitness Browser is included.
- Sequence-specific transcription factors (including sigma factors and DNA-binding response regulators)
with experimentally-determined DNA binding sites from the
PRODORIC database of gene regulation in prokaryotes.
- Putative transcription factors from RegPrecise
that have manually-curated predictions for their binding sites. These predictions are based on
conserved putative regulatory sites across genomes that contain similar transcription factors,
so PaperBLAST clusters the TFs at 70% identity and retains just one member of each cluster.
- Coding sequence (CDS) features from the
European Nucleotide Archive (ENA)
are included if the /experiment tag is set (implying that there is experimental evidence for the annotation),
the nucleotide entry links to paper(s) in PubMed,
and the nucleotide entry is from the STD data class
(implying that these are targeted annotated sequences, not from shotgun sequencing).
Also, to filter out genes whose transcription or translation was detected, but whose function
was not studied, nucleotide entries or papers with more than 25 such proteins are excluded.
Descriptions from ENA rely on the original submitter of the
sequence and cannot be updated by others, so they may be less reliable.
Except for GeneRIF and ENA,
the curated entries include a short curated
description of the protein's function.
For entries from BioLiP, the protein's function may not be known beyond binding to the ligand.
Many of these entries also link to articles in PubMed.
For more information see the
PaperBLAST paper (mSystems 2017)
or the code.
You can download PaperBLAST's database here.
Changes to PaperBLAST since the paper was written:
- November 2023: incorporated PRODORIC and RegPrecise. Many PRODORIC entries were not linked to a protein sequence (no UniProt identifier), so we added this information.
- February 2023: BioLiP changed their download format. PaperBLAST now includes their non-redundant subset. SitesBLAST and Sites on a Tree use a larger non-redundant subset that ensures that every ligand is represented within each cluster. This should ensure that every binding site is represented.
- June 2022: incorporated some coding sequences from ENA with the /experiment tag.
- March 2022: incorporated BioLiP.
- April 2020: incorporated TCDB.
- April 2019: EuropePMC now returns table entries in their search results. This has expanded PaperBLAST's database, but most of the new entries are of low relevance, and the resulting snippets are often just lists of locus tags with annotations.
- February 2018: the alignment page reports the conservation of the hit's functional sites (if available from from Swiss-Prot or UniProt)
- January 2018: incorporated BRENDA.
- December 2017: incorporated MetaCyc, CharProtDB, CAZy, REBASE, and the reannotations from the Fitness Browser.
- September 2017: EuropePMC no longer returns some table entries in their search results. This has shrunk PaperBLAST's database, but has also reduced the number of low-relevance hits.
Many of these changes are described in Interactive tools for functional annotation of bacterial genomes.
PaperBLAST cannot provide snippets for many of the papers that are
published in non-open-access journals. This limitation applies even if
the paper is marked as "free" on the publisher's web site and is
available in PubmedCentral or EuropePMC. If a journal that you publish
in is marked as "secret," please consider publishing elsewhere.
Many important articles are missing from PaperBLAST, either because
the article's full text is not in EuropePMC (as for many older
articles), or because the paper does not mention a protein identifier such as a locus tag, or because of PaperBLAST's heuristics. If you notice an
article that characterizes a protein's function but is missing from
PaperBLAST, please notify the curators at UniProt
or add an entry to GeneRIF.
Entries in either of these databases will eventually be incorporated
into PaperBLAST. Note that to add an entry to UniProt, you will need
to find the UniProt identifier for the protein. If the protein is not
already in UniProt, you can ask them to create an entry. To add an
entry to GeneRIF, you will need an NCBI Gene identifier, but
unfortunately many prokaryotic proteins in RefSeq do not have
corresponding Gene identifers.
References
PaperBLAST: Text-mining papers for information about homologs.
M. N. Price and A. P. Arkin (2017). mSystems, 10.1128/mSystems.00039-17.
Europe PMC in 2017.
M. Levchenko et al (2017). Nucleic Acids Research, 10.1093/nar/gkx1005.
Gene indexing: characterization and analysis of NLM's GeneRIFs.
J. A. Mitchell et al (2003). AMIA Annu Symp Proc 2003:460-464.
UniProt: the universal protein knowledgebase.
The UniProt Consortium (2016). Nucleic Acids Research, 10.1093/nar/gkw1099.
BRENDA in 2017: new perspectives and new tools in BRENDA.
S. Placzek et al (2017). Nucleic Acids Research, 10.1093/nar/gkw952.
The EcoCyc database: reflecting new knowledge about Escherichia coli K-12.
I. M. Keeseler et al (2016). Nucleic Acids Research, 10.1093/nar/gkw1003.
The MetaCyc database of metabolic pathways and enzymes.
R. Caspi et al (2018). Nucleic Acids Research, 10.1093/nar/gkx935.
CharProtDB: a database of experimentally characterized protein annotations.
R. Madupu et al (2012). Nucleic Acids Research, 10.1093/nar/gkr1133.
The carbohydrate-active enzymes database (CAZy) in 2013.
V. Lombard et al (2014). Nucleic Acids Research, 10.1093/nar/gkt1178.
The Transporter Classification Database (TCDB): recent advances
M. H. Saier, Jr. et al (2016). Nucleic Acids Research, 10.1093/nar/gkv1103.
REBASE - a database for DNA restriction and modification: enzymes, genes and genomes.
R. J. Roberts et al (2015). Nucleic Acids Research, 10.1093/nar/gku1046.
Deep annotation of protein function across diverse bacteria from mutant phenotypes.
M. N. Price et al (2016). bioRxiv, 10.1101/072470.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory