PaperBLAST

PaperBLAST Hits for TCDB::P08470 Sucrose porter (ScrA) (Salmonella typhimurium) (456 a.a., MDFEQISCSL...)

Show query sequence

>TCDB::P08470 Sucrose porter (ScrA) (Salmonella typhimurium)
MDFEQISCSLLPLLGGKENIASAAHCATRLRLVLVDDSLADQQAIGKVEGVKGCFRNAGQ
MQIIFGTGVVNKVYAAFTQAAGISESSKSEAADIAAKKLNPFQRIARLLSNIFVPIIPAI
VASGLLMGLLGMVKTYGWVDPGNAIYIMLDMCSSAAFIILPILIGFTAAREFGGNPYLGA
TLGGILTHPALTNAWGVAAGFHTMNFFGFEIAMIGYQGTVFPVLLAVWFMSIVEKQLRRA
IPDALDLILTPFLTVIISGFIALLIIGPAGRALGDGISFVLSTLISHAGWLAGLLFGGLY
SVIVITGIHHSFHAVEAGLLGNPSIGVNFLLPIWAMANVAQGGACLAVWFKTKDAKIKAI
TLPSAFSAMLGITEAAIFGINLRFVKPFIAALIGGAAGGAWVVSVHVYMTAVGLTAIPGM
AIVQASSLLNYIIGMVIAFGVAFTVSLVLKYKTDAE

Running BLASTp...

Found 245 similar proteins in the literature:

PTSBC_SALTM / P08470 PTS system sucrose-specific EIIBC component; EIIBC-Scr; EII-Scr; EC 2.7.1.211 from Salmonella typhimurium (see paper)
TC 4.A.1.2.1 / P08470 Sucrose porter (ScrA) from Salmonella typhimurium (see 4 papers)
100% identity, 100% coverage

• function: The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane (Probable). This system is involved in sucrose transport (PubMed:8628219).
  catalytic activity: N(pros)-phospho-L-histidyl-[protein](out) + sucrose = sucrose 6(G)-phosphate(in) + L-histidyl-[protein] (RHEA:49236)
• substrates: Sucrose

scrA / P27219 Enzyme II^scr (EC 2.7.1.211) from Klebsiella pneumoniae (see 2 papers)
PTSBC_KLEPN / P27219 PTS system sucrose-specific EIIBC component; EIIBC-Scr; EII-Scr; EC 2.7.1.211 from Klebsiella pneumoniae (see paper)
P27219 protein-Npi-phosphohistidine-sucrose phosphotransferase (EC 2.7.1.211) from Klebsiella pneumoniae (see paper)
scrA / CAA40658.1 sucrose-specific enzyme II from Klebsiella pneumoniae (see 2 papers)
95% identity, 100% coverage

• function: The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane (Probable). This system is involved in sucrose transport (PubMed:8628219).
  catalytic activity: N(pros)-phospho-L-histidyl-[protein](out) + sucrose = sucrose 6(G)-phosphate(in) + L-histidyl-[protein] (RHEA:49236)
• Disruption of KPC-producing Klebsiella pneumoniae membrane via induction of oxidative stress by cinnamon bark (Cinnamomum verum J. Presl) essential oil
  Yang, PloS one 2019
  • “...Polyphosphate kinase Lost O32719 Probable malate:quinone oxidoreductase (Fragment) Upregulated * A6TDG4 Prolipoprotein diacylglyceryl transferase Lost P27219 PTS system sucrose-specific EIIBC component Lost A6TC94 Succinyl-diaminopimelate desuccinylase Lost A6THZ7 Thymidine phosphorylase Lost A6TGL3 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Lost A6T4N3 UDP-N-acetylglucosamineN-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase Lost *refers to the proteins...”

KP22_RS13800 sucrose-specific PTS transporter subunit IIBC from Pectobacterium betavasculorum
82% identity, 100% coverage

• Untargeted metabolomics coupled with genomics in the study of sucrose and xylose metabolism in Pectobacterium betavasculorum
  Smoktunowicz, Frontiers in microbiology 2024
  • “...intermediate in glycolysis ( Meadow et al., 1990 ). The gene of the PTS transporter (KP22_RS13800), as well as sucrose-6-phosphate hydrolase (KP22_RS13795), are both present in the P. betavasculorum genome ( Supplementary Figure S5 ). What is more, metabolomic analysis of bacterial biomass confirmed that this...”

PTSBC_BACSU / P05306 PTS system sucrose-specific EIIBC component; EIIBC-Scr; EII-Scr; EC 2.7.1.211 from Bacillus subtilis (strain 168) (see 2 papers)
P05306 protein-Npi-phosphohistidine-sucrose phosphotransferase (EC 2.7.1.211) from Bacillus subtilis (see paper)
TC 4.A.1.2.9 / P05306 Sucrose porter, IIBC (SacP) (55% identical to 4.A.1.2.1) from Bacillus subtilis (see 5 papers)
BSU38050 phosphotransferase system (PTS) sucrose-specific enzyme IIBC component from Bacillus subtilis subsp. subtilis str. 168
60% identity, 99% coverage

• function: The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane (PubMed:3122206). This system is involved in sucrose transport (PubMed:3122206).
  catalytic activity: N(pros)-phospho-L-histidyl-[protein](out) + sucrose = sucrose 6(G)-phosphate(in) + L-histidyl-[protein] (RHEA:49236)
• substrates: Sucrose
• Reconstruction of the Regulatory Network for Bacillus subtilis and Reconciliation with Gene Expression Data
  Faria, Frontiers in microbiology 2016
  • “...Sucrose 376 ywdA, BSU38030 D-fructose-1,6-bisphosphate, Glucose-6-Phosphate, Sucrose 376 sacA, BSU38040 D-fructose-1,6-bisphosphate, Glucose-6-Phosphate, Sucrose 376 sacP, BSU38050 D-fructose-1,6-bisphosphate, Glucose-6-Phosphate, Sucrose 625 sacB, BSU34450 Uncharacterized, uncharacterized, Sucrose 625 levB, BSU34460 Uncharacterized, uncharacterized, Sucrose AR number arbitrarily assigned by the inference algorithm (the ARs described Figure 4 were assigned...”

CA_C0423 sucrose-specific PTS transporter subunit IIBC from Clostridium acetobutylicum ATCC 824
60% identity, 72% coverage

• Metabolic engineering of Thermoanaerobacterium aotearoense strain SCUT27 for biofuels production from sucrose and molasses
  Dai, Biotechnology for biofuels and bioproducts 2023
  • “...25 ]. In most Clostridia (including Thermoanaerobacterium) such as C. acetobutylicum , PTS-dependent transporter ScrA (CA_C0423, Fig. 1 ), sucrose-6-phosphate hydrolase or ScrB (CA_C0425) and fructokinase ScrK (CA_C0424) are responsible for sucrose transport and metabolism [ 26 28 ]. First, scrBAK from C. acetobutylicum was introduced...”
• Alleviation of Carbon Catabolite Repression through araR and xylR Inactivation in Clostridium acetobutylicum DSM 792
  Delarouzée, Applied and environmental microbiology 2023 (secret)
• Elucidation of the roles of adhE1 and adhE2 in the primary metabolism of Clostridium acetobutylicum by combining in-frame gene deletion and a quantitative system-scale approach
  Yoo, Biotechnology for biofuels 2016 (no snippet)

BC0775 PTS system, sucrose-specific IIBC component from Bacillus cereus ATCC 14579
59% identity, 99% coverage

• The Membrane Proteome of Spores and Vegetative Cells of the Food-Borne Pathogen Bacillus cereus
  Gao, International journal of molecular sciences 2021
  • “...for glucose transport was common in the spore inner membrane and cell membrane. Whereas, ScrA (BC0775) mediating starch and sucrose transportation was also shared, although significantly less abundant in the spore inner membrane. In contrast, vegetative cell membranes showed a larger variety of transporters for different...”

TRNA_RS41255 sucrose-specific PTS transporter subunit IIBC from Bacillus licheniformis DSM 13 = ATCC 14580
58% identity, 99% coverage

• Exploitation of ammonia-inducible promoters for enzyme overexpression in Bacillus licheniformis
  Shen, Journal of industrial microbiology & biotechnology 2021
  • “...T1-FPKM Log2 fold change Symbol TRNA_RS39005 Operon TRNA_RS39005, TRNA_RS39010 233.72 6,623.44 4.82 copA TRNA_RS41245, TRNA_RS41250, TRNA_RS41255 TRNA_RS41250 Operon TRNA_RS31535, TRNA_RS31540 304.15 5,168.93 4.08 sacA TRNA_RS42535 Operon TRNA_RS23130 37.49 2,115.45 5.82 ald TRNA_RS23130 Gene TRNA_RS42535 246.39 4,651.72 4.3 pdbX TRNA_RS31535 Gene TRNA_RS23240 137.77 4,263.28 4.91 plp TRNA_RS23240...”

RSp1285 PROBABLE PTS SYSTEM, SUCROSE-SPECIFIC (IIBC COMPONENT) TRANSMEMBRANE PROTEIN from Ralstonia solanacearum GMI1000
58% identity, 96% coverage

• Genome-Wide Identification of Tomato Xylem Sap Fitness Factors for Three Plant-Pathogenic Ralstonia Species
  Georgoulis, mSystems 2021
  • “...associated with bacterial metabolism. Consistent with previous studies that showed Ralstonia scrA sucrose catabolism mutants (RSp1285) have growth defects in tomato stems ( 28 , 29 ), scrB (RSp1284) sucrose catabolism mutants also had reduced fitness in xylem sap in our TnSeq experiments. The fitness defect...”

BG05_RS27275 sucrose-specific PTS transporter subunit IIBC from Bacillus mycoides
59% identity, 99% coverage

• Comparative Transcriptomics of Bacillus mycoides Strains in Response to Potato-Root Exudates Reveals Different Genetic Adaptation of Endophytic and Soil Isolates
  Yi, Frontiers in microbiology 2017
  • “...lactose transporter subunit (BG05_RS06025), PTS cellobiose transporter subunit (BG05_RS27110 and BG05_RS27115), and PTS sugar transporter (BG05_RS27275). It was reported that some rhizosphere bacteria selectively and preferentially consume amino acids instead of sugars. The catabolite repression of glucose assimilation in the presence of amino acids was observed...”

SACX_BACSU / P15400 Probable PTS system sucrose-specific EIIBC component; Negative regulator of SacY activity; EC 2.7.1.- from Bacillus subtilis (strain 168) (see 2 papers)
TC 4.A.1.2.10 / P15400 Sucrose porter and regulatory sensor, IIBC (SacX) (43% identical to 4.A.1.2.1) (Tortosa and Le Coq 1995). The IIA domains of PtsA, GamP, PtsG and GmuA can all phosphorylate the IIB domain in the SacX sensor from Bacillus subtilis (see 5 papers)
BSU38410 negative regulator of SacY from Bacillus subtilis subsp. subtilis str. 168
49% identity, 99% coverage

• function: The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active -transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane (Probable). This system may be involved in sucrose transport (PubMed:11580842). The EIIB domain is mainly phosphorylated by the EIIA domains of GamP and PtsA/YpqE (PubMed:30038046).
  function: Negatively regulates SacY activity by catalyzing its phosphorylation on 'His-99'.
• substrates: Sucrose
• Reconstruction of the Regulatory Network for Bacillus subtilis and Reconciliation with Gene Expression Data
  Faria, Frontiers in microbiology 2016
  • “...in the Atomic Regulon (AR) web analysis resource. AR number Gene name/BSU Stimuli 254 sacX, BSU38410 Uncharacterized, Sucrose 254 sacY, BSU38420 Uncharacterized, Sucrose 376 ywdA, BSU38030 D-fructose-1,6-bisphosphate, Glucose-6-Phosphate, Sucrose 376 sacA, BSU38040 D-fructose-1,6-bisphosphate, Glucose-6-Phosphate, Sucrose 376 sacP, BSU38050 D-fructose-1,6-bisphosphate, Glucose-6-Phosphate, Sucrose 625 sacB, BSU34450 Uncharacterized, uncharacterized,...”

MS0784 PtsG protein from Mannheimia succiniciproducens MBEL55E
45% identity, 93% coverage

• Mannheimia succiniciproducens phosphotransferase system for sucrose utilization
  Lee, Applied and environmental microbiology 2010
  • “...utilization of sucrose in M. succiniciproducens. The genes, MS0784, MS0807, MS0909, MS1233, and MS1237, were knocked out from the chromosome of the wild-type M....”
  • “...that M. succiniciproducens sucrose utilization system involves MS0784 or MS1237 for sucrose PTS, MS0909 for sucrose 6-phosphate hydrolase, and MS1233 for...”

MS0784 sucrose-specific PTS transporter subunit IIBC from [Mannheimia] succiniciproducens MBEL55E
45% identity, 97% coverage

• Mannheimia succiniciproducens phosphotransferase system for sucrose utilization
  Lee, Applied and environmental microbiology 2010
  • “...utilization of sucrose in M. succiniciproducens. The genes, MS0784, MS0807, MS0909, MS1233, and MS1237, were knocked out from the chromosome of the wild-type M....”
  • “...that M. succiniciproducens sucrose utilization system involves MS0784 or MS1237 for sucrose PTS, MS0909 for sucrose 6-phosphate hydrolase, and MS1233 for...”

APL_1319 PTS system sucrose-specific EIIBC component from Actinobacillus pleuropneumoniae L20
44% identity, 96% coverage

• Effects of growth conditions on biofilm formation by Actinobacillus pleuropneumoniae
  Labrie, Veterinary research 2010
  • “...dppD Dipeptide transport ATP-binding protein DppD 2.036 APL_1448 afuC Ferric ABC transporter ATP-binding protein 1.855 APL_1319 ptsB PTS system sucrose-specific EIIBC component 1.744 APL_1320 thiQ Thiamine transport ATP-binding protein ThiQ 1.569 APL_1622 cbiM Predicted ABC transport permease protein CbiM 1.433 APL_1620 cbiO Predicted ABC transport ATP-binding...”
• Host-pathogen interactions of Actinobacillus pleuropneumoniae with porcine lung and tracheal epithelial cells
  Auger, Infection and immunity 2009
  • “...proteins: others APL_0107 APL_1173 APL_0377 APL_1254 APL_1319 APL_0447 APL_0262 APL_1620 udp Fold change Description COG2820: uridine phosphorylase, probable...”

FD719_10830, FD722_11585, H3N34_00965, HU831_00535, HU985_14400, HVV26_09235 sucrose-specific PTS transporter subunit IIBC from Photobacterium damselae subsp. damselae
44% identity, 95% coverage

• Diverse Horizontally-Acquired Gene Clusters Confer Sucrose Utilization to Different Lineages of the Marine Pathogen Photobacterium damselae subsp. damselae
  Abushattal, Genes 2020
  • “...JABWTP000000000 JABXOP000000000 VANE00000000 JACFTX000000000 VANF00000000 VANH00000000 JABWTO000000000 JABXOR000000000 Sucrose operon genes (locus_tag) scrA HU985_14400 HVV26_09235 FD719_10830 H3N34_00965 FD720_04185 FD722_11585 HU831_00535 HWA77_17195 scrB HU985_14390 HVV26_09225 FD719_10820 H3N34_00955 FD720_04175 FD722_11575 HU831_00545 HWA77_17185 scrK HU985_14395 HVV26_09230 FD719_10825 H3N34_00960 FD720_04180 FD722_11580 HU831_00540 HWA77_17190 scrR HU985_14405 HVV26_09240 FD719_10835 H3N34_00970 FD720_04190 FD722_11590...”
  • “...JACFTX000000000 VANF00000000 VANH00000000 JABWTO000000000 JABXOR000000000 Sucrose operon genes (locus_tag) scrA HU985_14400 HVV26_09235 FD719_10830 H3N34_00965 FD720_04185 FD722_11585 HU831_00535 HWA77_17195 scrB HU985_14390 HVV26_09225 FD719_10820 H3N34_00955 FD720_04175 FD722_11575 HU831_00545 HWA77_17185 scrK HU985_14395 HVV26_09230 FD719_10825 H3N34_00960 FD720_04180 FD722_11580 HU831_00540 HWA77_17190 scrR HU985_14405 HVV26_09240 FD719_10835 H3N34_00970 FD720_04190 FD722_11590 HU831_00530 HWA77_17200...”
  • “...JABXOP000000000 VANE00000000 JACFTX000000000 VANF00000000 VANH00000000 JABWTO000000000 JABXOR000000000 Sucrose operon genes (locus_tag) scrA HU985_14400 HVV26_09235 FD719_10830 H3N34_00965 FD720_04185 FD722_11585 HU831_00535 HWA77_17195 scrB HU985_14390 HVV26_09225 FD719_10820 H3N34_00955 FD720_04175 FD722_11575 HU831_00545 HWA77_17185 scrK HU985_14395 HVV26_09230 FD719_10825 H3N34_00960 FD720_04180 FD722_11580 HU831_00540 HWA77_17190 scrR HU985_14405 HVV26_09240 FD719_10835 H3N34_00970 FD720_04190 FD722_11590 HU831_00530...”
  • “...VANF00000000 VANH00000000 JABWTO000000000 JABXOR000000000 Sucrose operon genes (locus_tag) scrA HU985_14400 HVV26_09235 FD719_10830 H3N34_00965 FD720_04185 FD722_11585 HU831_00535 HWA77_17195 scrB HU985_14390 HVV26_09225 FD719_10820 H3N34_00955 FD720_04175 FD722_11575 HU831_00545 HWA77_17185 scrK HU985_14395 HVV26_09230 FD719_10825 H3N34_00960 FD720_04180 FD722_11580 HU831_00540 HWA77_17190 scrR HU985_14405 HVV26_09240 FD719_10835 H3N34_00970 FD720_04190 FD722_11590 HU831_00530 HWA77_17200...”
  • “...Accession no. JABWTP000000000 JABXOP000000000 VANE00000000 JACFTX000000000 VANF00000000 VANH00000000 JABWTO000000000 JABXOR000000000 Sucrose operon genes (locus_tag) scrA HU985_14400 HVV26_09235 FD719_10830 H3N34_00965 FD720_04185 FD722_11585 HU831_00535 HWA77_17195 scrB HU985_14390 HVV26_09225 FD719_10820 H3N34_00955 FD720_04175 FD722_11575 HU831_00545 HWA77_17185 scrK HU985_14395 HVV26_09230 FD719_10825 H3N34_00960 FD720_04180 FD722_11580 HU831_00540 HWA77_17190 scrR HU985_14405 HVV26_09240 FD719_10835 H3N34_00970...”
  • “...no. JABWTP000000000 JABXOP000000000 VANE00000000 JACFTX000000000 VANF00000000 VANH00000000 JABWTO000000000 JABXOR000000000 Sucrose operon genes (locus_tag) scrA HU985_14400 HVV26_09235 FD719_10830 H3N34_00965 FD720_04185 FD722_11585 HU831_00535 HWA77_17195 scrB HU985_14390 HVV26_09225 FD719_10820 H3N34_00955 FD720_04175 FD722_11575 HU831_00545 HWA77_17185 scrK HU985_14395 HVV26_09230 FD719_10825 H3N34_00960 FD720_04180 FD722_11580 HU831_00540 HWA77_17190 scrR HU985_14405 HVV26_09240 FD719_10835 H3N34_00970 FD720_04190...”

VCA0653 PTS system, sucrose-specific IIBC component from Vibrio cholerae O1 biovar eltor str. N16961
44% identity, 95% coverage

• Diverse Horizontally-Acquired Gene Clusters Confer Sucrose Utilization to Different Lineages of the Marine Pathogen Photobacterium damselae subsp. damselae
  Abushattal, Genes 2020
  • “...promising studies in Pdd . Interestingly, a recent study pointed out that the V. cholerae VCA0653 gene encoding the sucrose-specific PTS component ScrA, was 30-fold downregulated on the phase variation switch from wild-type-colony phenotype to a rugose-colony phenotype, associated with advanced biofilm architecture [ 64 ]....”
• A novel phase variant of the cholera pathogen shows stress-adaptive cryptic transcriptomic signatures
  Lambert, BMC genomics 2016
  • “...rugosity). Sugar transport and utilization Genes encoding components of the phosphoenolpyruvate phosphotransferase system (PTS), including VCA0653 ( srcA ), which encodes a sucrose-specific PTS component and VC1826, which encodes a putative fructose-specific PTS component, were both down-regulated at least 30 fold on the N16961 to N16961R...”

FD720_04185 sucrose-specific PTS transporter subunit IIBC from Photobacterium damselae subsp. damselae
43% identity, 94% coverage

• Diverse Horizontally-Acquired Gene Clusters Confer Sucrose Utilization to Different Lineages of the Marine Pathogen Photobacterium damselae subsp. damselae
  Abushattal, Genes 2020
  • “...VANE00000000 JACFTX000000000 VANF00000000 VANH00000000 JABWTO000000000 JABXOR000000000 Sucrose operon genes (locus_tag) scrA HU985_14400 HVV26_09235 FD719_10830 H3N34_00965 FD720_04185 FD722_11585 HU831_00535 HWA77_17195 scrB HU985_14390 HVV26_09225 FD719_10820 H3N34_00955 FD720_04175 FD722_11575 HU831_00545 HWA77_17185 scrK HU985_14395 HVV26_09230 FD719_10825 H3N34_00960 FD720_04180 FD722_11580 HU831_00540 HWA77_17190 scrR HU985_14405 HVV26_09240 FD719_10835 H3N34_00970 FD720_04190 FD722_11590 HU831_00530 HWA77_17200...”

Lebu_1906 PTS system, sucrose-specific IIBC subunit from Leptotrichia buccalis DSM 1135
43% identity, 92% coverage

• Metabolism of sugars by genetically diverse species of oral Leptotrichia
  Thompson, Molecular oral microbiology 2012
  • “...2009 ) reveals genetic loci for the phosphoenolpyruvate-dependent phosphotransferase systems (PEP-PTS) for glucose (Lebu_1946), sucrose (Lebu_1906) and lactose (Lebu_0588). Similar PEP-PTS operons are likely present in the genomes of L. goodfellowii , L. shahii and L. hofstadii , but presumably are absent in L. wadei ....”

SAV2377 PTS system, sucrose-specific IIBC component from Staphylococcus aureus subsp. aureus Mu50
SA2167 PTS system, sucrose-specific IIBC component from Staphylococcus aureus subsp. aureus N315
43% identity, 95% coverage

• Genome-wide analysis of the regulatory function mediated by the small regulatory psm-mec RNA of methicillin-resistant Staphylococcus aureus
  Cheung, International journal of medical microbiology : IJMM 2014
  • “.... Gene number 2 Function Factor of regulation MSA3407, up-regulated 02548 (COL) Protein A 43.2 SAV2377 (Mu50) PTS system, sucrose-specific IIBC component 20.7 SAV2538 (Mu50) PTS system, glucose-specific II ABC component 16.4 SAV2507 (Mu50) Gluconate operon transcriptional repressor 14.1 SAV1068 (Mu50) Phosphoribosylformylglycinamidine synthase I 11.5 SAV1065...”
• Two novel point mutations in clinical Staphylococcus aureus reduce linezolid susceptibility and switch on the stringent response to promote persistent infection
  Gao, PLoS pathogens 2010
  • “...fructose-specific IIBC component 2.2 SAV1507 malA alpha-D-1,4-glucosidase 5.7 SAV1508 malR maltose operon transcriptional repressor 8.0 SAV2377 scrA PTS system, sucrose-specific IIBC component 3.0 SAV2506 gntK gluconokinase 8.5 SAV2507 gntR gluconate operon transcriptional repressor 4.1 SAV2516 fbp fructose-bisphosphatase 3.6 ENERGY METABOLISM: TCA Cycle SAV1147 sdhC succinate dehydrogenase...”
• The C-terminal region of the RNA helicase CshA is required for the interaction with the degradosome and turnover of bulk RNA in the opportunistic pathogen Staphylococcus aureus
  Giraud, RNA biology 2015
  • “...YhxD SA2119 2.9 2.5 2.1 3.8 SA2147 TcaR transcription regulator tcaR 2.5 2.4 1.9 17.5 SA2167 PTS system, sucrose-specific IIBC component scrA 3.5 2.5 3.6 2.5 SA2172 Proton/sodium-glutamate symport protein gltT 3.6 3.6 2.9 2.5 SA2174 HTH-type transcriptional regulator SarZ SarZ 2.5 2.3 1.9 2.6 SA2206...”
• Global transcriptome analysis of Staphylococcus aureus biofilms in response to innate immune cells
  Scherr, Infection and immunity 2013
  • “...response regulator Accessory gene regulator protein C SA2167 SA1143 SA1111 SA1875 SA1920 Iron compound ABC transporter, iron compound-binding protein Iron...”
  • “...SA1141 SA0764 SA0140 SA1529 SA0860 SA1872 SA1797 SA2167 SA1451 SA2173 SA1339 SA1038 SA2007 SA0671 SA1576 SA2434 SA1941 Glucosamine-6-phosphate isomerase,...”
• Characterization of the oxygen-responsive NreABC regulon of Staphylococcus aureus
  Schlag, Journal of bacteriology 2008
  • “...SA0212 SA0318 SA0580 SA0653 SA0654 SA0655 SA1014 SA1675 SA1699 SA2167 SA2209 SA2242 SA2424 SA2425 SA2426 SA2427 SA2428 fruB fruA scrA hlgB arcC arcD arcB arcA...”
• Reporter metabolite analysis of transcriptional profiles of a Staphylococcus aureus strain with normal phenotype and its isogenic hemB mutant displaying the small-colony-variant phenotype
  Seggewiss, Journal of bacteriology 2006
  • “...SA1960 SA0293 SA2156 SA0589 SA2303 SA0208 SA2302 SA0111 SA0848 SA2167 SA0207 SA0849 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00...”

SAUSA300_2324 PTS system, sucrose-specific IIBC component from Staphylococcus aureus subsp. aureus USA300_FPR3757
NWMN_2279 PTS system, sucrose-specific IIBC component from Staphylococcus aureus subsp. aureus str. Newman
SACOL2376 PTS system, sucrose-specific IIBC components, putative from Staphylococcus aureus subsp. aureus COL
43% identity, 95% coverage

• Impact of the pentose phosphate pathway on metabolism and pathogenesis of Staphylococcus aureus
  Kim, PLoS pathogens 2023 (no snippet)
• Inactivation of the Ecs ABC transporter of Staphylococcus aureus attenuates virulence by altering composition and function of bacterial wall
  Jonsson, PloS one 2010
  • “...sodium/glutamate symporter 2.5 2.4 NWMN_2261 ABC transporter ATP-binding protein HtrB 2.2 NWMN_2268 L-lactate permease 3.0 NWMN_2279 PTS system sucrose-specific IIBC component 2.4 NWMN_2311 amino acid ABC transporter ATP-binding protein 2.0 NWMN_2343 drug transporter 0.5 NWMN_2349 amino acid permease 0.6 NWMN_2370 transporter 0.5 0.5 NWMN_2412 ABC transporter...”
• Virulence and Metabolism
  Richardson, Microbiology spectrum 2019 (secret)
• A new oxidative sensing and regulation pathway mediated by the MgrA homologue SarZ in Staphylococcus aureus
  Chen, Molecular microbiology 2009
  • “...pflA 37.3 + Pyruvate formate lyase activating enzyme SACOL0204 pflB 18.8 + Pyruvate formate lyase SACOL2376 scrA 5.3 PTS system, Sucrose-specific IIBC component SACOL0387 set11 9.1 Exotoxin 11 SACOL0122 tet38 5.1 + Tetracycline resistance protein SACOL0516 treP 6.7 PTS system, IIBC component SACOL0517 treC 4.0 ,...”

KQ76_12410 sucrose-specific PTS transporter subunit IIBC from Staphylococcus aureus
43% identity, 95% coverage

• Unveiling Co-Infection in Cystic Fibrosis Airways: Transcriptomic Analysis of Pseudomonas aeruginosa and Staphylococcus aureus Dual-Species Biofilms
  Magalhães, Frontiers in genetics 2022
  • “...[F] Nucleotide transport and metabolism 478.97 1.37E-06 KQ76_10310 Hypothetical protein [S] Function unknown 258.36 1.73E-02 KQ76_12410 PTS system trehalose-specific transporter [G] Carbohydrate transport and metabolism 241.41 1.68E-03 KQ76_12710 Hypothetical protein [S] Function unknown 179.40 6.13E-02 KQ76_13850 Mannose-6-phosphate isomerase [G] Carbohydrate transport and metabolism 118.54 8.20E-04 KQ76_13345...”

DLJ56_RS12685 sucrose-specific PTS transporter subunit IIBC from Staphylococcus aureus
43% identity, 95% coverage

• Limited Adaptation of Staphylococcus aureus during Transition from Colonization to Invasive Infection
  Räz, Microbiology spectrum 2023
  • “...929336 Del 36delT Phe12fs DLJ56_RS05000 Hypothetical protein CI2025 NZ_CP029629 2435974 Del 915_926del TGCAATTGGTGG Ala306_ Gly309del DLJ56_RS12685 PTS sucrose transporter subunit IIBC CI2025 NZ_CP029629 796734 SNP 167A>G Gln56Arg gatA DLJ56_RS04105 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA CI2016 NZ_CP029629 17890 SNP 85T>C Phe29Leu gdpP DLJ56_RS00075 Cyclic-di-AMP phosphodiesterase GdpP CI2025 NZ_CP029629...”

Asuc_0914 PTS system, sucrose-specific IIBC subunit from Actinobacillus succinogenes 130Z
46% identity, 97% coverage

• Recent advances in bio-based production of top platform chemical, succinic acid: an alternative to conventional chemistry
  Kumar, Biotechnology for biofuels and bioproducts 2024
  • “...40 ]. When they used BEs to delete the gene encoding of glucose transport ( Asuc_0914 ), which shared homology with ptsG gene (encoding glucose permease) in E. coli , they found a 1.24 fold increase in titer and yield of SA compared to parent strain....”
• Development of highly efficient and specific base editors in Actinobacillus succinogenes for enhancing succinic acid production
  Chen, Biotechnology for biofuels and bioproducts 2023
  • “...inactivate hypothetical sugar and SA transporters of A.succinogenes . We found that the inactivation of Asuc_0914 encoding sucrose-specific IIBC subunit enhanced SA production, while the inactivation of hypothetical SA transporters Asuc_0715 and Asuc_0716 significantly reduced SA production. Therefore, the tools have great application potential in the...”
  • “...synthesis, such as putative genes for associated transporters of sugars and SA. Here, inactivation of Asuc_0914 , encoding of sucrose-specific IIBC subunit that may be involved in glucose transport, and inactivation of hypothetical SA transporters Asuc_0715 and Asuc_0716 were found to be associated with SA production....”

SERP1968 PTS system, sucrose-specific IIBC components from Staphylococcus epidermidis RP62A
43% identity, 91% coverage

• Skin-to-blood pH shift triggers metabolome and proteome global remodelling in Staphylococcus epidermidis
  Gonçalves, Frontiers in microbiology 2022
  • “...concomitantly with their translocation across the cell membrane. Four proteins from this system (PtsG, SERP1900, SERP1968 and SERP2260) specific for glucose, sucrose and fructose transport, and enzymes generating phosphoenolpyruvate from oxaloacetate (PckA) and pyruvate (PpdK and its regulator SERP2169) support the fuelling of glycolysis in the...”

scrA / P51184 Enzyme II^scr (EC 2.7.1.211) from Staphylococcus xylosus (see paper)
PTSBC_STAXY / P51184 PTS system sucrose-specific EIIBC component; EIIBC-Scr; EII-Scr; EC 2.7.1.211 from Staphylococcus xylosus (see paper)
P51184 protein-Npi-phosphohistidine-sucrose phosphotransferase (EC 2.7.1.211) from Staphylococcus xylosus (see paper)
SXYL_00555 sucrose-specific PTS transporter subunit IIBC from Staphylococcus xylosus
43% identity, 95% coverage

• function: The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane (By similarity). This system is involved in sucrose transport (PubMed:8232209).
  catalytic activity: N(pros)-phospho-L-histidyl-[protein](out) + sucrose = sucrose 6(G)-phosphate(in) + L-histidyl-[protein] (RHEA:49236)
  disruption phenotype: Mutant is deficient in sucrose transport.
• Insight into the Genome of Staphylococcus xylosus, a Ubiquitous Species Well Adapted to Meat Products
  Leroy, Microorganisms 2017
  • “...SXYL_00253 EIIBC SXYL_00699 glcU Glucose uptake protein SXYL_01421 crr EIIA SXYL_01308 glkA Glucokinase Sucrose Lactate SXYL_00555 scrA EIIBC SXYL_00250 Lactate permease SXYL_00886 scrR Repressor SXYL_00577 Lactate permease SXYL_00887-88 scrBK Hydrolase, Fructokinase SXYL_00170 lactate-quinone oxidoreductase others Lactose SXYL_00060, SXYL_00626 Arbutin, EIIBC SXYL_00082 lacR Transcription activator SXYL_00528 Beta-glucoside,...”

CRIB_1461 PTS transporter subunit EIIC from Romboutsia ilealis
45% identity, 96% coverage

• Genomic and functional analysis of Romboutsia ilealis CRIB^T reveals adaptation to the small intestine
  Gerritsen, PeerJ 2017
  • “..., PTS system glucose-specific EIIBC component (CRIB_2017); 2 BC , PTS system sucrose-specific EIIBC component (CRIB_1461); 3, -fructofuranosidase with RDD family protein (CRIB_1459 and CRIB_1460); 4, fructokinase (CRIB_152 and CRIB_1458); 5; ABC-type transporter (CRIB_148-CRIB_150); 6, -fructofuranosidase (CRIB_151); 7, glucokinase (CRIB_1849); 8, glucose 6-phosphate isomerase (CRIB_140); 9,...”

PTTBC_BACSU / P39794 PTS system trehalose-specific EIIBC component; EIIBC-Tre; EII-Tre; EC 2.7.1.201 from Bacillus subtilis (strain 168) (see paper)
TC 4.A.1.2.8 / P39794 Trehalose porter, IIBC (TreP) (38% identical to 4.A.1.2.4) from Bacillus subtilis (see 5 papers)
NP_388661 phosphotransferase system (PTS) trehalose-specific enzyme IIBC component from Bacillus subtilis subsp. subtilis str. 168
BSU07800 phosphotransferase system (PTS) trehalose-specific enzyme IIBC component from Bacillus subtilis subsp. subtilis str. 168
40% identity, 94% coverage

• function: The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. This system is involved in trehalose transport.
  catalytic activity: alpha,alpha-trehalose(out) + N(pros)-phospho-L-histidyl- [protein] = alpha,alpha-trehalose 6-phosphate(in) + L-histidyl- [protein] (RHEA:33371)
• substrates: Trehalose
• Trans-translation is involved in the CcpA-dependent tagging and degradation of TreP in Bacillus subtilis.
  Ujiie, Journal of biochemistry 2009 (PubMed)
  • GeneRIF: Here, we demonstrated that the tmRNA-tagging of TreP occurs depending on the gene for CcpA.
• Reconstruction of the Regulatory Network for Bacillus subtilis and Reconciliation with Gene Expression Data
  Faria, Frontiers in microbiology 2016
  • “...Utilization. Table 7 Atomic Regulon 332. Gene name / BSU Stimuli Average PCC Function treP, BSU07800 D -fructose-1, 6-bisphosphate, Glucose-6-Phosphate, phosphate, D-trehalose-6-phosphate 0.807 PTS system, trehalose-specific IIB component (EC 2.7.1.69) treA, BSU07810 D -fructose-1, 6-bisphosphate, Glucose-6-Phosphate, phosphate, D-trehalose-6-phosphate 0.814 Trehalose-6-phosphate hydrolase (EC 3.2.1.93) treR, BSU07820 D...”
• Secondary structural entropy in RNA switch (Riboswitch) identification
  Manzourolajdad, BMC bioinformatics 2015
  • “...0.363 1806 degS BSU35500 0.818 74 850053 850209 forward BSU07750 yflA -3789 0.3694 236 treP BSU07800 0.817 75 255279 255435 forward BSU02330 ybfQ -1718 0.2994 2434 ybgA BSU02370 0.816 76 1541729 1541885 forward BSU14680 ykzC -2958 0.3376 79 ylaA BSU14710 0.816 77 909862 910018 forward BSU08330...”
  • “...nt 850067 850266 forward BSU07750 yflA -3783 -57.20 - 0.4000 124.1029968 - 0.3800 202 treP BSU07800 0.9058393836 200 nt 1466905 1467104 forward BSU13960 ykwC -207 -56.93 - 0.3900 123.7220001 - 0.4200 802 pbpH BSU13980 0.9029595852 200 nt 3759694 3759893 forward BSU36530 bcrC -467 -62.40 - 0.3850...”

ERIC1_1c04630, ERIC2_c17680 PTS system trehalose-specific EIIBC component from Paenibacillus larvae subsp. larvae DSM 25430
40% identity, 94% coverage

• How to kill the honey bee larva: genomic potential and virulence mechanisms of Paenibacillus larvae
  Djukic, PloS one 2014
  • “...strains are equipped with a putative trehalose specific II c component of a PTS system (ERIC1_1c04630; ERIC2_c17680) for uptake of the disaccharide. A regulated uptake system for trehalose might correspond to the second, the invasive phase of infection. In this phase when the bacteria invade the...”
  • “...are equipped with a putative trehalose specific II c component of a PTS system (ERIC1_1c04630; ERIC2_c17680) for uptake of the disaccharide. A regulated uptake system for trehalose might correspond to the second, the invasive phase of infection. In this phase when the bacteria invade the haemocoel...”

LLKF_0663 PTS system sucrose-specific transporter subunit IIABC from Lactococcus lactis subsp. lactis KF147
41% identity, 70% coverage

• Strain-Dependent Transcriptome Signatures for Robustness in Lactococcus lactis
  Dijkstra, PloS one 2016
  • “...DnaK negative 12.8 LLKF_1695 thiL acetyl-CoA acetyltransferase positive 4.6 LLKF_0551 dfpA phosphopantothenoylcysteine decarboxylase positive 1.5 LLKF_0663 scrA PTS system sucrose-specific transporter subunit IIABC positive 0.5 LLKF_2232 hypothetical protein negative 0.9 LLKF_1965 sufD SUF system FeS cluster assembly protein SufD positive 11.3 LLKF_0510 adaA methylphosphotriester-DNA alkyltransferase positive...”

BB562_00810 sucrose-specific PTS transporter subunit IIBC from Lactiplantibacillus pentosus
41% identity, 70% coverage

• Transcriptomic Profile and Probiotic Properties of Lactiplantibacillus pentosus Pre-adapted to Edible Oils
  Alonso, Frontiers in microbiology 2021
  • “...This study greAR ACTGGATATTGGCAAGTTCG BB562_01140 (Cysteine synthase) cysF ATGCTCGTACACCATATCCA 56 200 This study cysR TCAATGATGGTGGTCGTGG BB562_00810 (PTS beta-glucoside transporter subunit EIIBCA) ptsF TTATAAATTAACCGCGGCAG 56 200 This study ptsR ATCAAGGTGACTTACTCGGT BB562_11880 (Transketolase) trakF ATGAACTTAA GCTGAAAGCG 56 199 This study trakR ACCGCATGGCCTTTCGATT pheS (Phenylalanyl-tRNA synthase alpha subunit) pheS-21F...”
  • “...for 1,4-alpha-glucan branching enzyme (BB562_00085), glucose-1-phosphate adenylyltransferase (BB562_00090), phosphotransferase system (PTS) beta-glucoside transporter subunit EIIBCA (BB562_00810), sucrose-6-phosphate hydrolase (BB562_00815), and alpha, alpha-phosphotrehalase (BB562_01175) were detected ( Supplementary Table 1 and Supplementary Figure 2 ). Olive Oil Adaptation Changes Nucleotide and Amino Acid Metabolism in L. pentosus...”

PS417_23050 trehalose PTS system, EII-BC components TreB from Pseudomonas simiae WCS417
39% identity, 94% coverage

• mutant phenotype: Specifically important for trehalose utilization.

KSF55_00925 sucrose-specific PTS transporter subunit IIBC from Lactiplantibacillus pentosus
41% identity, 70% coverage

• Genome-wide transcriptomics revealed carbon source-mediated gamma-aminobutyric acid (GABA) production in a probiotic, <i>Lactiplantibacillus pentosus</i> 9D3
  Raethong, Heliyon 2025
  • “...KSF55_15895 Galactitol PTS Down Up KSF55_15890 Galactitol PTS Down Up KSF55_15680 Ascorbate PTS Down Up KSF55_00925 Sucrose PTS Down Up a The up- or down-regulated DEGs in the glucose culture were considered by comparing glucose to sucrose or lactose cultures. b The up- or down-regulated DEGs...”
  • “...in starch and sucrose metabolism were more enriched in the sucrose culture, such as KSF55_00920, KSF55_00925, KSF55_00930, and KSF55_00940, which encode fructokinase, sucrose PTS system, beta-fructofuranosidase, and oligo-1,6-glucosidase, respectively. 3.4 Carbon source-mediated transcriptional change patterns in L. pentosus 9D3 A hierarchical clustering analysis compared the gene...”

NH13_02050 sucrose-specific PTS transporter subunit IIBC from Lactobacillus acidophilus
40% identity, 69% coverage

• Draft Genome Sequence of the Probiotic Strain Lactobacillus acidophilus ATCC 4356
  Palomino, Genome announcements 2015
  • “...utilization functions were predicted by RASTtk, particularly the PTS system for N -acetylglucosamine-specific IIABC components (NH13_02050), as well as the N -acetyl- d -glucosamine ABC transport system, permease protein (NH13_08155). Mechanisms of the enzymes degrading N -acetylglucosamine ( 15 ) are predicted: NagB, GlcN6P deaminase (NH13_09645)...”

HZ99_RS23185 PTS system trehalose-specific EIIBC component from Pseudomonas fluorescens
39% identity, 94% coverage

• Combined Transcriptome and Proteome Analysis of RpoS Regulon Reveals Its Role in Spoilage Potential of Pseudomonas fluorescens
  Liu, Frontiers in microbiology 2019
  • “...0.237 (2.95E-02) 0.553 (1.08E-02) Down/Down HZ99_RS19405 WP_038445324.1 Maltodextrin phosphorylase GlgP 0.190 (1.31E-09) 0.553 (5.91E-03) Down/Down HZ99_RS23185 WP_038446334.1 Trehalose permease IIC protein 0.554(5.91E-03) /Down INTRACELLULAR SECRETION AND EXTRACELLULAR STRUCTURES HZ99_RS00355 WP_080727762.1 Type V secretory pathway, adhesin AidA 0.032 (3.29E-03) - Down/ HZ99_RS03975 WP_008603564.1 FapF 0.017 (3.21E-08) 0.468...”

lp_0185 sucrose PTS, EIIBCA from Lactobacillus plantarum WCFS1
LP_RS00755, lp_0185 sucrose-specific PTS transporter subunit IIBC from Lactiplantibacillus plantarum WCFS1
41% identity, 70% coverage

• Strain diversity of plant-associated Lactiplantibacillus plantarum
  Yu, Microbial biotechnology 2021
  • “...to a limited extent on sucrose (Fig. 2 ), lacks the first 650bp of pts1BCA (lp_0185), a gene in the sucrose phosphoenolpyruvate (PEP)dependent phosphotransferase system (PTS; Saulnier etal ., 2007 ; Yin etal ., 2018 ). The number of gene clusters in the other COG categories...”
• Butanol Tolerance of Lactiplantibacillus plantarum: A Transcriptome Study
  Petrov, Genes 2021
  • “...glucose transporter subunit IIA NC 2.30 lp_0575, pts9AB PTS mannose transporter subunit IIAB NC 6.36 lp_0185, pts1BCA PTS -glucoside transporter subunit IIBCA NC 4.96 lp_2649, pts19C PTS N-acetylgalactosamine transporter IIC 12.45 2.88 lp_3009, pts23B PTS sugar transporter subunit IIB 2.19 3.02 lp_0265, pts5ABC PTS transporter subunit...”
• Lifestyle of Lactobacillus plantarum in the mouse caecum
  Marco, Environmental microbiology 2009
  • “...al., 2004 ). Seven of these genes, including (i) pts 19A (lp_2647) and pts 1BCA (lp_0185) encoding components of N -acetylgalactosamine and sucrose PTS systems, (ii) dhaT , encoding 1,3 propanediol dehydrogenase, and (iii) adhE , encoding a bifunctional alcohol dehydrogenase and acetaldehyde dehydrogenase, were also...”
• Identification of prebiotic fructooligosaccharide metabolism in Lactobacillus plantarum WCFS1 through microarrays
  Saulnier, Applied and environmental microbiology 2007
  • “...the products of the gene encoding a sucrose PTS (lp_0185) in Lactobacillus spp. strains other than L. plantarum strains were low. The first proteins showing a...”
  • “...M FOD1.5b Energy metabolism and transport lp_0184 lp_0185 lp_0187 lp_0189 lp_0193 lp_0280 lp_0286 lp_0329 lp_0393 lp_0764 lp_0849 lp_1101 lp_1102 lp_1105...”
• An agr-like two-component regulatory system in Lactobacillus plantarum is involved in production of a novel cyclic peptide and regulation of adherence
  Sturme, Journal of bacteriology 2005
  • “...and trehalose phosphotransferase system genes lp_0185, lp_0436, and lp_0264, respectively). Cluster 2 encompassed constitutively down-regulated genes,...”
  • “...University of California, Berkeley Cluster 1 lp_0184 lp_0185 lp_0187 lp_0188 lp_0189 lp_0263 lp_0264 lp_0435 lp_0436 lp_3480 lp_3481 lp_3482 Geneb L. PLANTARUM...”
• Saccharomyces cerevisiae strains L7 contribute to flavor and deacidification in Suanyu, a Chinese traditional fermented fish
  Wenkang, NPJ science of food 2024
  • “...amino sugar and nucleotide sugar metabolism. In the starch and sucrose metabolism pathway, the genes LP_RS00755 (coding for scrA, sucrose phosphotransferase), LP_RS00760 (coding for sacA, fructofuranosidase), and LP_RS00750 (coding for scrK, fructokinase) were downregulated. Multiple genes associated with sugar metabolism were downregulated under co-culture conditions, indicating...”

SA0432 PTS enzyme II, phosphoenolpyruvate-dependent, trehalose-specific from Staphylococcus aureus subsp. aureus N315
SAV0474 phosphoenolpyruvate-dependent and trehalose-specific PTS enzyme II from Staphylococcus aureus subsp. aureus Mu50
41% identity, 92% coverage

• Activity of Telavancin against Staphylococcus aureus Isolates, Including Those with Decreased Susceptibility to Ceftaroline, from Cystic Fibrosis Patients
  Roch, Antimicrobial agents and chemotherapy 2018
  • “...A>G A>G A>G L218P thrS SA1506 Threonyl-tRNA synthetase C>T C>T C>T C>T C>T G60E treP SA0432 PTS system, trehalose-specific IIB component C>G C>G C>G C>G C>G A381G uvrA SA0714 Excinuclease ABC subunit A T>C T>C TA>CG T>C TA>CG L857P murQ SA0185 N -Acetylmuramic acid 6-phosphate etherase...”
• Exposure of clinical MRSA heterogeneous strains to β-lactams redirects metabolism to optimize energy production through the TCA cycle
  Keaton, PloS one 2013
  • “...in the regulation of glycerol uptake and metabolism, glycerolipid metabolism (catalyzes glycerol to glycerol 3-P). SA0432 treP 13.4 PTS enzyme II, phosphoenol-pyruvate-dependent, trehalose-specific Phosphotransferase transport system (PTS), trehalose-specific. Carbohydrate Transport and Metabolism Differentially regulated genes in the group of carbohydrate transport and metabolism included genes involved...”
  • “...A pronounced reduction in the expression of trehalose specific, phosphoenolpyruvate-dependent phosphotransferase system (13-fold; treP , SA0432) and -glucosidase (23-fold; SA0433) that converts trehalose into D-glucose-6-phosphate was observed. Moreover, expression of several additional sugar phosphotranspherase transport systems were down-regulated during HeR/HoR selection including putative mannose specific PTS...”
• Global transcriptome analysis of Staphylococcus aureus biofilms in response to innate immune cells
  Scherr, Infection and immunity 2013
  • “...SA2736 SA1137 SA1569 SA1794 SA1285 SA1205 SA0563 SA1495 SA0432 SA1107 SA0540 SA0970 SA1839 SA1523 SA0513 SA1752 SA2131 SA0314 SA1323 SA1832 SA1065 SA1954 SA2634...”
• Characterizing the effects of inorganic acid and alkaline shock on the Staphylococcus aureus transcriptome and messenger RNA turnover
  Anderson, FEMS immunology and medical microbiology 2010
  • “...SA0179 phosphosugar-binding transcriptional regulator sa_c7020s6143_a_at 2.9 2.5 ND SA0404 transcriptional regulator sa_c7120s6232_a_at 3.4 2.5 ND SA0432 spoOJ protein sa_c7424s6449_a_at 4.1 2.5 2.5 SA0518 GntR family transcriptional regulator sa_c8164s7148_a_at 18.0 2.5 2.5 SA0757 DeoR family transcriptional regulator sa_c8938s7854_at 12.2 2.5 ND SA0772 exsB protein sa_c791s594_at * 17.0...”
• Effect of a glucose impulse on the CcpA regulon in Staphylococcus aureus
  Seidl, BMC microbiology 2009
  • “...additional factors 1 ID Product a wt mut N315 Newman common +/- b +/- b SA0432 NWMN_0438 treP PTS system, trehalose-specific IIBC component 0.5 0.2 SA0433 NWNM_0439 treC alpha-phosphotrehalose 0.7 0.3 SA0434 NWNM_0440 treR trehalose operon repressor 0.7 0.3 SA1218 NWNM_1297 pstB phosphate ABC transporter, ATP-binding...”
  • “...1.2 SA2444 NWMN_2550 similar to accessory secretory protein Asp2 2.3 1.3 Partially controlled by CcpA SA0432 NWMN_0438 treP PTS system, trehalose-specific IIBC component 0.5 0.2 SA1218 NWNM_1297 pstB phosphate ABC transporter, ATP-binding protein (PstB) 0.5 2.6 SA1219 NWNM_1298 similar to phosphate ABC transporter 0.4 2.7 SA1220...”
• Reporter metabolite analysis of transcriptional profiles of a Staphylococcus aureus strain with normal phenotype and its isogenic hemB mutant displaying the small-colony-variant phenotype
  Seggewiss, Journal of bacteriology 2006
  • “...SEGGEWI ET AL. J. BACTERIOL. TABLE 2--Continued Fold changeb SA0432 SA0209 SA0206 SA0640 0.00 0.00 0.00 0.00 2.52 0.20 0.20 2.01 SA0172 SA0186 SA0639 0.00 0.00...”
• Transcription profiling-based identification of Staphylococcus aureus genes regulated by the agr and/or sarA loci
  Dunman, Journal of bacteriology 2001
  • “...SA2183 SA1656 SA1441 SA0434 SA0460 SA0796 SA1140 SA1183 SA0432 SA1269 SA1270 SA2300 SA0212 SA0412 SA2378 SA0107 SA2093 SA0102 DNA replication DNA replication...”
• Staphylococcus aureus virulence expression is impaired by Lactococcus lactis in mixed cultures
  Even, Applied and environmental microbiology 2009
  • “...SAV0269 SAV0214 MW0245 MW0190 rbsD SAV2158 SAV0189 SAV2323 SAV0474 MW2084 MW0163 MW2244 MW0428 mtlA glcA glvC treP SAV0771 MW0733 gapR MW2526 MW0999 MW0586...”

PTS3B_STRMU / P12655 PTS system sucrose-specific EIIBCA component; EIIBCA-Scr; EII-Scr; EC 2.7.1.211 from Streptococcus mutans serotype c (strain ATCC 700610 / UA159) (see 2 papers)
P12655 protein-Npi-phosphohistidine-sucrose phosphotransferase (EC 2.7.1.211) from Streptococcus mutans serotype c (see 3 papers)
scrA / GB|AAN59464.1 PTS system, sucrose-specific, EIIBCA component; EC 2.7.1.69 from Streptococcus mutans (see paper)
SMUGS5_08275, SMU_1841, SMU_RS08435 sucrose-specific PTS transporter subunit IIBC from Streptococcus mutans GS-5
40% identity, 67% coverage

• function: The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane (PubMed:2536656, PubMed:468378). This system is involved in sucrose transport (PubMed:2536656, PubMed:468378).
  catalytic activity: N(pros)-phospho-L-histidyl-[protein](out) + sucrose = sucrose 6(G)-phosphate(in) + L-histidyl-[protein] (RHEA:49236)
• Cnm of Streptococcus mutans is important for cell surface structure and membrane permeability
  Naka, Frontiers in cellular and infection microbiology 2022
  • “...SMU_1905c Bacteriocin secretion protein 1029103 SMU_1905c 2.748 scrA PTS system sucrose-specific transporter subunit IIABC 1029057 SMU_1841 2.701 SMU_1118c ABC sugar transporter, permease 1028430 SMU_1118c 2.609 opuBc Choline ABC transporter, osmoprotectant binding protein 1028413 SMU_1095 2.592 trk Potassium uptake protein TrkA 1028798 SMU_1562 2.544 pacL Cation-transporting P-type...”
• Identification of the antibacterial action mechanism of diterpenoids through transcriptome profiling
  Moon, Frontiers in microbiology 2022
  • “...* AA CA KA DM SMU_RS09355 PTS transporter subunit EIIC ptsG 1.39 3.48 2.10 2.37 SMU_RS08435 PTS beta-glucoside transporter subunit IIBCA scrA 0.68 3.83 2.06 2.13 SMU_RS04505 PTS transporter subunit EIIC bglP 0.62 4.11 2.20 2.14 SMU_RS06770 PTS transporter subunit EIIC lacE 0.65 1.42 1.45 1.69...”
• D‑Tagatose inhibits the growth and biofilm formation of Streptococcus mutans
  Hasibul, Molecular medicine reports 2018
  • “...EII-mal/glu-F acacaatatctttggcggtaaga 105 EII-mal/glu-R cgaaaccagagataataccaacg SMUGS5_03875 Fructose-specific PTS subunit IIABC EII-fru-F tgatacttttaaggctgggatca 116 EII-fru-R aaaagaaccgttgcttcctttac SMUGS5_08275 Sucrose-specific PTS subunit IIABC EII-sucF ggtgtctttggtgctctgtattc 113 EII-suc-R gtcaccatgaccagtaccatttt SMUGS5_R09892 16S ribosomal RNA 16SF cctacgggaggcagcagtag 101 16SR caacagagctttacgatccgaaa...”
• RNA-Seq Reveals Enhanced Sugar Metabolism in Streptococcus mutans Co-cultured with Candida albicans within Mixed-Species Biofilms
  He, Frontiers in microbiology 2017
  • “...Ajdi and Pham, 2007 ; Moye et al., 2014 ). Here, we observed that scrA (SMU_1841), scrB (SMU_1843), and scrK (SMU_1840) were significantly up-regulated in dual-species biofilms (vs. single species S. mutans ; Supplementary Table S1 ). The scr A gene encodes a high-affinity sucrose PTS...”
• Systematic analysis of lysine malonylation in Streptococcus mutans
  Li, Frontiers in cellular and infection microbiology 2022
  • “...name Protein description Modified sites Cytoplasmic membrane I6L922 SMU_765 NADH oxidase/alkyl hydroperoxidase reductase peroxide-forming 109 P12655 scrA PTS system sucrose-specific EIIBCA component 46, 601 Q8CVC6 prsA Foldase protein PrsA 253 Q8DRU8 opuCa Putative osmoprotectant amino acid ABC transporter, ATP-binding protein 23 Q8DRV8 SMU_2104 APC family permease(predicted)...”
• Shotgun Metagenomics of a Water Kefir Fermentation Ecosystem Reveals a Novel Oenococcus Species
  Verce, Frontiers in microbiology 2019
  • “...PTS EIIBCA components encoded by Pediococcus pentosaceus and Streptococcus mutans (Swissprot accession numbers P43470 and P12655 , respectively) was found only in L. harbinensis, L. hordei/mali , and L. nagelii , all in the vicinity of a -fructofuranosidase/sucrose-6-phosphate hydrolase-encoding gene. Genes encoding the mannose-class PTS components...”

CPF_1785 PTS system, sucrose-specific IIBC component from Clostridium perfringens ATCC 13124
43% identity, 98% coverage

• Effect of Trehalose and Trehalose Transport on the Tolerance of Clostridium perfringens to Environmental Stress in a Wild Type Strain and Its Fluoroquinolone-Resistant Mutant
  Park, International journal of microbiology 2016
  • “...596.80 133.1 TTGATATTAAAGCAAGTATGGGACT CPF_1956 topA ACCTTGCAACTGACCCTGAT 2.38 2.42 2.07 CAGCACTCAATCCCCATTTT CPF_1760 topB AACTTGGGCTTTAGGCCATT 1.61 GCTACGAGCTCCCCTTCTCT CPF_1785 PTS sucrose-specific IIBC component GCGGCCATATTTGGAGTAAA 92.15 CCAGTTCCAGCCAATTTCAT a treB and treC are trehalose-specific genes. The transcription of several genes was considerably decreased in the mutant 13124 GR in comparison with...”
• Global Phenotypic Characterization of Effects of Fluoroquinolone Resistance Selection on the Metabolic Activities and Drug Susceptibilities of Clostridium perfringens Strains
  Park, International journal of microbiology 2014
  • “...Growth of 13124 GR also was reduced on maltose. Microarray data also showed that the CPF_1785 and CPF_0541 genes, for the transport of sucrose and trehalose, respectively, into the cells, were downregulated 15- and 31-fold in a gatifloxacin-resistant mutant, 13124 GR , and putative maltose transporters...”
  • “...growth on maltose. Downregulation of genes involved in the sucrose and trehalose-specific phosphotransferase (PTS) systems CPF_1785 and CPF_0541 , the maltose ABC transporter CPF_2652 , and a putative maltose transporter CPF_2654 in the gatifloxacin-resistant strain 13124 GR was observed, which may have resulted in the lack...”
• Comparative transcription analysis and toxin production of two fluoroquinolone-resistant mutants of Clostridium perfringens
  Park, BMC microbiology 2013
  • “...2 1.6 Transport and binding proteins CPE0600 CPF_0581 amino acid ABC transporter 4.8 3.4 CPE1534 CPF_1785 PTS system, sucrose-specific IIBC component 3.1 14.3 CPE2345 CPF_2654 putative maltose/maltodextrin ABC transporter 2.0 1.8 Unknown functions CPE2509 CPF_2832 degV family protein 3.6 3.3 CPE1171 CPF_1374 mutator mutT protein homolog...”

CPE1534 probable PTS system from Clostridium perfringens str. 13
43% identity, 98% coverage

• Comparative transcription analysis and toxin production of two fluoroquinolone-resistant mutants of Clostridium perfringens
  Park, BMC microbiology 2013
  • “...regulator 2 1.6 Transport and binding proteins CPE0600 CPF_0581 amino acid ABC transporter 4.8 3.4 CPE1534 CPF_1785 PTS system, sucrose-specific IIBC component 3.1 14.3 CPE2345 CPF_2654 putative maltose/maltodextrin ABC transporter 2.0 1.8 Unknown functions CPE2509 CPF_2832 degV family protein 3.6 3.3 CPE1171 CPF_1374 mutator mutT protein...”

AO353_15980 trehalose PTS system, EII-BC components TreB from Pseudomonas fluorescens FW300-N2E3
38% identity, 94% coverage

• mutant phenotype: Specifically important for trehalose utilization.

BSQ49_00775 sucrose-specific PTS transporter subunit IIBC from Liquorilactobacillus hordei
40% identity, 68% coverage

• Living the Sweet Life: How Liquorilactobacillus hordei TMW 1.1822 Changes Its Behavior in the Presence of Sucrose in Comparison to Glucose
  Bechtner, Foods (Basel, Switzerland) 2020
  • “...6.01 Sucrose-6-phosphate hydrolase fig|468911.3.peg.158 BSQ49_00770 14 1.04 8.10 PTS system, sucrose-specific EIIBCA components Carbohydrates fig|468911.3.peg.159 BSQ49_00775 15 0.35 3.81 6-phospho-beta-glucosidase Carbohydrates fig|468911.3.peg.251; fig|468911.3.peg.1214 BSQ49_01215; BSQ49_06130 16 0.38 3.94 PTS system, unknown specificity IIA component Carbohydrates fig|468911.3.peg.252 BSQ49_01220 17 0.43 2.87 Glucohydrolase (putative alpha-glucosidase activity) fig|468911.3.peg.395 BSQ49_01980...”

NWMN_0438 PTS system, trehalose-specific IIBC component from Staphylococcus aureus subsp. aureus str. Newman
40% identity, 92% coverage

• Essential Fitness Repertoire of Staphylococcus aureus during Co-infection with Acinetobacter baumannii In Vivo
  Li, mSystems 2022
  • “...and hypothetical protein (NWMN_0560). Twenty genes unique to co-infection, such as phosphotransferase system protein TreP (NWMN_0438), oxidoreductase (NWMN_2478), deoxynucleoside kinase (NWMN_0518), Na + /H + antiporter MnhG (NWMN_0599), and oligopeptide transport permease (NWMN_0856), were required for the colonization of both tissues ( Fig.3C ). Interestingly, genes...”
  • “...including the mono-infection-unique essential gene sbnB (NWMN_0061) encoding ornithine cyclodeaminase, the co-infection-unique essential gene treP (NWMN_0438) encoding trehalose-specific transporter, and the in vivo non-essential gene sasF (NWMN_2545) encoding cell-wall-anchored protein SasF, were selected based on the fold change of Tn-seq reads of differentially screened genes. Note...”
• Effect of a glucose impulse on the CcpA regulon in Staphylococcus aureus
  Seidl, BMC microbiology 2009
  • “...factors 1 ID Product a wt mut N315 Newman common +/- b +/- b SA0432 NWMN_0438 treP PTS system, trehalose-specific IIBC component 0.5 0.2 SA0433 NWNM_0439 treC alpha-phosphotrehalose 0.7 0.3 SA0434 NWNM_0440 treR trehalose operon repressor 0.7 0.3 SA1218 NWNM_1297 pstB phosphate ABC transporter, ATP-binding protein...”
  • “...SA2444 NWMN_2550 similar to accessory secretory protein Asp2 2.3 1.3 Partially controlled by CcpA SA0432 NWMN_0438 treP PTS system, trehalose-specific IIBC component 0.5 0.2 SA1218 NWNM_1297 pstB phosphate ABC transporter, ATP-binding protein (PstB) 0.5 2.6 SA1219 NWNM_1298 similar to phosphate ABC transporter 0.4 2.7 SA1220 NWNM_1299...”

MW0428 PTS enzyme II from Staphylococcus aureus subsp. aureus MW2
SAS0431 sugar-specific PTS transport system, IIBC component from Staphylococcus aureus subsp. aureus MSSA476
40% identity, 92% coverage

• Staphylococcus aureus virulence expression is impaired by Lactococcus lactis in mixed cultures
  Even, Applied and environmental microbiology 2009
  • “...rbsD SAV2158 SAV0189 SAV2323 SAV0474 MW2084 MW0163 MW2244 MW0428 mtlA glcA glvC treP SAV0771 MW0733 gapR MW2526 MW0999 MW0586 MW0588 mqo2 ctaB MW1772 MW0590...”
• Exposure of clinical MRSA heterogeneous strains to β-lactams redirects metabolism to optimize energy production through the TCA cycle
  Keaton, PloS one 2013
  • “...Facilitates diffusion of glycerol into the cells. SA0433 23.1 alpha-glucosidase Converts trehalose-6-P into D-glucose 6-P. SAS0431 11.2 sugar-specific PTS transport system, IIBC component Phosphotransferase transport system (PTS), SAS0432 19.8 putative glycosyl hydrolase Converts trehalose-6-P into glucose-6-P. SAR2247 mtlD 5.2 mannitol-1-phosphate 5-dehydrogenase Catalyzes: D-mannitol-1-P+NAD+=D-fructose-6-P+NADH SA1336 2 glucose-6-phosphate...”
• Two novel point mutations in clinical Staphylococcus aureus reduce linezolid susceptibility and switch on the stringent response to promote persistent infection
  Gao, PLoS pathogens 2010
  • “...0.5 SAV2538 ptsG PTS system, glucose-specific II ABC component 0.3 Up-regulated MW2435 fructose-bisphosphatase (fbp) 2.2 SAS0431 sugar-specific PTS transport system, IIBC component (trehalose) 2.2 SAS1448 maltose operon transcriptional repressor 7.5 SAV0247 gatC probable PTS galactitol-specific enzyme IIC component 2.0 SAV0700 fruA PTS system, fructose-specific IIBC component...”

SAUSA300_0448 PTS system, trehalose-specific IIBC component from Staphylococcus aureus subsp. aureus USA300_FPR3757
SAOUHSC_00437 hypothetical protein from Staphylococcus aureus subsp. aureus NCTC 8325
SACOL0516 PTS system, IIBC components from Staphylococcus aureus subsp. aureus COL
40% identity, 92% coverage

• Cigarette Smoke Extract-Exposed Methicillin-Resistant Staphylococcus aureus Regulates Leukocyte Function for Pulmonary Persistence
  Kulkarni, American journal of respiratory cell and molecular biology 2016
  • “...SAUSA300_0202 SAUSA300_0203 SAUSA300_2440 SAUSA300_0018 SAUSA300_0448 SAUSA300_0224 SAUSA300_0019 SAUSA300_0524 narZ SAUSA300_0987 SAUSA300_1029 SAUSA300_0349...”
• Suppression of Staphylococcus aureus biofilm formation and virulence by a benzimidazole derivative, UM-C162
  Kong, Scientific reports 2018
  • “...SAOUHSC_01311, SAOUHSC_01312, SAOUHSC_02821 p <0.001 Down-regulated Cell wall/external encapsulating structure 23 SAOUHSC_00114, SAOUHSC_00356, SAOUHSC_00383, SAOUHSC_00386, SAOUHSC_00437, SAOUHSC_01127, SAOUHSC_02549, SAOUHSC_02708, SAOUHSC_02971, capF , capL , capA , clfA , clfB , eno , hlgB , hlgC , sspA , sbi , hlb , sasA , sdrC ,...”
  • “...2.91 Intracellular multiplication clpB 9.54 clpC 5.23 ctsR 8.61 Surface protein of Gram positive cocci SAOUHSC_00437 3.69 SAOUHSC_02549 2.75 Teichoic acid biosynthesis protein SAOUHSC_00974 25.4 SAOUHSC_00643 2.6 Peptidoglycan biosynthesis SAOUHSC_01987 2.12 In addition to genes encoding cell adhesion and attachment, treatment of S . aureus with...”
• A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome
  Becher, PloS one 2009
  • “...SACOL1320 (GlpK), SACOL1319 (GlpF), SACOL0200, SACOL0407 (GlpT)], or consumption of alternative sugars [SACOL1393 (GlcT), SACOL2663, SACOL0516, SACOL0178, SACOL0224, SACOL2316]. Of the proteins down-regulated in stationary phase numerous could be assigned to the category of iron uptake facilitation [SACOL2010, SACOL2277, SACOL2167, SACOL0799, SACOL0099 (SirA), SACOL0704] or to...”
• A new oxidative sensing and regulation pathway mediated by the MgrA homologue SarZ in Staphylococcus aureus
  Chen, Molecular microbiology 2009
  • “...Sucrose-specific IIBC component SACOL0387 set11 9.1 Exotoxin 11 SACOL0122 tet38 5.1 + Tetracycline resistance protein SACOL0516 treP 6.7 PTS system, IIBC component SACOL0517 treC 4.0 , phosphotreharase SACOL0012 2.8 Homoserin O-acetyltransferase SACOL0176 6.3 + Conserved hypothetical protein SACOL0177 4.6 Glucokinase-regulator-related protein SACOL0183 3.4 Conserved hypothetical protein...”
• A defect in menadione biosynthesis induces global changes in gene expression in Staphylococcus aureus
  Kohler, Journal of bacteriology 2008
  • “...play a role in the uptake of trehalose (SACOL0516), mannitol (SACOL2146), and fructose (SACOL2663) and also of glucose (ptsI, SACOL0175, SACOL2552) (see Table...”

AW20_2116 PTS system trehalose-specific EIIBC component from Bacillus anthracis str. Sterne
BAS0598 PTS system, trehalose-specific IIBC component from Bacillus anthracis str. Sterne
39% identity, 94% coverage

• Beyond the spore, the exosporium sugar anthrose impacts vegetative Bacillus anthracis gene regulation in cis and trans
  Norris, Scientific reports 2023
  • “...Pyruvate formate-lyase activating enzyme 1.18 AW20_2081 BAS0631 Ribose operon repressor; transcriptional regulator LacI/PurR family 1.20 AW20_2116 BAS0598 TreB; PTS system, trehalose-specific IIBC component 1.26 AW20_5282 BAS2949 Magnesium and cobalt transport protein CorA 1.33 AW20_3236 BAS4922 Nucleoside transporter, NupC family 1.45 AW20_2625 BAS0165 GntP; Gluconate permease, Bsu4004...”
• Beyond the spore, the exosporium sugar anthrose impacts vegetative Bacillus anthracis gene regulation in cis and trans
  Norris, Scientific reports 2023
  • “...formate-lyase activating enzyme 1.18 AW20_2081 BAS0631 Ribose operon repressor; transcriptional regulator LacI/PurR family 1.20 AW20_2116 BAS0598 TreB; PTS system, trehalose-specific IIBC component 1.26 AW20_5282 BAS2949 Magnesium and cobalt transport protein CorA 1.33 AW20_3236 BAS4922 Nucleoside transporter, NupC family 1.45 AW20_2625 BAS0165 GntP; Gluconate permease, Bsu4004 homolog...”

P43470 PTS system sucrose-specific EIIBCA component from Pediococcus pentosaceus
41% identity, 70% coverage

• Shotgun Metagenomics of a Water Kefir Fermentation Ecosystem Reveals a Novel Oenococcus Species
  Verce, Frontiers in microbiology 2019
  • “...the sucrose-specific PTS EIIBCA components encoded by Pediococcus pentosaceus and Streptococcus mutans (Swissprot accession numbers P43470 and P12655 , respectively) was found only in L. harbinensis, L. hordei/mali , and L. nagelii , all in the vicinity of a -fructofuranosidase/sucrose-6-phosphate hydrolase-encoding gene. Genes encoding the mannose-class...”

SPy1815 putative sucrose-specific PTS permease, enzyme II from Streptococcus pyogenes M1 GAS
42% identity, 74% coverage

• Global Analysis and Comparison of the Transcriptomes and Proteomes of Group A Streptococcus Biofilms
  Freiberg, mSystems 2016
  • “...protein Spy1798 spxA 2.09 1.72 1.7 2.35 1.99 1.97 1.96 1.59 1.57 Transcriptional regulator P Spy1815 rpmF 1.57 1.97 0.64 2.61 3.01 1.67 2.39 2.78 1.45 50S ribosomal protein L32 J Spy1843 1.54 1.64 1.5 2.2 2.3 2.16 1.3 1.4 1.26 Soluble lytic murein transglycosylase M...”
• Regulation of SpeB in Streptococcus pyogenes by pH and NaCl: a model for in vivo gene expression
  Loughman, Journal of bacteriology 2006
  • “...SPy1724 SPy1725 SPy1746 SPy1759 SPy1760 SPy1761 SPy1763 SPy1815 SPy1816 SPy1915 SPy2033 SPy2037 SPy2039 SPy2040 SPy2041 SPy2050 SPy2051 SPy2147 SPy2169 SPy2170...”
  • “...SPy1915 SPy0739 SPy1065 SPy1738 SPy1378 Spy1228 SPy1109 SPy1815 SPy0149 Gene (putative function) VOL. 188, 2006 MODELING IN VIVO STREPTOCOCCAL GENE EXPRESSION...”
• A novel adaptation of aldolase regulates virulence in Streptococcus pyogenes
  Loughman, The EMBO journal 2006
  • “...S. pyogenes Locusa Spy2039 Spy1738 Spy0167 Spy0745 Spy1915 Spy1815 Spy0149 Gene speB manL slo sagH salA scrA ntpK Cysteine protease Mannose PTS II Streptolysin...”
• The Rgg regulator of Streptococcus pyogenes influences utilization of nonglucose carbohydrates, prophage induction, and expression of the NAD-glycohydrolase virulence operon
  Dmitriev, Journal of bacteriology 2006
  • “...during the exponential phase of growth. For example, SPy1815, -1595, and -1593, which are involved in sucrose metabolism, were more abundant in the mutant...”

gbs1734 Unknown from Streptococcus agalactiae NEM316
40% identity, 71% coverage

• Transcriptome adaptation of group B Streptococcus to growth in human amniotic fluid
  Sitkiewicz, PloS one 2009
  • “...facilitator protein gbs1714 3.9 Pyruvate,phosphate dikinase gbs1732 pmi 3.2 Mannose-6-phosphate isomerase gbs1733 scrK 6.9 Fructokinase gbs1734 scrA 22.3 2.6 PTS system, sucrose-specific IIABC component gbs1735 scrB 5.2 Sucrose-6-phosphate hydrolase gbs1777 glpF.2 2.2 3.8 Glycerol uptake facilitator protein gbs1797 2.3 Galactose-1-phosphate uridylyltransferase gbs1811 plr 2.1 2.5 Glyceraldehyde...”

EFA0067 PTS system, IIABC components from Enterococcus faecalis V583
40% identity, 69% coverage

• Survey of genomic diversity among Enterococcus faecalis strains by microarray-based comparative genomic hybridization
  Aakra, Applied and environmental microbiology 2007
  • “...EF3044 (coding for an N-acetylglucosamine-6-phosphate deacetylase), EFA0067 (coding for PTS IIABC components). Our CGH analysis confirms the presence...”

SAG1690 PTS system, IIABC components from Streptococcus agalactiae 2603V/R
40% identity, 71% coverage

• Adaptive response of neonatal sepsis-derived Group B Streptococcus to bilirubin
  Hansen, Scientific reports 2018
  • “...transporter ATP-binding protein 2.02 3.37E-04 4.60E-02 SAG1441 Maltose/maltodextrin ABC transporter maltose/maltodextrin-binding protein 2.19 4.69E-04 5.91E-02 SAG1690 PTS system transporter subunit IIABC 2.01 5.22E-04 5.91E-02 SAG2072 Uridine phosphorylase 1.70 5.26E-04 5.91E-02 SAG0331 Formate acetyltransferase 1.65 8.21E-04 8.43E-02 SAG2014 Hypothetical protein 1.17 8.39E-04 8.43E-02 Genes encoding transport proteins...”

HSISS4_01641 sucrose-specific PTS transporter subunit IIBC from Streptococcus salivarius
40% identity, 72% coverage

• A Genome-Wide CRISPR Interference Screen Reveals an StkP-Mediated Connection between Cell Wall Integrity and Competence in Streptococcus salivarius
  Knoops, mSystems 2022
  • “...-comR ) together with a chloramphenicol resistance cassette at the neutral locus suc (upstream of HSISS4_01641 ). We next fused the promoter of comX to the native lacZ gene (P comX -lacZ ) together with a spectinomycin resistance cassette and introduced the gRNA library into this...”
• The CovRS Environmental Sensor Directly Controls the ComRS Signaling System To Orchestrate Competence Bimodality in Salivarius Streptococci
  Knoops, mBio 2022
  • “...covR inhibition, a P xyl2 -comR-cat construct was introduced at the suc locus (upstream of HSISS4_01641 ), and both resistance cassettes at the tnpII and suc loci were excised. Finally, a constitutive promoter (P 3 ) and a dcas9 handle followed by an S. pyogenes terminator...”

ID870_01290 sucrose-specific PTS transporter subunit IIBC from Streptococcus agalactiae CJB111
40% identity, 71% coverage

• Genomic Analyses Identify Manganese Homeostasis as a Driver of Group B Streptococcal Vaginal Colonization
  Burcham, mBio 2022
  • “...transporter subunit IIB 9.43 19.55 21.30 ID870_00995 PTS sugar transporter subunit IIA 7.71 6.94 6.60 ID870_01290 PTS glucose transporter subunit IIA 3.29 3.53 3.21 ID870_01665 Transporter substrate-binding domain-containing protein 6.37 6.37 5.75 4.38 ID870_07535 PTS mannose/fructose/sorbose transporter family subunit IID 3.95 6.86 8.25 10.86 30.53 ATP-binding...”

T303_09505 sucrose-specific PTS transporter subunit IIBC from Streptococcus thermophilus ASCC 1275
40% identity, 72% coverage

• Transcriptomic Insights Into the Growth Phase- and Sugar-Associated Changes in the Exopolysaccharide Production of a High EPS-Producing Streptococcus thermophilus ASCC 1275
  Padmanabhan, Frontiers in microbiology 2018
  • “...(T303_02800), IIAB (T303_02805), PTS fructose transporter subunit IIA (T303_07665) and PTS sucrose transporter subunit IIABC (T303_09505) were highly expressed along with phosphoenolpyruvate-protein phosphotransferase (T303_07265); but at 10 h all other genes except phospho-enolpyruvate-protein phosphotransferase were downregulated. In M17-S at 5 h, we observed a downregulation of...”

SAK_1702 PTS system, sucrose-specific IIABC component from Streptococcus agalactiae A909
40% identity, 71% coverage

• The Role of Regulator Catabolite Control Protein A (CcpA) in Streptococcus agalactiae Physiology and Stress Response
  Roux, Microbiology spectrum 2022
  • “...subunits; SAK_0915 , PTS system, -glucoside-specific IIABC component; SAK_1377 , PTS system, fructose-specific IIABC component; SAK_1702 , PTS system, sucrose-specific IIABC component; SAK_1893-1895 , PTS system, glucose-specific IIABC component; SAK_1908-1911 , mannose/fructose/sorbose PTS, IID, IIC, IIB, and IIA subunits, SAK_0532-0534 , sugar ABC transporter; SAK_1475-1477 ,...”
• A Vaginal Tract Signal Detected by the Group B Streptococcus SaeRS System Elicits Transcriptomic Changes and Enhances Murine Colonization
  Cook, Infection and immunity 2018
  • “...sak_0525 sak_0526 sak_0528 sak_0529 sak_0530 sak_1377 sak_1702 sak_1759 sak_1825 sak_1833 sak_1834 sak_1835 sak_1893 sak_1894 sak_1895 sak_1908 sak_1909...”
  • “...sak_0258 sak_1155 sak_0398 sak_0399 sak_0400 sak_1920 sak_1702 sak_0354 sak_0257 Fatty acid biosynthesis and metabolism sak_0416 sak_0417 sak_0418 sak_0419...”

SSA_0456 Phosphotransferase system IIC components, glucose/maltose/N-acetylglucosamine-specific, putative from Streptococcus sanguinis SK36
42% identity, 71% coverage

• Glucose Phosphotransferase System Modulates Pyruvate Metabolism, Bacterial Fitness, and Microbial Ecology in Oral Streptococci
  Zeng, Journal of bacteriology 2023 (secret)
• Distinct Regulatory Role of Carbon Catabolite Protein A (CcpA) in Oral Streptococcal spxB Expression
  Redanz, Journal of bacteriology 2018
  • “...system IIC components, glucose/maltose/N-acetylglucosamine specific (SSA_0456, SGO_1857); pykF, pyruvate kinase gene (SSA_0848; SGO_1339); manL, gene for...”
• Physiological and molecular characterization of genetic competence in Streptococcus sanguinis
  Rodriguez, Molecular oral microbiology 2011
  • “...sufD SP_2000 SSA_1972 SGO_1731 SP_2001 SSA_1973 SGO_1732 SP_2002 SSA_1974 SGO_1733 SP_0338 SSA_2096 clpL SGO_1856 SP_1722 SSA_0456 scrA SGO_1857 --- SSA_0860 SGO_2013 --- --- SGO_2086 --- --- SGO_2088 SP_0054 purK SSA_0040 purK SGO_2089 purK SP_0051 purD SSA_0037 purD SGO_2092 purD --- --- SGO_2093 --- SSA_0036 * SGO_2094...”

stu1734 sucrose PTS component II from Streptococcus thermophilus LMG 18311
40% identity, 70% coverage

• Specialized adaptation of a lactic acid bacterium to the milk environment: the comparative genomics of Streptococcus thermophilus LMD-9
  Goh, Microbial cell factories 2011
  • “...mannose/fructose PTS IIAB stu0333 str0333 STER1323 Cellobiose PTS IIC stu1368 str1368 STER1710 Sucrose PTS EIIBCA stu1734 str1734 STER0237 glucose/ N -acetylglucosamine PTS EIICBA, trunc. stu0189 str0189 STER0446 Fructose PTS IIA, trunc. stu0401 str0401 STER0544 Beta-glucoside PTS EIIABC, trunc. stu0512 str0512 STER1862 Trehalose PTS EIIABC, trunc. stu1890...”

str1734 sucrose-specific PTS permease, enzyme II from Streptococcus thermophilus CNRZ1066
40% identity, 71% coverage

• Specialized adaptation of a lactic acid bacterium to the milk environment: the comparative genomics of Streptococcus thermophilus LMD-9
  Goh, Microbial cell factories 2011
  • “...PTS IIAB stu0333 str0333 STER1323 Cellobiose PTS IIC stu1368 str1368 STER1710 Sucrose PTS EIIBCA stu1734 str1734 STER0237 glucose/ N -acetylglucosamine PTS EIICBA, trunc. stu0189 str0189 STER0446 Fructose PTS IIA, trunc. stu0401 str0401 STER0544 Beta-glucoside PTS EIIABC, trunc. stu0512 str0512 STER1862 Trehalose PTS EIIABC, trunc. stu1890 str1890...”

LCA_RS08985 sucrose-specific PTS transporter subunit IIBC from Latilactobacillus sakei subsp. sakei 23K
LSA1792 Sucrose-specific phosphotransferase system, enzyme IIBCA from Lactobacillus sakei subsp. sakei 23K
41% identity, 66% coverage

• Transcriptome Analysis Reveals the Role of Sucrose in the Production of Latilactobacillus sakei L3 Exopolysaccharide
  Wang, International journal of molecular sciences 2024
  • “...sucrose-added medium [ 14 ]. According to Figure 5 and Table 3 , the PTS-S (LCA_RS08985) and PTS fructose transporter subunit IIC (PTS-F, LCA_RS05240), assigned to the phosphotransferase system (PTS) relating to the transport and metabolism of sugars from the extracellular to the intracellular sides of...”
  • “...50 ]. The structures of sucrose and PTS sucrose transporter subunit IIABC (PTS-S) encoded by LCA_RS08985 were firstly obtained, and PDBQT files were finally acquired after the optimization of force-field energy by AutodockTools 1.5.6 software [ 51 , 52 ]. 3.3.5. ncRNA Target Genes and Interaction...”
• Global transcriptome response in Lactobacillus sakei during growth on ribose
  McLeod, BMC microbiology 2011
  • “...CG GTTA A A -148 LSA1711 lacL TGAAAC CG TTTT A A -36 lacL-lacM LSA1711-1710 LSA1792 scrA TGTAAA CG GTT GT A -78 scrA-dexB-scrK LSA1792-1790 LSA1830 pox2 T TG TAA CG CTTACA -70 The identification is based on the genome sequence of L. sakei strain 23K,...”

CHF17_RS08755 sucrose-specific PTS transporter subunit IIBC from Streptococcus agalactiae
40% identity, 71% coverage

• Dual RNA sequencing of group B Streptococcus-infected human monocytes reveals new insights into host-pathogen interactions and bacterial evasion of phagocytosis
  Sullivan, Scientific reports 2023
  • “...iGBS in monocytes. Gene locus tag Label Gene product FC P-adj CHF17_RS00245 tRNA-Ile 232.25 2.17E11 CHF17_RS08755 PTS beta-glucoside transporter subunit IIBCA 198.45 0.00E+00 CHF17_RS03815 tetracycline resistance determinant leader peptide 197.68 7.30E26 CHF17_RS00445 adhP Alcohol dehydrogenase AdhP 173.27 0.00E+00 CHF17_RS01525 lrgB Antiholin-like protein LrgB 157.58 1.03E281 CHF17_RS08465...”

SGO_1857 PTS system, IIABC components from Streptococcus gordonii str. Challis substr. CH1
SGO_RS09095 sucrose-specific PTS transporter subunit IIBC from Streptococcus gordonii str. Challis substr. CH1
41% identity, 71% coverage

• Interactions Between Streptococcus gordonii and Fusobacterium nucleatum Altered Bacterial Transcriptional Profiling and Attenuated the Immune Responses of Macrophages
  Liu, Frontiers in cellular and infection microbiology 2021
  • “...The genes in the central cluster include SGO_0281 (SGO_RS01385, PTS glucose transporter subunit IIA, up-regulated), SGO_1857 (SGO_RS09095, PTS beta-glucoside transporter subunit IIBCA, down-regulated), and SGO_1858 (SGO_RS09100, sucrose-6-phosphate hydrolase, down-regulated). These genes encode proteins that participate in the carbohydrate transport process, and they potentially interacted with genes...”
• Transcriptional profiling of coaggregation interactions between Streptococcus gordonii and Veillonella parvula by Dual RNA-Seq
  Mutha, Scientific reports 2019
  • “...genes SGO_RS00210/RS00215/RS00220 (old names SGO_00440046), scrK , ldh , lacC (SGO_RS07435, old name SGO_1517), SGO_RS09095 (SGO_1857) and a downstream gene SGO_RS09100 (SGO_1858), encoding a putative sucrose-6-phosphate hydrolase, which was down-regulated approximately 2.5-fold in coaggregates. In addition, SGO_RS02020 (SGO_0405), encoding a putative -n-acetylhexosaminidase, SGO_RS03680 (SGO_0749), encoding glutathione-disulfide...”
• Distinct Regulatory Role of Carbon Catabolite Protein A (CcpA) in Oral Streptococcal spxB Expression
  Redanz, Journal of bacteriology 2018
  • “...IIC components, glucose/maltose/N-acetylglucosamine specific (SSA_0456, SGO_1857); pykF, pyruvate kinase gene (SSA_0848; SGO_1339); manL, gene for...”
• Physiological and molecular characterization of genetic competence in Streptococcus sanguinis
  Rodriguez, Molecular oral microbiology 2011
  • “...SSA_1972 SGO_1731 SP_2001 SSA_1973 SGO_1732 SP_2002 SSA_1974 SGO_1733 SP_0338 SSA_2096 clpL SGO_1856 SP_1722 SSA_0456 scrA SGO_1857 --- SSA_0860 SGO_2013 --- --- SGO_2086 --- --- SGO_2088 SP_0054 purK SSA_0040 purK SGO_2089 purK SP_0051 purD SSA_0037 purD SGO_2092 purD --- --- SGO_2093 --- SSA_0036 * SGO_2094 --- ---...”
• Interactions Between Streptococcus gordonii and Fusobacterium nucleatum Altered Bacterial Transcriptional Profiling and Attenuated the Immune Responses of Macrophages
  Liu, Frontiers in cellular and infection microbiology 2021
  • “...genes in the central cluster include SGO_0281 (SGO_RS01385, PTS glucose transporter subunit IIA, up-regulated), SGO_1857 (SGO_RS09095, PTS beta-glucoside transporter subunit IIBCA, down-regulated), and SGO_1858 (SGO_RS09100, sucrose-6-phosphate hydrolase, down-regulated). These genes encode proteins that participate in the carbohydrate transport process, and they potentially interacted with genes in...”
• Transcriptional profiling of coaggregation interactions between Streptococcus gordonii and Veillonella parvula by Dual RNA-Seq
  Mutha, Scientific reports 2019
  • “...components EIIB, EIIC and EIID of a mannose, sorbose or fructose transporter, while the other (SGO_RS09095) encodes the EIIBCA components of a sucrose transporter. SGO_RS09095 was also classified under the phosphate-containing compound metabolic process, along with six other genes. Four of these genes were down-regulated between...”
  • “...included genes SGO_RS00210/RS00215/RS00220 (old names SGO_00440046), scrK , ldh , lacC (SGO_RS07435, old name SGO_1517), SGO_RS09095 (SGO_1857) and a downstream gene SGO_RS09100 (SGO_1858), encoding a putative sucrose-6-phosphate hydrolase, which was down-regulated approximately 2.5-fold in coaggregates. In addition, SGO_RS02020 (SGO_0405), encoding a putative -n-acetylhexosaminidase, SGO_RS03680 (SGO_0749), encoding...”

B1745_01765 sucrose-specific PTS transporter subunit IIBC from Lactobacillus amylolyticus
40% identity, 69% coverage

• Adaptive mechanism of Lactobacillus amylolyticus L6 in soymilk environment based on metabolism of nutrients and related gene-expression profiles
  Fei, Food science & nutrition 2022
  • “...metabolism were significantly upregulated in logarithmic phase, such as genes coding for PTS glucoside transporter (B1745_01765), 6phosphoalphaglucosidase (B1745_05130), gluconate kinase (B1745_01565), and glucose6phosphate dehydrogenase (B1745_01805) (Table 2 ). However, several genes involved in sucrose transportation, especially sugar ABC transporters (B1745_06760, B1745_06745 and B1745_06745), and galactose metabolism...”
  • “...ldh Llactate dehydrogenase 3.18 B1745_05695 adhE acetaldehyde dehydrogenase /alcohol dehydrogenase 2.67 B1745_RS08070 galA alphagalactosidase 2.32 B1745_01765 scrA PTS betaglucoside transporter subunit EIIBCA 1.98 B1745_04615 spp HAD family hydrolase 1.93 B1745_03820 gyaR hypothetical protein 1.80 B1745_03825 spp sugarphosphatase 1.69 B1745_01805 zwf glucose6phosphate dehydrogenase 1.62 B1745_06170 gpmB histidine...”

DA471_RS06690, QV15_02000 PTS system trehalose-specific EIIBC component from Staphylococcus aureus
42% identity, 82% coverage

• Silversol® (a Colloidal Nanosilver Formulation) Inhibits Growth of Antibiotic-Resistant Staphylococcus aureus by Disrupting Its Physiology in Multiple Ways
  Thakkar, Pharmaceutics 2024
  • “...Phosphoglycerate dehydrogenase 2.31 0.03 0 32 DA471_RS00920 xerC Tyrosine recombinase XerC 2.3 0.03 0 33 DA471_RS06690 treP PTS system trehalose-specific EIIBC component 2.3 0.03 0 34 DA471_RS08610 - DUF1398 family protein 2.28 0.03 NA 35 DA471_RS03440 opuD2 BCCT family transporter 2.27 0.03 NA 36 DA471_RS10560 -...”
• A spectrum of CodY activities drives metabolic reorganization and virulence gene expression in Staphylococcus aureus
  Waters, Molecular microbiology 2016
  • “...- are also turned on early. In contrast, a transporter for trehalose ( treP , QV15_02000) and ldh (QV15_13410; coding for lactate dehydrogenase) are turned on late, suggesting that trehalose and lactate are utilized after other nutrients are exhausted. QV15_04760, coding for an Fe 3+ transport...”

SP_1722 sucrose-specific PTS transporter subunit IIBC from Streptococcus pneumoniae TIGR4
40% identity, 73% coverage

• The Effect of Impaired Polyamine Transport on Pneumococcal Transcriptome
  Nakamya, Pathogens (Basel, Switzerland) 2021
  • “...ABC transporter permease SP_2108 malX 2.4 <0.0001 Maltose/maltodextrin-binding protein SP_1894 gtfA 2.3 <0.0001 Sucrose phosphorylase SP_1722 SP_1722 51.0 <0.0001 PTS sucrose system EIIBCA or EIIBC SP_0648 bgaA 7.0 <0.0001 Beta galactosidase SP_1898 aga 2.2 <0.0001 Alpha galactosidase SP_1721 scrK 10.0 <0.0001 Fructokinase SP_1725 scrR 9.2 <0.0001...”
• The Two-Component System 09 of Streptococcus pneumoniae Is Important for Metabolic Fitness and Resistance during Dissemination in the Host
  Hirschmann, Microorganisms 2021
  • “...disaccharide of glucose and fructose that is taken up by the sucrose-specific PTS IIBCA components (SP_1722), phosphorylated to sucrose-6-phosphate, and enters glycolysis as glucose-6-phosphate [ 39 ]. Growth analyses with lactose and sucrose revealed that S. pneumoniae can utilize sucrose and lactose equally, whereas the tcs09...”
• The biofilm inhibitor Carolacton inhibits planktonic growth of virulent pneumococci via a conserved target
  Donner, Scientific reports 2016
  • “...2.48E-40 sp_2016 nicotinate-nucleotide pyrophosphorylase 2.60 1.07E-46 sp_0539 bacteriocin blpM 2.59 1.38E-04 Starch and sucrose metabolism sp_1722 PTS system IIABC components 0.87 6.04E-04 sp_1314 IS66 family element, Orf1 3.11 7.89E-03 sp_1803 hypothetical protein 1.35 3.02E-09 Central carbon/lipid metabolism sp_0252 fructose-6-phosphate aldolase 2.34 4.59E-06 sp_0253 glycerol dehydrogenase 2.57...”
• Physiological and molecular characterization of genetic competence in Streptococcus sanguinis
  Rodriguez, Molecular oral microbiology 2011
  • “...SGO_1721 sufD SP_2000 SSA_1972 SGO_1731 SP_2001 SSA_1973 SGO_1732 SP_2002 SSA_1974 SGO_1733 SP_0338 SSA_2096 clpL SGO_1856 SP_1722 SSA_0456 scrA SGO_1857 --- SSA_0860 SGO_2013 --- --- SGO_2086 --- --- SGO_2088 SP_0054 purK SSA_0040 purK SGO_2089 purK SP_0051 purD SSA_0037 purD SGO_2092 purD --- --- SGO_2093 --- SSA_0036 *...”

spr1566 Phosphotransferase system enzyme II from Streptococcus pneumoniae R6
40% identity, 73% coverage

• A functional genomics approach to establish the complement of carbohydrate transporters in Streptococcus pneumoniae
  Bidossi, PloS one 2012
  • “...spr1528 PTS-Glc indel GlcN SP1688-9-90 SPG01596-7-8 spr1532-3-4 CUT1 conserved NeuNAc ManNAc NeuNAc [72] SP1722 SPG01627 spr1566 PTS-Glc scrH alleles sucrose sucrose [27] SP1796-7-8 SPG01682-3-4 spr1618-9-20 CUT1 susXT1T2 alleles sucrose sucrose [27] - SPG01697-8-701 d - PTS-Lac indel sulphated glycans [108] SP1884 SPG01796 spr1699 PTS-Glc indel trehalose...”

STER_1710, STER_RS08355 sucrose-specific PTS transporter subunit IIBC from Streptococcus thermophilus LMD-9
40% identity, 72% coverage

• Identification of Hanks-Type Kinase PknB-Specific Targets in the Streptococcus thermophilus Phosphoproteome
  Henry, Frontiers in microbiology 2019
  • “...Pyruvate formate lyase YP_820965.1 WP_011226473.1 STER_1622 STER_RS07960 ScrA Sucrose PTS transporter subunit EIIBCA YP_821049.1 WP_011681617.1 STER_1710 STER_RS08355 GalU UDP-glucose-pyrophosphorylase YP_821134.1 WP_002953557.1 STER_1810 STER_RS08845 Cell cycle control GpsB Cell division protein YP_819787.1 WP_011680702.1 STER_0280 STER_RS01360 PabC Transporter/YceG motif involved in septum cleavage YP_819793.1 WP_011680707.1 STER_0288 STER_RS01395 FtsW...”
  • “...formate lyase YP_820965.1 WP_011226473.1 STER_1622 STER_RS07960 ScrA Sucrose PTS transporter subunit EIIBCA YP_821049.1 WP_011681617.1 STER_1710 STER_RS08355 GalU UDP-glucose-pyrophosphorylase YP_821134.1 WP_002953557.1 STER_1810 STER_RS08845 Cell cycle control GpsB Cell division protein YP_819787.1 WP_011680702.1 STER_0280 STER_RS01360 PabC Transporter/YceG motif involved in septum cleavage YP_819793.1 WP_011680707.1 STER_0288 STER_RS01395 FtsW FtsW/RodA/SpoVE...”
• Adaptor protein MecA is a negative regulator of the expression of late competence genes in Streptococcus thermophilus
  Boutry, Journal of bacteriology 2012
  • “...STER_1602 STER_1639 STER_1683 STER_1684 STER_1709 STER_1710 ldh ABC-type Fe3-siderophore transport system, permease component L-Lactate dehydrogenase...”

LGAS_1778 Sucrose PTS, EIIBCA from Lactobacillus gasseri ATCC 33323
39% identity, 69% coverage

• The PTS transporters of Lactobacillus gasseri ATCC 33323
  Francl, BMC microbiology 2010
  • “...PTS 15, 20, and 21, respectively (Table 5 ). The amplified PTS 15 (LGAS_1669), 20 (LGAS_1778) and 21 (LGAS_1795) internal regions were 819 bp, 760 bp and 675 bp, respectively. The junction fragments for successful pMJM-4 integration were 999 bp and 1039 bp. The junction fragments...”

TC 4.A.1.2.16 / ART98386 PTS beta-glucoside transporter, EIIBCA of 647 aas and 10 predicted TMSs from Lactobacillus gasseri
39% identity, 69% coverage

• substrates: beta glucosides

SAOUHSC_02661 PTS system sucrose-specific IIBC component, putative from Staphylococcus aureus subsp. aureus NCTC 8325
42% identity, 85% coverage

• Whole-genome sequencing of Staphylococcus aureus strain RN4220, a key laboratory strain used in virulence research, identifies mutations that affect not only virulence factors but also the fitness of the strain
  Nair, Journal of bacteriology 2011
  • “...SAOUHSC_01726 SAOUHSC_01827 SAOUHSC_02254 SAOUHSC_02265 SAOUHSC_02274 SAOUHSC_02661 *, truncation. Mutation identified by O'Neill (18). substitutions in coding...”
• The Staphylococcus aureus KdpDE two-component system couples extracellular K+ sensing and Agr signaling to infection programming
  Xue, Infection and immunity 2011
  • “...SAOUHSC_02311 SAOUHSC_02310 SAOUHSC_01990 SAOUHSC_00636 SAOUHSC_00637 SAOUHSC_02661 PstB product phosphate ABC transporter Similar to phosphate ABC transporter...”

TC 4.A.1.2.12 / Q8NMD6 The sucrose porter, PtsS (regulated by SugR which also regulates other enzymes II) from Corynebacterium glutamicum (Brevibacterium flavum) (see paper)
NCgl2553 sucrose-specific PTS transporter subunit IIBC from Corynebacterium glutamicum ATCC 13032
cg2925 enzyme II sucrose protein from Corynebacterium glutamicum ATCC 13032
38% identity, 67% coverage

• substrates: Sucrose
• Transcriptome analysis of Corynebacterium glutamicum in the process of recombinant protein expression in bioreactors
  Sun, PloS one 2017
  • “...is a critical gene in the PTS system, was up-regulated by 2.98-fold, and NCgl1305 and NCgl2553 encoding the phosphotransferase system IIC component were up-regulated by 4.54 and 3.86-fold, respectively, both consistently showing the up absorption and transfer of glucose. Increased glucose consumption during the anaerobic condition...”
• The two-component signal transduction system CopRS of Corynebacterium glutamicum is required for adaptation to copper-excess stress
  Schelder, PloS one 2011
  • “...cg1290 NCgl1094 metE 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase 0.29 cg1487 NCgl1262 leuC isopropylmalate isomerase, large subunit 0.37 cg2925 NCgl2553 ptsS enzyme II sucrose protein 0.38 cg3226 NCgl2816 putative L-lactate permease 0.02 Proteins of unknown function cg0077 NCgl0057 hypothetical protein 11.67 cg0078 NCgl0058 hypothetical protein 10.02 cg0416 NCgl0339 secreted protein...”
• The DeoR-type transcriptional regulator SugR acts as a repressor for genes encoding the phosphoenolpyruvate:sugar phosphotransferase system (PTS) in Corynebacterium glutamicum
  Gaigalat, BMC molecular biology 2007
  • “...PTS component non clustered cg1537 NCgl1305 ptsG 683 72.6 Glucose-specific PTS component, enzyme IIBCA cg2925 NCgl2553 ptsS 661 69.1 Sucrose-specific PTS component, enzyme IIBCA cg3365 NCgl2933 - 513 52.7 L-ascorbate type PTS component, enzyme IIC cg3366 NCgl2934 - 270 29.0 L-ascorbate type PTS component, enzyme IIAB...”
  • “...NCBI No. Gene name m-value a-value Annotation cg2026 - - 3.53 11.68 Hypothetical protein cg2925 NCgl2553 ptsS 3.39 11.87 Phosphotransferase system (PTS), sucrose-specific enzyme IIBCA component cg2120 NCgl1861 ptsF 3.27 12.04 Phosphotransferase system (PTS), fructose-specific enzyme IIABC component cg3107 NCgl2709 adhA 3.23 13.00 Alcohol dehydrogenase cg2118...”
• Two-component systems of Corynebacterium glutamicum: deletion analysis and involvement of the PhoS-PhoR system in the phosphate starvation response
  Kocan, Journal of bacteriology 2006
  • “...TABLE 1--Continued C. glutamicum locus tag no. NCgl2553 NCgl2717 NCgl2718 NCgl2731 NCgl2787 NCgl2817 NCgl2859 NCgl2860 NCgl2864 NCgl2865 NCgl2877 NCgl2897...”
• Substrate-dependent cluster density dynamics of Corynebacterium glutamicum phosphotransferase system permeases
  Martins, Molecular microbiology 2019
  • “...in Fig. 1 . ptsG (cg1537) encodes the glucosespecific membrane integral EIIBCA transporter, while ptsS (cg2925) encodes the sucrosespecific EIIBCA, and ptsF (cg2120) the fructosespecific EIIABC (Fig. 1 ). A fourth putative PTS belongs to the Lascorbatetype family and is encoded by rmpC (cg3365) (not depicted...”
• Physiology and Transcriptional Analysis of (p)ppGpp-Related Regulatory Effects in Corynebacterium glutamicum
  Ruwe, Frontiers in microbiology 2019
  • “...putative iron(III) dicitrate transporter, substrate-binding lipoprotein 1.00 3.76317E06 cg2324 relS (p)ppGpp synthetase, RelA/SpoT-family 1.51 8.38571E77 cg2925 ptsS phosphotransferase system (PTS), sucrose-specific enzyme IIBCA component 1.15 7.96046E51 cg3226 putative MFS-type L-lactate permease 1.22 9.86559E18 log 2 ratios ( M -values) and probability values ( p adj )...”
• The two-component signal transduction system CopRS of Corynebacterium glutamicum is required for adaptation to copper-excess stress
  Schelder, PloS one 2011
  • “...3.24 cg1290 NCgl1094 metE 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase 0.29 cg1487 NCgl1262 leuC isopropylmalate isomerase, large subunit 0.37 cg2925 NCgl2553 ptsS enzyme II sucrose protein 0.38 cg3226 NCgl2816 putative L-lactate permease 0.02 Proteins of unknown function cg0077 NCgl0057 hypothetical protein 11.67 cg0078 NCgl0058 hypothetical protein 10.02 cg0416 NCgl0339 secreted...”
• The Zur regulon of Corynebacterium glutamicum ATCC 13032
  Schröder, BMC genomics 2010
  • “...4.91 cg2261 amtB secondary ammonium transporter - 1.01 n.s. cg2560 aceA isocitrate lyase 1.56 n.s. cg2925 ptsS phosphotransferase system component - 1.35 n.s. cg3096 ald acetaldehyde dehydrogenase 1.69 103 cg3138 - putative membrane protease subunit 3.14 n.s. cg3139 - hypothetical protein 2.03 n.s. cg3140 tagA1 DNA-3-methyladenine...”
• Elastase digests: new ammunition for shotgun membrane proteomics
  Rietschel, Molecular & cellular proteomics : MCP 2009
  • “...12 13 14 15 41 39 30 29 28 22 2 17 9 26 Cg0447 Cg2925 Cg2404 Cg1366 Cg3138 16 27 21 Cg2780 17 18 27 26 19 13 Cg2403 Cg2708 19 20 21 22 23 24 25 26 25 23 22 22...”
• The global repressor SugR controls expression of genes of glycolysis and of the L-lactate dehydrogenase LdhA in Corynebacterium glutamicum
  Engels, Journal of bacteriology 2008
  • “...mutant Gene name, gene product, and/or deduced function cg2925 cg2119 cg2120 cg2118 cg2117 cg2121 cg3219 ptsS, sucrose-specific enzyme II of the PTS pfkB,...”
• Co-ordinated regulation of gluconate catabolism and glucose uptake in Corynebacterium glutamicum by two functionally equivalent transcriptional regulators, GntR1 and GntR2
  Frunzke, Molecular microbiology 2008
  • “...1.05 1.24 1.34 0.92 cg2399 Glucose kinase, glk 0.22 0.93 0.82 0.66 1.09 0.91 0.81 cg2925 PTS system, sucrose-specific IIABC component, ptsS 0.26 1.05 1.37 1.17 1.47 1.14 1.28 cg2178 N utilization substance protein A 0.26 1.03 0.68 1.09 1.26 0.93 0.85 cg3398 Superfamily II DNA...”
• The DeoR-type transcriptional regulator SugR acts as a repressor for genes encoding the phosphoenolpyruvate:sugar phosphotransferase system (PTS) in Corynebacterium glutamicum
  Gaigalat, BMC molecular biology 2007
  • “...HPr, PTS component non clustered cg1537 NCgl1305 ptsG 683 72.6 Glucose-specific PTS component, enzyme IIBCA cg2925 NCgl2553 ptsS 661 69.1 Sucrose-specific PTS component, enzyme IIBCA cg3365 NCgl2933 - 513 52.7 L-ascorbate type PTS component, enzyme IIC cg3366 NCgl2934 - 270 29.0 L-ascorbate type PTS component, enzyme...”
  • “...CDS NCBI No. Gene name m-value a-value Annotation cg2026 - - 3.53 11.68 Hypothetical protein cg2925 NCgl2553 ptsS 3.39 11.87 Phosphotransferase system (PTS), sucrose-specific enzyme IIBCA component cg2120 NCgl1861 ptsF 3.27 12.04 Phosphotransferase system (PTS), fructose-specific enzyme IIABC component cg3107 NCgl2709 adhA 3.23 13.00 Alcohol dehydrogenase...”
• More

UH47_02750 PTS system trehalose-specific EIIBC component from Staphylococcus pseudintermedius
40% identity, 81% coverage

• Carprofen-induced depletion of proton motive force reverses TetK-mediated doxycycline resistance in methicillin-resistant Staphylococcus pseudintermedius
  Magnowska, Scientific reports 2019
  • “...melB 1.1 1.9 alternative carbon source UH47_02745 trehalose-6-phosphate hydrolase treC 1.7 2.4 alternative carbon source UH47_02750 trehalose permease IIC protein 2.6 3.1 alternative carbon source UH47_07415 gluconokinase gntK 1.6 1.4 alternative carbon source UH47_12030 glycerol-3-phosphate dehydrogenase glpA 2.2 2.5 2 alternative carbon source UH47_12040 glycerol transporter...”
  • “...of numerous alternative carbohydrate carbon source uptake and activation proteins were triggered, i.e. trehalose (permease, UH47_02750; 6-phosphate hydrolase, treC ), glucoside (specific transporter, UH47_02965), glucarate (transporter, gudP ), glycerol (transporter, glpF ; kinase, glpK ; dehydrogenase, glpA ), melibiose (transporter, melB ) and gluconate (gluconokinase, gntK...”

CV_3300 protein-N p-phosphohistidine-sugar phosphotransferase from Chromobacterium violaceum ATCC 12472
38% identity, 92% coverage

• Guava leaf extract inhibits quorum-sensing and Chromobacterium violaceum induced lysis of human hepatoma cells: whole transcriptome analysis reveals differential gene expression
  Ghosh, PloS one 2014
  • “...3.49 7.18E-006 CV_2716 hypothetical 52.45 5.47 3.26 4.07E-005 CV_3062 enoyl-CoA hydratase 32.72 1.31 4.64 0 CV_3300 treB protein phosphohistidine-sugar phosphotransferase 8.82 0.55 4 0.01 CV_4091 cviI autoinducer synthase 171.85 19.44 3.14 5.39E-005 CV_4092 aldehyde dehydrogenase 20.7 1.39 3.9 0 CV_4142 hoxX HoxX-like protein 7.99 0.53 3.9...”

VP0710 PTS system, trehalose-specific IIBC component from Vibrio parahaemolyticus RIMD 2210633
VP_RS03405 PTS trehalose transporter subunit IIBC from Vibrio parahaemolyticus RIMD 2210633
35% identity, 94% coverage

• The Gene Cluster <i>Cj0423</i>-<i>Cj0425</i> Negatively Regulates Biofilm Formation in <i>Campylobacter jejuni</i>
  Wang, International journal of molecular sciences 2024
  • “...the uncharacterized functional gene vp0610 in Vibrio parahaemolyticus , identifying 180 interacting proteins, including Hfq, VP0710, VP0793, and CyaA, all of which are known to play a role in biofilm formation. This demonstrates the efficacy of the method, as evidenced by the identification of 93 proteins...”
• Characterization of the RpoN regulon reveals the regulation of motility, T6SS2 and metabolism in Vibrio parahaemolyticus
  Gu, Frontiers in microbiology 2022
  • “...2.50E-22 VP1515 formate dehydrogenase cytochrome b556 subunit 4.05 9.61E-74 PTS VP0366 phosphoenolpyruvate-protein phosphotransferase 1.42 2.32E-21 VP0710 PTS system trehalose(maltose)-specific transporter subunits IIBC 1.68 0.002609259 VP0711 trehalose-6-phosphate hydrolase 1.26 0.025630694 VP0810 PTS system mannose-specific factor IIC 1.38 0.001487326 VP2636 PTS system cellobiose-specific transporter subunit Iic transporter subunit...”
• A Novel Gene vp0610 Negatively Regulates Biofilm Formation in Vibrio parahaemolyticus
  Jiang, Frontiers in microbiology 2021
  • “...production. Pull-down assays revealed that VP0610 can interact with 180 proteins, some of which (Hfq, VP0710, VP0793, and CyaA) participate in biofilm formation. Moreover, deleting vp0610 enhanced the expression of genes responsible for biofilm component ( flaE ), the sugar phosphotransferase system (PTS) EIIA component (...”
  • “...Table 3 ). Specifically, RNA binding protein (Hfq), adenylate cyclase (CyaA), and PTS-related protein components (VP0710 and VP0793) were identified as key proteins involved in biofilm formation via the quorum sensing and cAMP/CRP pathways ( Supplementary Figure 1 ). Therefore, we will focus on cAMP/CRP pathways...”
• Identification of Antibacterial Components in the Methanol-Phase Extract from Edible Herbaceous Plant Rumex madaio Makino and Their Antibacterial Action Modes
  Liu, Molecules (Basel, Switzerland) 2022
  • “...subunit IIA VP_RS19165 0.393 Glucose-1-phosphate adenylyltransferase VP_RS03410 0.474 Alpha%2Calpha-phosphotrehalase VP_RS23025 0.498 Glycogen debranching protein GlgX VP_RS03405 0.499 PTS trehalose transporter subunit IIBC VP_RS22910 4.693 4-alpha-glucanotransferase Necroptosis VP_RS04005 0.261 Molecular chaperone HtpG VP_RS00595 0.363 Glutamate-ammonia ligase Taurine and hypotaurine metabolism VP_RS10125 0.167 Acetate kinase VP_RS05370 0.219 Alanine...”

SMU_2038, SMU_RS09325 PTS system trehalose-specific EIIBC component from Streptococcus mutans UA159
36% identity, 68% coverage

• Identification of the antibacterial action mechanism of diterpenoids through transcriptome profiling
  Moon, Frontiers in microbiology 2022
  • “...IICBA mtlA1 3.34 1.65 1.41 SMU_RS01555 PTS glucitol/sorbitol transporter subunit IIA 0.88 1.68 1.79 1.85 SMU_RS09325 PTS system trehalose-specific EIIBC component pttB 2.94 2.56 2.43 SMU_RS04080 Extracellular solute-binding protein msmE 1.23 0.86 2.31 2.26 SMU_RS04095 Sucrose phosphorylase gtfA 0.98 1.69 1.71 SMU_RS04105 Alpha-glucosidase dexB 1.28 1.23...”
• Transcriptional Profiling Reveals the Importance of RcrR in the Regulation of Multiple Sugar Transportation and Biofilm Formation in Streptococcus mutans
  Gong, mSystems 2021
  • “...SMU_1183 , SMU_1184c , and SMU_1185 ) and the trehalose-specific PTS system ( SMU_2037 and SMU_2038 ) ( Fig.8A ). The promoter regions ( P SMU_1185 and P SMU_2038 ) were used to search for a generally conserved motif for RcrR binding using MEME Suite 5.1.1...”
  • “...PTS operons. The expression levels of SMU_1183 , SMU_1184c , SMU_1185 , SMU_2037 , and SMU_2038 in the rcrR -overexpressing strain were found to be upregulated 2- to 7-fold compared with the wild-type strain by quantitative reverse transcription-PCR (qRT-PCR) ( Fig.9B ). The predicted binding sequences...”
• Protein Interactomes of Streptococcus mutans YidC1 and YidC2 Membrane Protein Insertases Suggest SRP Pathway-Independent- and -Dependent Functions, Respectively
  Lara, mSphere 2021
  • “...component (SMU_2047) Conserved hypothetical protein, cyclic nucleotide-binding protein (SMU_1307c) Putative PTS system, trehalose-specific IIABC component (SMU_2038) Putative cell shape-determining protein MreC (SMU_20) Putative glycosyltransferase, RgpI (SMU_833) Conserved hypothetical protein (SMU_1477c) Putative undecaprenyl-phosphate-UDP- MurNAc-pentapeptide transferase (SMU_456) Putative cell division protein RodA (SMU_1279c) Integral membrane protein possibly involved...”
• Characterization of the Trehalose Utilization Operon in Streptococcus mutans Reveals that the TreR Transcriptional Regulator Is Involved in Stress Response Pathways and Toxin Production
  Baker, Journal of bacteriology 2018
  • “...SMU_2037 Putative trehalose-6-phosphate hydrolase TreA SMU_2038 Putative PTS, trehalose-specific IIABC component SMU_2040 Putative transcriptional regulator;...”
• RNA-Seq Reveals Enhanced Sugar Metabolism in Streptococcus mutans Co-cultured with Candida albicans within Mixed-Species Biofilms
  He, Frontiers in microbiology 2017
  • “...are channeled into the glycolytic pathway ( Chassy and Victoria Porter, 1979 ). Furthermore, pttB (SMU_2038), encoding a trehalose PTS permease, was also up-regulated in dual-species biofilms (Supplementary Table S1 ). Notably, the trehalose-PTS (i.e., EII Tre ), the primary transporter for trehalose ( Poy and...”

SSA_1752 Phosphotransferase system, trehalose-specific IIBC component, putative from Streptococcus sanguinis SK36
37% identity, 63% coverage

• Manganese Depletion Leads to Multisystem Changes in the Transcriptome of the Opportunistic Pathogen Streptococcus sanguinis
  Puccio, Frontiers in microbiology 2020
  • “...et al., 2020 ) as well as by the high expression of putative glucose transporters SSA_1752, SSA_1918-1920, and SSA_1298-1300 ( Ajdic and Pham, 2007 ) at T 20 ( Supplementary Table S2 ). Surprisingly, expression of nearly all sugar transport systems decreased after Mn depletion (...”

VpaChn25_0668 PTS trehalose transporter subunit IIBC from Vibrio parahaemolyticus
35% identity, 94% coverage

• Genomic and transcriptomic analyses reveal distinct biological functions for cold shock proteins (VpaCspA and VpaCspD) in Vibrio parahaemolyticus CHN25 during low-temperature survival
  Zhu, BMC genomics 2017
  • “...3.4141 PTS system fructose-specific transporter subunit IIB VpaChn25A_1312 4.9223 PTS system fructose-specific transporter subunit IIABC VpaChn25_0668 0.4181 PTS system trehalose (maltose)-specific transporter subunits IIBC VpaChn25_2564 2.1655 PTS system cellobiose-specific transporter subunit IIA VpaChn25_2566 2.8755 PTS system cellobiose-specific transporter subunit IIB Alanine, aspartate and glutamate metabolism VpaChn25A_0370...”
  • “...0.3818 PTS system mannitol-specific transporter subunit IIABC VpaChn25_2566 0.3343 PTS system cellobiose-specific transporter subunit IIB VpaChn25_0668 3.948 PTS system trehalose (maltose)-specific transporter subunits IIBC Butanoate metabolism VpaChn25A_0528 2.6111 Acetoacetyl-CoA synthetase VpaChn25A_0560 2.8181 Acyl-CoA thiolase Fructose and mannose metabolism VpaChn25A_1313 5.1663 Mannose-6-phosphate isomerase VpaChn25_0355 0.3626 Mannitol-1-phosphate 5-dehydrogenase...”

M28_Spy1768 PTS system, trehalose-specific IIBC component from Streptococcus pyogenes MGAS6180
35% identity, 65% coverage

• Adaptation of group A Streptococcus to human amniotic fluid
  Sitkiewicz, PloS one 2010
  • “...phosphotransferase system repressor M28_Spy1668 SPy1972 pulA 5.30 Pullulanase M28_Spy1767 SPy2096 dexS 6.18 39.01 Trehalose-6-phosphate hydrolase M28_Spy1768 SPy2097 - 8.81 43.06 PTS system, trehalose-specific IIBC component Values represent fold change in expression in AF at ML, LL, and S growth phases compared to expression in THY medium....”

SAK_0257 PTS system, trehalose-specific IIBCA component from Streptococcus agalactiae A909
35% identity, 67% coverage

• The Role of Regulator Catabolite Control Protein A (CcpA) in Streptococcus agalactiae Physiology and Stress Response
  Roux, Microbiology spectrum 2022
  • “...belonging to a ribose operon, SAK_0528 and SAK_0529 belonging to a galactitol PTS operon, and SAK_0257 coding a trehalose PTS. In order to demonstrate a glucose effect in S. agalactiae , the A909WT strain was cultured in chemically defined medium supplemented with different carbon sources (glucose,...”
  • “...putative cre site of three genes regulated by CcpA ( rbsR , typA , and SAK_0257 encoding the trehalose phosphotransferase system) under the transcriptome conditions. Proteins encoded by rbsR and SAK_0257 are both involved in carbon metabolism. The gene typA codes for a translational regulator involved...”
• A Vaginal Tract Signal Detected by the Group B Streptococcus SaeRS System Elicits Transcriptomic Changes and Enhances Murine Colonization
  Cook, Infection and immunity 2018
  • “...and no. (strain A909) Phosphotransferase systems sak_0257 sak_0261 sak_0354 sak_0398 sak_0399 sak_0400 sak_0524 sak_0525 sak_0526 sak_0528 sak_0529 sak_0530...”
  • “...sak_0398 sak_0399 sak_0400 sak_1920 sak_1702 sak_0354 sak_0257 Fatty acid biosynthesis and metabolism sak_0416 sak_0417 sak_0418 sak_0419 sak_0420 sak_0421...”
• The sensor histidine kinase RgfC affects group B streptococcal virulence factor expression independent of its response regulator RgfA
  Gendrin, Infection and immunity 2015
  • “...SAK_0398, SAK_0400, SAK_0523, SAK_ 0529, SAK_0915, SAK_0530, SAK_0257, and SAK_1920). Increased expression of such genes may facilitate GBS survival and...”

Q8Y7L9 Lmo1255 protein from Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
lmo1255 similar to PTS system trehalose specific enzyme IIBC from Listeria monocytogenes EGD-e
LMRG_00704 PTS system, trehalose-specific, IIBC component from Listeria monocytogenes 10403S
35% identity, 91% coverage

• Proteomic dataset of Listeria monocytogenes exposed to sublethal concentrations of free and nanoencapsulated nisin
  Pinilla, Data in brief 2022
  • “...Nis / LNis Annotation not available Q8Y486 lmo2569 lmo2569 Nis / LNis Annotation not available Q8Y7L9 lmo1255 lmo1255 Nis / LNis Annotation not available Q8Y8C6 lmo0982 lmo0982 Nis / LNis Annotation not available Q8Y4U6 lmo2335 fruA Nis / LNis FruA protein; sugar transporter, phosphoenolpyruvate-dependent phosphotransferase system...”
• DegU-mediated suppression of carbohydrate uptake in Listeria monocytogenes increases adaptation to oxidative stress
  Chen, Applied and environmental microbiology 2023 (secret)
• Listeria monocytogenes GshF contributes to oxidative stress tolerance via regulation of the phosphoenolpyruvate-carbohydrate phosphotransferase system
  Chen, Microbiology spectrum 2023
  • “...lmo1035 PTS beta-glucoside transporter subunit IIABC lmo1095 3.29 Yes/down lmo1095 PTS cellbiose transporter subunit IIB lmo1255 1.52 Yes/up 4.14 Yes/down lmo1255 PTS trehalose transporter subunit IIBC lmo1719 1.64 Yes/down lmo1719 PTS lichenan transporter subunit IIA lmo1720 2.29 Yes/down 2.06 Yes/up lmo1720 PTS lichenan transporter subunit IIB...”
• Proteomic dataset of Listeria monocytogenes exposed to sublethal concentrations of free and nanoencapsulated nisin
  Pinilla, Data in brief 2022
  • “.../ LNis Annotation not available Q8Y486 lmo2569 lmo2569 Nis / LNis Annotation not available Q8Y7L9 lmo1255 lmo1255 Nis / LNis Annotation not available Q8Y8C6 lmo0982 lmo0982 Nis / LNis Annotation not available Q8Y4U6 lmo2335 fruA Nis / LNis FruA protein; sugar transporter, phosphoenolpyruvate-dependent phosphotransferase system Q7AP82...”
• Proteomic Analysis of Listeria monocytogenes FBUNT During Biofilm Formation at 10°C in Response to Lactocin AL705
  Melian, Frontiers in microbiology 2021
  • “...the cytoplasmic membrane. Notably, transport systems such as -glucosidase IIABC (lmo0027), cellobiose (lmo2763), and trehalose (lmo1255) specific PTS proteins were highly overexpressed. In addition, mannose (lmo0098), a specific PTS protein indicating the adaptive response of sessile cells to the bacteriocin, was downregulated as this PTS system...”
  • “...of lactocin AL705; PTS cellobiose-specific IIC component (Lmo2763; FC: 11.12), PTS trehalose transporter subunit IIBC (Lmo1255; FC: 4.58), and ABC transporter permease (Lmo2371; FC: 4.25) were implicated in carbohydrate transmembrane transport and are integral membrane components that showed the highest overexpression, however other proteins were also...”
• YjbH mediates the oxidative stress response and infection by regulating SpxA1 and the phosphoenolpyruvate-carbohydrate phosphotransferase system (PTS) in Listeria monocytogenes
  Cheng, Gut microbes 2021
  • “...Yes lmo2666 PTS galacticol-specific enzyme IIB 4.79 Yes lmo2650 PTS L-ascorbate-specific enzyme IIB 4.02 Yes lmo1255 PTS trehalose-specific enzyme IIBC 2.93 Yes lmo2002 PTS mannose-specific enzyme IIB 2.72 Yes lmo0027 PTS beta-glucosides specific enzyme IIABC 2.55 Yes lmo0022 PTS fructose-specific enzyme IIB 2.24 Yes lmo2685 PTS...”
• The σ^B-dependent regulatory sRNA Rli47 represses isoleucine biosynthesis in Listeria monocytogenes through a direct interaction with the ilvA transcript
  Marinho, RNA biology 2019 (secret)
• Cross Talk among Transporters of the Phosphoenolpyruvate-Dependent Phosphotransferase System in Bacillus subtilis
  Morabbi, Journal of bacteriology 2018
  • “...family is common. In Listeria monocytogenes EGD-e, EIICB Tre (encoded by L. monocytogenes 1255 [ lmo1255 ]) is assumed to be phosphorylated by EIIA Glc encoded by lmo1017 ( 42 ). The GlcNAc and trehalose transporters also share the EIIA Glc subunit in Vibrio cholerae (...”
• Phosphotransferase system-dependent extracellular growth of listeria monocytogenes is regulated by alternative sigma factors σL and σH
  Wang, Applied and environmental microbiology 2014
  • “...by lmo0096; and (iii) PTSGlc (EIIBC), encoded by lmo1255 (20). Moreover, a H-dependent promoter was identified 54 nucleotides upstream of the start codon of...”
• More
• Listeria monocytogenes 10403S Alternative Sigma-54 Factor σ^L Has a Negative Role on Survival Ability Under Bile Exposure
  Boonmee, Frontiers in microbiology 2021
  • “...bglA as housekeeping genes and (ii) mptA , ilvD , ilvC , csbD , and LMRG_00704 for sigma L function. A list of TaqMan primers and probes designed by PrimerQuest (IDT DNA, Coralville, IA) is shown in Supplementary Table S2 . TaqMan probes were synthesized with...”
  • “...of L with or without bile ( Figure 5A ). In contrast, the csbD and LMRG_00704 transcripts are significantly lower in the presence of L alone in BCH ( p <0.05); however, their transcripts are highly expressed in L . Therefore, csbD and LMRG_00704 are negatively...”
• Deep RNA sequencing of L. monocytogenes reveals overlapping and extensive stationary phase and sigma B-dependent transcriptomes, including multiple highly transcribed noncoding RNAs
  Oliver, BMC genomics 2009
  • “...YvyD protein 377.1 LMRG_00515 pdhB lmo1053 highly similar to pyruvate dehydrogenase (E1 beta subunit) 356.4 LMRG_00704 lmo1255 lmo1255 similar to PTS system trehalose-specific enzyme IIBC 353.6 LMRG_00516 pdhC lmo1054 highly similar to pyruvate dehydrogenase (dihydrolipoamide acetyltransferase E2 subunit) 351.3 LMRG_01480 lmo2362 lmo2362 similar to amino acid...”

gbs0189 Unknown from Streptococcus agalactiae NEM316
CHF17_RS01560 PTS system trehalose-specific EIIBC component from Streptococcus agalactiae
35% identity, 67% coverage

• Whole-Genome Comparison Uncovers Genomic Mutations between Group B Streptococci Sampled from Infected Newborns and Their Mothers
  Almeida, Journal of bacteriology 2015
  • “...metabolism gbs1230 Intermediary metabolism Unknown gbs0189 Cellular processes gbs1460 Cellular processes gbs2047 Information pathways gbs1159 Intermediary...”
  • “...genomic region coding for trehalosespecific PTS enzyme IIABC (gbs0189 [trePI]). Trehalose is known to contribute to the adaptation of bacteria to osmotic...”
• Analysis of growth-phase regulated genes in Streptococcus agalactiae by global transcript profiling
  Sitkiewicz, BMC microbiology 2009
  • “...protein family TGTCAACTATATCA 176297 176310 92 gbs0155 Multimodular transpeptidase-transglycosylase PBP 1B TGTAATCGTTTACA 209972 209985 100 gbs0189 PTS system, trehalose-specific IIBC component TGTAAACGGTTACT 214120 214133 92 gbs0191 Transcription antiterminator, BglG family TGAAAAAGGTAACA 243786 243799 92 gbs0227 pseudogene TGTTACCGTTTTCA 284183 284196 100 gbs0266 NADH peroxidase TGAAAGCGGTTATA 349577 349590...”
• Relevance of peptide uptake systems to the physiology and virulence of Streptococcus agalactiae
  Samen, Journal of bacteriology 2004
  • “...genes gbs0183 to dppA and dppD to gbs0189, indicating transcriptional initiation upstream of dppA and transcriptional termination downstream of dppE,...”
• Dual RNA sequencing of group B Streptococcus-infected human monocytes reveals new insights into host-pathogen interactions and bacterial evasion of phagocytosis
  Sullivan, Scientific reports 2023
  • “...protein 48.84 1.86E208 CHF17_RS01975 glpO Type 1 glycerol-3-phosphate oxidase 45.01 4.08E56 CHF17_RS05665 L,D-transpeptidase 44.41 1.67E140 CHF17_RS01560 treP PTS system trehalose-specific EIIBC component 38.09 4.87E250 CHF17_RS05275 CatB-related O-acetyltransferase 34.53 2.24E180 CHF17_RS07525 30S ribosomal protein S21 33.65 1.37E64 CHF17_RS03425 rplS 50S ribosomal protein L19 32.43 5.52E281 CHF17_RS04020 HYPOTHETICAL...”

ID870_08455 PTS system trehalose-specific EIIBC component from Streptococcus agalactiae CJB111
SAG0192 PTS system, IIABC components from Streptococcus agalactiae 2603V/R
35% identity, 67% coverage

• Identification of a DNA-cytosine methyltransferase that impacts global transcription to promote group B streptococcal vaginal colonization
  Manzer, mBio 2023
  • “...genes that were most dysregulated were those involved in sugar metabolism or transport, including treP/C (ID870_08455, ID870_08450) , dhaK/L/M (ID870_01490ID870_01480) , lrgA/B (ID870_08490, ID870_08485) , lacA/B (ID870_00285, ID870_00290) , argF (ID870_10075) , arcC (ID870_10080) , and multiple genes belonging to pts sugar transporters. At the early...”
  • “...relative to WT Locus tag Gene name Description EXP fold change ES fold change Metabolism ID870_08455 treP Trehalose phosphorylase 69.17 2.75 ID870_08450 treC Trehalose-6-phosphate hydrolase 66.48 3.00 ID870_00285 lacA Galactose-6-phosphate subunit A 4.12 5.40 ID870_00290 lacB Galactose-6-phosphate subunit B 3.42 2.82 ID870_01490 dhaK Dihydroxyacetone kinase subunit...”
• Adaptive response of Group B streptococcus to high glucose conditions: new insights on the CovRS regulation network
  Di, PloS one 2013
  • “...sources, such as sag1805 , sag1813 , sag1814 , sag1948 1951 , sag1898 1902 and sag0192 were found to be highly down-regulated (up to 120-fold). Host-pathogen interaction genes Pathogenic bacteria, by modulating the expression of surface-associated or secreted virulence factors, can adapt to host conditions and...”

SPCG_RS09625 PTS system trehalose-specific EIIBC component from Streptococcus pneumoniae CGSP14
36% identity, 69% coverage

• The transcriptomic response of Streptococcus pneumoniae following exposure to cigarette smoke extract
  Manna, Scientific reports 2018
  • “...protein 1.48 0.037 SPCG_RS04895 Endo-beta-N-acetylglucosaminidase LytB 1.40 0.004 SPCG_RS08595 Carbohydrate ABC transporter permease 1.13 0.044 SPCG_RS09625 Phosphotransferase system trehalose transporter subunit IIABC TreP 1.07 0.014 Cell wall/membrane biogenesis SPCG_RS00545 Peptidoglycan-binding protein LysM 1.76 0.004 SPCG_RS04610 ABC-type lipoprotein export system, ATPase component 1.40 0.019 SPCG_RS10170 Membrane protein...”

SPy2097 putative PTS system enzyme II from Streptococcus pyogenes M1 GAS
34% identity, 68% coverage

• Adaptation of group A Streptococcus to human amniotic fluid
  Sitkiewicz, PloS one 2010
  • “...system repressor M28_Spy1668 SPy1972 pulA 5.30 Pullulanase M28_Spy1767 SPy2096 dexS 6.18 39.01 Trehalose-6-phosphate hydrolase M28_Spy1768 SPy2097 - 8.81 43.06 PTS system, trehalose-specific IIBC component Values represent fold change in expression in AF at ML, LL, and S growth phases compared to expression in THY medium. Another...”

TC 4.A.1.2.13 / Q720G7 Trehalose PTS permease IIBC of 494 aas from Listeria monocytogenes serotype 4b (strain F2365)
LMOf2365_1272 PTS system, trehalose-specific, IIBC component from Listeria monocytogenes str. 4b F2365
35% identity, 91% coverage

• substrates: Trehalose
• Transcriptomics of Listeria monocytogenes Treated With Olive Leaf Extract
  Liu, Frontiers in microbiology 2021
  • “...1.36, 1.47, and 1.13, respectively). At 24h post-treatment, 9 PTS-related genes (LMOf2365_0030, LMOf2365_0113, LMOf2365_0572, LMOf2365_0922, LMOf2365_1272, LMOf2365_2128, LMOf2365_2129, LMOf2365_2130, and LMOf2365_2292) were found to be differentially regulated; 7 of which were found to be downregulated in the presence of OLE while LMOf2365_2129 and LMOf2365_0572 were both...”
• Transcriptomic response of Listeria monocytogenes during the transition to the long-term-survival phase
  Wen, Applied and environmental microbiology 2011
  • “...a trehalose-specific transporter (IIBC component) gene, treB (LMOf2365_1272; 20.6-fold upregulation) (Fig. 3). A relatively large group of cation transporter...”

FORC16_0656 PTS trehalose transporter subunit IIBC from Vibrio vulnificus
35% identity, 94% coverage

• Fresh Crab Plays an Important Role as a Nutrient Reservoir for the Rapid Propagation of Vibrio vulnificus
  Kim, Frontiers in microbiology 2021
  • “...of other sugar-related genes was down-regulated, regarding the phosphotransferase system (PTS) for cellobiose (FORC16_2482-2483), trehalose (FORC16_0656), and N-acetylglucosamine (FORC16_4038), which is probably due to the abundance of glucose and glycogen in the crab environment ( Johnston and Davies, 1972 ). However, galactoside transport and metabolism repressor...”

UC7_RS13285 PTS system trehalose-specific EIIBC component from Enterococcus caccae ATCC BAA-1240
35% identity, 92% coverage

• Analysis of Temporal Changes in Growth and Gene Expression for Commensal Gut Microbes in Response to the Polyphenol Naringenin
  Firrman, Microbiology insights 2018
  • “...UC7_RS15570 PTS IIC component 1.5 Sugar transport UC7_RS12210 DNA-directed RNA polymerase subunit delta 1.5 Transcription UC7_RS13285 PTS trehalose IIBC component 1.5 Sugar transport UC7_RS15260 Hypothetical protein 1.5 Unknown UC7_RS14935 Ribosomal RNA large subunit methyltransferase A 1.5 Protein synthesis UC7_RS14065 Hypothetical protein 1.5 Unknown UC7_RS15925 ABC transporter...”

OG1RF_11753 PTS system trehalose-specific EIIBC component from Enterococcus faecalis OG1RF
35% identity, 92% coverage

• Global Regulation of Gene Expression by the MafR Protein of Enterococcus faecalis
  Ruiz-Cruz, Frontiers in microbiology 2015
  • “...in ( i ) the OG1RF_11146-49 operon, involved in glycerol metabolism, ( ii ) the OG1RF_11753 gene, which encodes the EIIBC component of a trehalose PTS transporter, and ( iii ) the OG1RF_11763-61 operon, which encodes components of a carbohydrate ABC transporter. In some pathogenic streptococci...”

ESA_02545 hypothetical protein from Enterobacter sakazakii ATCC BAA-894
ESA_02545 beta-glucoside-specific PTS transporter subunit IIABC from Cronobacter sakazakii ATCC BAA-894
36% identity, 73% coverage

• Comparative analysis of genome sequences covering the seven cronobacter species
  Joseph, PloS one 2012
  • “...involved in positive control of the utilization of different sugars by transcription antitermination [56] . ESA_02545 encodes a kinase which converts -glucosides to 6-phospho--glucosides and ESA_02546 encodes a 6-phospho--glucosidase specific to arbutin-6-phosphate and salicilin-6-phosphate. ESA_02547 also encodes 6-phospho--glucosidase, which may have the same or similar function...”

SGO_1653 trehalose PTS enzyme II from Streptococcus gordonii str. Challis substr. CH1
35% identity, 67% coverage

• Amino Sugars Reshape Interactions between Streptococcus mutans and Streptococcus gordonii
  Chen, Applied and environmental microbiology 2020 (secret)
• Response of fatty acid synthesis genes to the binding of human salivary amylase by Streptococcus gordonii
  Nikitkova, Applied and environmental microbiology 2012
  • “...2.27 4.32 1.89 2.44 2.14 1.91 2.15 2.02 SGO_0939 SGO_1653 SGO_1792 SGO_0133 SGO_1273 SGO_0018 1.00 0.72 0.78 0.86 0.78 0.63 2.00 1.65 1.71 1.82 1.72 1.55 0.80...”

SPD_1664 PTS system, trehalose-specific IIABC components from Streptococcus pneumoniae D39
35% identity, 69% coverage

• StkP- and PhpP-Mediated Posttranslational Modifications Modulate the S. pneumoniae Metabolism, Polysaccharide Capsule, and Virulence
  Kant, Infection and immunity 2023
  • “...SPD_1935 Sugar ABC transporter permease 2.43 8.81E-47 1.96 8.43E-27 SPD_1663 Alpha,alpha-phosphotrehalase 27.30 9.72E-40 2.15 1.69E-23 SPD_1664 PTS beta-glucoside transporter subunit EIIBCA 8.25 0 8.11 4.12E-261 SPD_RS4270 Hypothetical protein 2.32 5.6E_03 2.12 8.9E-03 SPD_RS6165 ABC transporter ATP-binding protein 2.43 5.72E-89 2.0 6.87E-47 Miscellaneous genes SPD_632 Bifunctional phosphomethylpyrimidine...”
• SPD_1495 Contributes to Capsular Polysaccharide Synthesis and Virulence in Streptococcus pneumoniae
  Zheng, mSystems 2020
  • “...that many upregulated proteins in D39 spd1495 , such as LacB, LacD, DexB, BglA-1, SPD_0559, SPD_1664, and SPD_0412, formed a small network. These proteins are involved in carbohydrate metabolism, which supplies some of the key raw materials for CPS synthesis, such as ATP and NAD +...”
• S1 Domain RNA-Binding Protein CvfD Is a New Posttranscriptional Regulator That Mediates Cold Sensitivity, Phosphate Transport, and Virulence in Streptococcus pneumoniae D39
  Sinha, Journal of bacteriology 2020 (secret)
• Redefining the Small Regulatory RNA Transcriptome in Streptococcus pneumoniae Serotype 2 Strain D39
  Sinha, Journal of bacteriology 2019
  • “...spd_1577 spd_1580, spd_1582 spd_1605, spd_1604 spd_1662, murI spd_1664, treC Spd_sr 39c Spd_sr 52c Spd_sr91 Spd_sr92 Spd_sr93 Spd_sr94 Spd_sr95 Spd_sr10c...”
• Deep genome annotation of the opportunistic human pathogen Streptococcus pneumoniae D39
  Slager, Nucleic acids research 2018
  • “...G>T R28L (CGC>CTC) 1672084 1672541 SPD_1660 ( rdgB ) G>A RdgB T117I (ACA>ATA) 1676516 1676973 SPD_1664 ( treP ) C>T TreP G359D (GGC>GAC) 1787708 1788165 SPD_1793 C>T A2V (GCA>GTA) 1977728 1978185 SPD_2002 ( dltD ) C>A DltD V252F (GTC>TTC) 2022372 2022829 SPD_2045 ( mreC ) A>G...”
• N-acetylglucosamine-Mediated Expression of nagA and nagB in Streptococcus pneumoniae
  Afzal, Frontiers in cellular and infection microbiology 2016
  • “...spd_1049 Transcription antiterminator, LacT 4.4 spd_0282 Hypothetical protein 4.4 spd_0281 PTS system, IIA component 4.2 spd_1664 PTS system, trehalose-specific IIABC components 4.2 spd_1663 -phosphotrehalase, TreC 4.0 spd_0279 PTS system, IIB component 3.9 spd_1495 Sugar ABC transporter, sugar-binding protein 3.7 spd_1973 -1,2-mannosidase, putative 3.6 spd_1496 PTS system,...”
• Ascorbic acid-dependent gene expression in Streptococcus pneumoniae and the activator function of the transcriptional regulator UlaR2
  Afzal, Frontiers in microbiology 2015
  • “...triad protein A, PhtA 3.9 spd_1053 Galactose-6-phosphate isomerase, LacA subunit, LacA 2.5 spd_1295 Hemolysin 4.6 spd_1664 PTS system, trehalose-specific IIABC components 2.1 spd_1839 Transketolase, Tkt 4.7 spd_1840 L-ascorbate 6-phosphate lactonase, UlaG 35.5 spd_1841 Transcriptional regulator, UlaR 14.9 spd_1842 L-ribulose-5-phosphate 4-epimerase, UlaF/AraD 11.6 spd_1843 L-xylulose 5-phosphate 3-epimerase,...”

spr1699 Phosphotransferase system, trehalose-specific IIBC component from Streptococcus pneumoniae R6
35% identity, 64% coverage

• A functional genomics approach to establish the complement of carbohydrate transporters in Streptococcus pneumoniae
  Bidossi, PloS one 2012
  • “...alleles sucrose sucrose [27] - SPG01697-8-701 d - PTS-Lac indel sulphated glycans [108] SP1884 SPG01796 spr1699 PTS-Glc indel trehalose trehalose [73] SP1895-6-7 SPG01782-3-4 spr1710-1-2 CUT1 rafGFE conserved stachyose, raffinose, melibiose alpha-galactosides SP2022-3-4 SPG01935-6-7 spr1834-5-6 PTS-Lac conserved amygdalin beta-glucosides SP2036-7-8 SPG01950-1-2 spr1847-8-9 PTS-Asc conserved ascorbate ascorbate [75]...”

A5I073 PTS system, beta-glucoside-specific IIabc component from Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
CBO0881 PTS system, beta-glucoside-specific IIabc component from Clostridium botulinum A str. ATCC 3502
35% identity, 69% coverage

• Identification of potential drug targets and vaccine candidates in Clostridium botulinum using subtractive genomics approach
  Sudha, Bioinformation 2019
  • “...179 Isochorismatase A5I0D8 Yes - 10 CBO0881 cbo02060 629 PTS system beta-glucoside-specific transporter subunit IIABC A5I073 Yes COG1264[G] 11 CBO2715 cbo00521, cbo00523 177 dTDP-4-dehydrorhamnose 3,5-epimerase A5I5E9 Yes COG1898[M] 12 CBO1432 cbo01503 283 N-acetylmuramoyl-L-alanine amidase A5I1R2 Yes COG0860[M] 13 CBO3111 cbo01503 967 N-acetylmuramoyl-L-alanine amidase A5I6J2 Yes COG0860[M]...”
• Identification of potential drug targets and vaccine candidates in Clostridium botulinum using subtractive genomics approach
  Sudha, Bioinformation 2019
  • “...14 shortlisted targets were found to be interacting with different C. botulinum strains and protein CBO0881 has maximum 50 interactors. Target with higher interactors was considered as metabolically important active protein, and hence could be used as good drug target [ 31 ]. Functionality analysis: We...”
  • “...ABC transporter permease A5I0Z1 No COG0765[E] 9 CBO0945 - 179 Isochorismatase A5I0D8 Yes - 10 CBO0881 cbo02060 629 PTS system beta-glucoside-specific transporter subunit IIABC A5I073 Yes COG1264[G] 11 CBO2715 cbo00521, cbo00523 177 dTDP-4-dehydrorhamnose 3,5-epimerase A5I5E9 Yes COG1898[M] 12 CBO1432 cbo01503 283 N-acetylmuramoyl-L-alanine amidase A5I1R2 Yes COG0860[M]...”
• Genetic homogeneity of Clostridium botulinum type A1 strains with unique toxin gene clusters
  Raphael, Applied and environmental microbiology 2008
  • “...the ha/orfX A1 strains consisting of CBO0640, CBO0652, CBO0881, CBO1050, CBO2468, CBO2615, and CBO3197 also failed to produce amplification products using the...”

VC0910 PTS system, trehalose-specific IIBC component from Vibrio cholerae O1 biovar eltor str. N16961
34% identity, 95% coverage

• Cross-Platform Transcriptomic Data Integration, Profiling, and Mining in Vibrio cholerae
  Qin, Microbiology spectrum 2023
  • “...five genes most significantly upregulated at the overall transcriptome level were vc2698 , vca1031 , vc0910 , vc0911 , and vc2699 . The gene vc2698 ( aspA ), an aspartate ammonia-lyase, was identified in a previous study ( 11 ) as being responsible for the reversible...”
  • “...commonly associated with nutritional competition ( 12 ), but its function has not been investigated. vc0910 ( treB ) was identified as phosphotransferase system (PTS) trehalose transporter subunit IIBC and vc0911 ( treC ) was identified as ,-phosphotrehalase; both of these belong to the PTS system,...”
• Disrupting Central Carbon Metabolism Increases β-Lactam Antibiotic Susceptibility in Vibrio cholerae
  Keller, Journal of bacteriology 2023 (secret)
• MlrA, a MerR family regulator in Vibrio cholerae, senses the anaerobic signal in the small intestine of the host to promote bacterial intestinal colonization
  Wu, Gut microbes 2022
  • “...sequences of identified MlrA-binding sites in the promoter region of two genes ( vca0219 and vc0910 ). The RNA-seq data showed that the expression of vca0219 and vc0910 are downregulated 3.12-fold and upregulated 2.10-fold, respectively, in mlrA , suggesting that MlrA may directly regulate the expression...”
  • “...an important virulence factor in V. cholerae that belongs to the pore-forming toxin family. 42 Vc0910 encodes the EIIB/EIIC proteins of the carbohydrate phosphotransferase system (PTS). Previous research has shown that cooperative regulation of PTS is important for bacterial survival and virulence gene expression. 43 ,...”
• Transcriptional profiling of Vibrio cholerae O1 following exposure to human anti- lipopolysaccharide monoclonal antibodies
  Baranova, Pathogens and disease 2020
  • “...IgG treatment. log2a VCA1028 VC0911 VCA0247 VC1649 VC0910 VCA0860 VCA0945 VCA0908 VCA0944 VC0606 VCA0136 VCA0137 VC0089 VC1778 VC0795 VC0797 VC0796 VCA0684...”
• A Genome-Wide Screen Reveals that the Vibrio cholerae Phosphoenolpyruvate Phosphotransferase System Modulates Virulence Gene Expression
  Wang, Infection and immunity 2015
  • “...VC1822 C6706 VC2013 C6706 VC0995 C6706 VCA1045 C6706 VC0910 PtsI(H189A) VC0964(H91D) PtsH(H15A) Lab collection Lab collection 56 This study This study This...”
  • “...VCA1045 pCVD442 carrying an unmarked, in-frame deletion in VC0910 pCVD442 carrying intact VC0965 with a mutation H189A pCVD442 carrying intact VC0966 with a...”

SP_1884 trehalose PTS system, IIABC components from Streptococcus pneumoniae TIGR4
35% identity, 69% coverage

• A bacterial pan-genome makes gene essentiality strain-dependent and evolvable
  Rosconi, Nature microbiology 2022
  • “...constructed in a PG06-SP_1205 knockout. The identification of three functionally related suppressive SNPs (SP_1176 A17P, SP_1884 I34T and SP_1885 H182N) suggests that transport of the disaccharide trehalose (or a similar compound) is a central hub for bypassing SP_1205. Gene SP_1205 has a synthetic lethal interaction with...”
• The Effect of Impaired Polyamine Transport on Pneumococcal Transcriptome
  Nakamya, Pathogens (Basel, Switzerland) 2021
  • “...for pneumococcal stress responses. Locus Tag Gene Fold Change potABCD /TIGR4 FDR p Value Description SP_1884 SP_1884 3.6 <0.0001 PTS trehalose transporter subunit IIBC SP_1883 SP_1883 3.2 <0.0001 Trehalose 6-phosphate hydrolase SP_1907 groES 3.9 <0.0001 Co-chaperone SP_0519 dnaJ 3.8 <0.0001 Molecular chaperone SP_0517 dnaK 4.2 <0.0001...”
• Polyamine Synthesis Effects Capsule Expression by Reduction of Precursors in Streptococcus pneumoniae
  Ayoola, Frontiers in microbiology 2019
  • “...ATP-binding protein 1.6 metQ SP_0149 Lipoprotein 1.7 Stress response SP_1883 SP_1883 Putative dextran glucosidase 28.1 SP_1884 SP_1884 Trehalose PTS system, IIABC components 26.2 psaB SP_1648 Manganese ABC transporter, ATP-binding protein 2.7 psaC SP_1649 Putative manganese ABC transporter, permease protein 2.7 psaA SP_1650 Manganese ABC transporter substrate-binding...”

BSU01680 putative sugar phosphotransferase enzyme II from Bacillus subtilis subsp. subtilis str. 168
35% identity, 99% coverage

• T-REx: Transcriptome analysis webserver for RNA-seq Expression data
  de, BMC genomics 2015
  • “...T1 C_R61H-WT BSU01660 green CodY F71Y1 A_F71Y T1 Null-WT BSU01670 green CodY F71Y2 A_F71Y T1 BSU01680 green CodY R61K1 B_R61K T2 etc R61K2 B_R61K T2 BSU03981 red CcpA R61H1 C_R61K T2 BSU03982 red CcpA R61H2 C_R61K T2 BSU03990 red CcpA null1 Null T2 BSU04160 red CcpA...”

EF2213 PTS system, IIBC components from Enterococcus faecalis V583
Q832L3 PTS system, IIBC components from Enterococcus faecalis (strain ATCC 700802 / V583)
35% identity, 92% coverage

• Transcriptome, proteome, and metabolite analyses of a lactate dehydrogenase-negative mutant of Enterococcus faecalis V583
  Mehmeti, Applied and environmental microbiology 2011
  • “...adhE eutD alsS budA L-Lactate EF1720 Uracil permease EF2213 EF3014 EF3199 EF3200 EF3315 EF3318 EF3319 EF3320 EF3321 EF3322 EF3324 EF3325 PTS system, IIBC...”
• Transcriptional response of Enterococcus faecalis V583 to erythromycin
  Aakra, Antimicrobial agents and chemotherapy 2005
  • “...EF0022 EF0411 EF0553 EF0958 EF1012 EF1017 EF1018 EF1019 EF1336 EF1633 EF1801 EF2213 EF3029 EF3290 EF0782 EF3180 EF0056 EF0179 EF0247 0 0 0 0 0 0 0 0 0 0 0 0.80...”
• Gliotoxin-mediated bacterial growth inhibition is caused by specific metal ion depletion
  Downes, Scientific reports 2023
  • “...family 1 2.76907 0.012451 15 39.9 Q839A6 PTS system, IIBC components 2.73649 0.0463181 7 16.2 Q832L3 ABC transporter, substrate-binding protein 1.82212 0.0241417 19 49.8 Q832K5 Ornithine carbamoyltransferase, catabolic 1.73602 0.00170647 17 67.6 Q839Q5 30S ribosomal protein S15 1.64109 0.0088054 6 56.2 Q82ZJ1 Hydrolase, haloacid dehalogenase-like family...”

A0J47_RS18430 PTS trehalose transporter subunit IIBC from Photobacterium damselae subsp. damselae
34% identity, 94% coverage

• Low salinity activates a virulence program in the generalist marine pathogen Photobacterium damselae subsp. damselae
  Barca, mSystems 2023
  • “...Glycogen phosphorylase 3.14 1.65 2.10E-67 ChrII A0J47_RS18420 Trehalose operon repressor TreR 2.13 1.09 3.69E-51 ChrII A0J47_RS18430 PTS system, trehalose-specific IIBC component PTS system TreB 14.92 3.90 0 ChrII A0J47_RS18435 Trehalose-6-phosphate hydrolase TreC 7.00 2.81 1.83E-30 ChrII Amino sugar and nucleotide metabolism A0J47_RS17085 Anaerobic ribonucleoside-triphosphate reductase activating...”

SSU0217 sugar phosphotransferase system (PTS), IIABC component from Streptococcus suis P1/7
34% identity, 68% coverage

• FlpS, the FNR-Like Protein of Streptococcus suis Is an Essential, Oxygen-Sensing Activator of the Arginine Deiminase System
  Willenborg, Pathogens (Basel, Switzerland) 2016
  • “...In the exp growth phase the predicted PTS for fructose ( SSU0768 ), trehalose ( SSU0217 ) and glucose/mannose ( SSU1583 ), and in the stat growth phase the PTS for predicted transport of mannose ( SSU0199-201 ), galactose ( SSU0403-0406 ), and N-acetylgalactosamines ( SSU1055-1057...”
  • “...genes found by our microarray analysis. SSU0357 and SSU1583 presumably encode for glucose-specific PTS whereas SSU0217 and SSU1309 encode for trehalose- and -glucoside PTS, respectively. Glucose and glucose-containing di- and oligosaccharides are the major energy sources of S. suis. Since expression of gapA and gpmA was...”

PMI0291 trehalose-specific PTS system, EIIBC component from Proteus mirabilis HI4320
35% identity, 95% coverage

• Perturbation of FliL interferes with Proteus mirabilis swarmer cell gene expression and differentiation
  Cusick, Journal of bacteriology 2012
  • “...PMI3460 PMI1660 PMI1646 PMI0842 PMI0833 PMI1647 PMI0992 PMI2149 PMI0291 PMI1623 PMI1622 PMI1442 PMI1659 PMI1245 PMI0176 PMI1662 fliG flgF fliN flaA NA NA fliJ...”
• Transcriptome of Proteus mirabilis in the murine urinary tract: virulence and nitrogen assimilation gene expression
  Pearson, Infection and immunity 2011
  • “...PMI2814 PMI3177 PMI1631 PMI1469 PMI0022 PMI1595 PMI1622 PMI0291 PMI0596 PMI1656 PMI3178 PMI1943 PMI1620 PMI1666 PMI1645 PMI0044 PMI1621 PMI3211 PMI1506 PMI1879...”

U876_02330 PTS trehalose transporter subunit IIBC from Aeromonas hydrophila NJ-35
35% identity, 91% coverage

• Tetrahymena thermophila Predation Enhances Environmental Adaptation of the Carp Pathogenic Strain Aeromonas hydrophila NJ-35
  Liu, Frontiers in cellular and infection microbiology 2018
  • “...transporter 0.491 U876_08755 GltP C 4 -dicarboxylate ABC transporter 0.485 U876_00825 NirC Nitrite transporter 0.354 U876_02330 Pts IIBC PTS system trehalose-specific transporter 0.322 U876_17165 Stpk Serine/threonine protein kinase 0.401 Validation of mass spectrometry results by qRT-PCR To determine whether the differentially expressed proteins screened between the...”

Spaf_1559 PTS system trehalose-specific EIIBC component from Streptococcus parasanguinis FW213
36% identity, 65% coverage

• Complete genome and transcriptomes of Streptococcus parasanguinis FW213: phylogenic relations and potential virulence mechanisms
  Geng, PloS one 2012
  • “...Spaf_1806 Small-conductance mechanosensitive efflux channel 797 240 3.3 Spaf_1558 Putative trehalose-6P hydrolase 848 36 23.4 Spaf_1559 Trehalose-specific IIBC component 449 25 18.1 a , the PRKM was calculated as described in the materials and methods. b , the ratio of the expression levels in cells grown...”
  • “...Additionally, a relatively high level of expression was seen in genes encoding the trehalose-specific EIIAB (Spaf_1559) and the trehalose-6 phosphate hydrolase (Spaf_1558) in the early growth phase. Trehalose is a compatible solute that accumulates intracellularly upon osmotic stress [58] and the expression of trehalose PTS in...”

VSAL_II0577 PTS system, trehalose-specific EIIBC component from Vibrio salmonicida LFI1238
VSAL_II0577 PTS trehalose transporter subunit IIBC from Aliivibrio salmonicida LFI1238
34% identity, 95% coverage

• Differential expression profiling of ΔlitR and ΔrpoQ mutants reveals insight into QS regulation of motility, adhesion and biofilm formation in Aliivibrio salmonicida
  Khider, BMC genomics 2019
  • “...5 downregulated genes within transport/binding protein functional group were genes of the PTS system ( VSAL_II0577 , VSAL_II0894 , VSAL_II0995 and VSAL_II0966 ) with fold changes ranging from 44.43 to 8.34 (Additional file 3 : Table S3). Six genes ( VSAL_II0366 , VSLA_II0367 , VSAL_II0368 ,...”

bglP / CAA84286.1 beta-glucoside permease from Bacillus subtilis (see paper)
35% identity, 64% coverage

TC 4.A.1.2.11 / P40739 Aryl β-glucoside porter, IIBCA (BglP; SytA) (35% identical to 4.A.1.2.2) from Bacillus subtilis (see 5 papers)
35% identity, 64% coverage

• substrates: Aryl beta-glucosides
• The bvr locus of Listeria monocytogenes mediates virulence gene repression by beta-glucosides
  Brehm, Journal of bacteriology 1999
  • “...(accession numbers: ArbF, P26207; BglF, P08722; and BglP, P40739; identities with BvrB: 37, 34, and 32%, respectively). The positions of residues involved in...”
• Identification and characterization of a new beta-glucoside utilization system in Bacillus subtilis
  Tobisch, Journal of bacteriology 1997
  • “...enzyme IIBCA protein (SytA/BglP; SwissProt accession no. P40739) and a phospho-b-glucosidase (BglH; SwissProt accession no. P40740). Arbutin and salicin are...”

ESA_RS01190 PTS trehalose transporter subunit IIBC from Cronobacter sakazakii ATCC BAA-894
34% identity, 96% coverage

• The Global Response of Cronobacter sakazakii Cells to Amino Acid Deficiency
  Chen, Frontiers in microbiology 2018
  • “...MFS transporter ESA_RS17675 glpK -6.85 Glycerol kinase ESA_RS01185 treC -7.35 Glucohydrolase ESA_RS17670 glpF -7.40 Aquaporin ESA_RS01190 treB -8.34 PTS sucrose IIB component/PTS sucrose IIC component The homologous BAA-894 genes were identified through BLAST, using the corresponding Escherichia coli MG1655 gene as a bait. N/A, no homolog...”

GM298_21730 PTS trehalose transporter subunit IIBC from Enterobacter sp. HSTU-ASh6
34% identity, 96% coverage

• Unveiling chlorpyrifos mineralizing and tomato plant-growth activities of Enterobacter sp. strain HSTU-ASh6 using biochemical tests, field experiments, genomics, and in silico analyses
  Haque, Frontiers in microbiology 2022
  • “...[Fe] 1.15.1.1 sod C GM298_13845 45550.46068 Superoxide dismutase [CuZn] SodC2 1.15.1.1 Trehalose metabolism tre B GM298_21730 11825.13243 PTS trehalose transporter subunit IIBC 2.7.1.201 tre C GM298_21725 10130.11773 Alpha, alpha-phosphotrehalase 3.2.1.93 tre R GM298_21735 13371.14318 HTH-type transcriptional regulator TreR ots A GM298_03275 196622.198046 Alpha, alpha-trehalose-phosphate synthase 2.4.1.15...”

CPF_0541 PTS system, trehalose-specific IIBC component from Clostridium perfringens ATCC 13124
35% identity, 95% coverage

• Effect of Trehalose and Trehalose Transport on the Tolerance of Clostridium perfringens to Environmental Stress in a Wild Type Strain and Its Fluoroquinolone-Resistant Mutant
  Park, International journal of microbiology 2016
  • “...In conclusion, the study shows that trehalose can protect C. perfringens from environmental stress. Furthermore, CPF_0541, annotated as treB , is implicated in trehalose transport, and its expression is altered in the gatifloxacin-resistant mutant 13124 GR . Acknowledgments The authors thank Dr. Robert D. Wagner and...”
  • “...and gatifloxacin resistant mutant 13124 GR by qRT-PCR a . Locus Gene Primer Fold (mutant/wild) CPF_0541 upstream treB upstream ACAGAGTACATAGGCGGAAAAGA 333.89 828.5 330 TTTCAACATCTGCTTTGCTTG CPF_0541 treB TTGGGACTTTGGATTTGCTC 93.81 227.5 22.28 GCCTGCCACTATAGCTCCTG CPF_0542 treC GAGCTTTAAAGGGCGAAGAAA 45.1 44.50 16.80 CCCAGTTTAAATCAGCCTGTG CPF_0543 treR GCCTTCAGAATCACAACTTATGG 1.69 1.79 1.31 TTTCGCACTCTTTTCCTAAGC CPF_0539...”
• Global Phenotypic Characterization of Effects of Fluoroquinolone Resistance Selection on the Metabolic Activities and Drug Susceptibilities of Clostridium perfringens Strains
  Park, International journal of microbiology 2014
  • “...13124 GR also was reduced on maltose. Microarray data also showed that the CPF_1785 and CPF_0541 genes, for the transport of sucrose and trehalose, respectively, into the cells, were downregulated 15- and 31-fold in a gatifloxacin-resistant mutant, 13124 GR , and putative maltose transporters were also...”
  • “...maltose. Downregulation of genes involved in the sucrose and trehalose-specific phosphotransferase (PTS) systems CPF_1785 and CPF_0541 , the maltose ABC transporter CPF_2652 , and a putative maltose transporter CPF_2654 in the gatifloxacin-resistant strain 13124 GR was observed, which may have resulted in the lack of growth...”

EAE_09695 PTS trehalose transporter subunit IIBC from Klebsiella aerogenes KCTC 2190
33% identity, 95% coverage

• Transcriptional effects of melatonin on the gut commensal bacterium Klebsiella aerogenes
  Graniczkowska, Genomics 2022
  • “...CelB lactose/cellobiose-specific enzyme IIC stationary 1.330 EAE_09655 MtlA2 transcriptional regulator/PTS system, IIA component stationary 1.413 EAE_09695 TreB trehalose/maltose-specific transporter subunits IIBC stationary 1.730 Table 6 Relative expression of carbohydrate transport and metabolism in K. aerogenes grown with 1 nM melatonin as compared to control cells Gene...”

KPHS_04990 trehalose(maltose)-specific PTS system components IIBC from Klebsiella pneumoniae subsp. pneumoniae HS11286
33% identity, 95% coverage

• Use of a combined antibacterial synergy approach and the ANNOgesic tool to identify novel targets within the gene networks of multidrug-resistant Klebsiella pneumoniae
  Lee, mSystems 2024
  • “...hydratase-isomerase) were significantly changed after combination treatment exposure. ( H ) Starch and sucrose metabolism. KPHS_04990 (trehalose(maltose)-specific PTS system component IIBC) was upregulated and KPHS_52250 (putative PTS, EIIC) was downregulated. Fig 3 Functional networks among differentially expressed genes and noncoding RNA-associated genes. ( A ) KPHS_23690...”
  • “...to produce trehalose and orthophosphate under stressful conditions ( 51 ). Oppositely, the upregulation of KPHS_04990 (trehalose(maltose)-specific PTS system component IIBC) is associated with the degradation of trehalose-6-phosphate to glucose and glucose 6-phosphate in the carbohydrate transport system. To achieve a maximum growth rate, bacteria reduce...”

CD630_04690 PTS beta-glucoside transporter subunit IIBCA from Clostridioides difficile 630
CD0469 PTS system, IIabc component from Clostridium difficile 630
35% identity, 71% coverage

• Clostridioides difficile strain-dependent and strain-independent adaptations to a microaerobic environment
  Weiss, Microbial genomics 2021
  • “...striking differences in transcription of sugar transporters. Four gene clusters involved in sucrose transport ( CD630_04690 ), mannose transport ( CD630_2567025680 ), lactose/cellobiose transport ( CD630_3443034450 ) and xylose utilization ( xylA , xynA , xynB ) exhibited higher expression in strain 630 than CD196. C....”
• The repertoire of ABC proteins in Clostridioides difficile
  Pipatthana, Computational and structural biotechnology journal 2021
  • “...ABC conserved motif and are not associated with transport activity [2] . Eleven proteins (cd630_03880, cd630_04690, cd630_08160, cd630_22690, cd630_30750, cd630_30860, cd630_30970, cd630_31160, cd630_31250, cd630_31340, and cd630_31370) annotated as phosphoryl transfer protein subunit IIABC were also omitted from further analyses. Although the phosphotransferase system (PTS) is involved...”
• Pleiotropic role of the RNA chaperone protein Hfq in the human pathogen Clostridium difficile
  Boudry, Journal of bacteriology 2014
  • “...(CD630_n00170), an sRNA located in the IGR between CD0469 Journal of Bacteriology Downloaded from http://jb.asm.org/ on February 11, 2017 by University of...”
• Genome-wide identification of regulatory RNAs in the human pathogen Clostridium difficile
  Soutourina, PLoS genetics 2013
  • “...Figure 5 shows two examples of growth phase-regulated sRNAs: RCd6 located in the IGR between CD0469 and CD0470 genes encoding a saccharose-type IIABC component of the PTS system and a beta-lactamase-inducing penicillin-binding protein (BlaR), respectively, and SQ1498 located in IGR between CD2112 and CD2113 genes encoding...”

A0A0H3F7X9 protein-Npi-phosphohistidine-trehalose phosphotransferase (EC 2.7.1.201); protein-Npi-phosphohistidine-sucrose phosphotransferase (EC 2.7.1.211) from Escherichia coli (see paper)
34% identity, 91% coverage

UC7_RS14195 beta-glucoside-specific PTS transporter subunit IIABC from Enterococcus caccae ATCC BAA-1240
34% identity, 72% coverage

• Analysis of Temporal Changes in Growth and Gene Expression for Commensal Gut Microbes in Response to the Polyphenol Naringenin
  Firrman, Microbiology insights 2018
  • “...protein 2.0 Unknown UC7_RS13805 Hypothetical protein 1.9 Unknown UC7_RS13955 Protein-(glutamine-N5) methyltransferase, release factor-specific 1.9 Methylation UC7_RS14195 PTS -glucoside transporter subunit EIIBCA 1.9 Sugar transport UC7_RS15880 Hypothetical protein 1.9 Unknown UC7_RS14150 Serine hydrolase 1.8 Metabolism UC7_RS16020 Hypothetical protein 1.8 Unknown UC7_RS14330 Teichoic acid glycosylation protein 1.8 Cell...”

SSON53G_RS25460 PTS trehalose transporter subunit IIBC from Shigella sonnei 53G
34% identity, 88% coverage

• Shigella sonnei infection of zebrafish reveals that O-antigen mediates neutrophil tolerance and dysentery incidence
  Torraca, PLoS pathogens 2019
  • “...genes. From top to bottom, genes represented in D are: adhE_3, glyA, purF, purD, purL, SSON53G_RS25460 (treB-like), gcvP, gcvH, yjiY, gcvT, treC, SSON53G_RS05440 (ymdF-like), gadC, SSON53G_RS20945 (slp-like), otsA, SSON53G_RS02230 (bolA-like), suhB, katE, SSON53G_RS31575 (mcbA-like), hdeD, gadB_1, gadB_2, yohC, gadE, hdeB, SSON53G_RS09595 (narU-like), yegP, ycgB, hdeA, SSON53G_RS20815...”

SF4250 PTS system enzyme II from Shigella flexneri 2a str. 301
34% identity, 89% coverage

• RNA-seq analysis of the influence of anaerobiosis and FNR on Shigella flexneri
  Vergara-Irigaray, BMC genomics 2014
  • “...Na+-translocating NADH-quinone reductase subunit E -1.75 SF5M90T_1011 rutA pyrimidine monooxygenase -3.07 Carbohydrate transport and metabolism SF4250 treB PTS system trehalose(maltose)-specific transporter subunits IIBC 3.66 SF5M90T_4160 treC trehalase 6-P hydrolase 3.56 SF5M90T_1379 manX PTS enzyme IIAB, mannose-specific 3.36 SF5M90T_1378 manY PTS enzyme IIC, mannose-specific 3.11 SF5M90T_1377 manZ...”

TreB / b4240 trehalose-specific PTS enzyme IIBC component (EC 2.7.1.201) from Escherichia coli K-12 substr. MG1655 (see 3 papers)
TreB / P36672 trehalose-specific PTS enzyme IIBC component (EC 2.7.1.201) from Escherichia coli (strain K12) (see paper)
PTTBC_ECOLI / P36672 PTS system trehalose-specific EIIBC component; EIIBC-Tre; EII-Tre; EC 2.7.1.201 from Escherichia coli (strain K12) (see 2 papers)
P36672 protein-Npi-phosphohistidine-trehalose phosphotransferase (EC 2.7.1.201) from Escherichia coli (see paper)
TC 4.A.1.2.4 / P36672 Trehalose porter, TreB (IIBC) which can take up maltose by facilitated diffusion from Escherichia coli (see 5 papers)
b4240 fused trehalose(maltose)-specific PTS enzyme: IIB component/IIC component from Escherichia coli str. K-12 substr. MG1655
34% identity, 88% coverage

• function: The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. This system is involved in trehalose transport at low osmolarity.
  catalytic activity: alpha,alpha-trehalose(out) + N(pros)-phospho-L-histidyl- [protein] = alpha,alpha-trehalose 6-phosphate(in) + L-histidyl- [protein] (RHEA:33371)
• substrates: Trehalose
  tcdb comment: Can also transport sucrose at a low rate (Steen et al. 2014)
• Combinatorial strategies for improving multiple-stress resistance in industrially relevant Escherichia coli strains
  Lennen, Applied and environmental microbiology 2014
  • “...(Continued) Strain Gene Description Fold change b0463 b0121 b2095 b4240 b3415 b2664 b2943 ECD_01942 b2028 b4114 b2845 b2663 acrA speE gatZ treB gntT csiR galP...”
• Reconfiguring the quorum-sensing regulator SdiA of Escherichia coli to control biofilm formation via indole and N-acylhomoserine lactones
  Lee, Applied and environmental microbiology 2009
  • “...b3704 b3722 b4051 b4067 b4069 b4119 b4149 b4187 b4227 b1197 b4239 b4240 5.3 6.1 8.0 4.0 8.6 12.1 8.0 13.9 12.1 1.4 8.6 5.7 6.5 13.0 13.0 8.6 3.5 2.6 5.3 7.0...”
• Inhibition of hydrogen uptake in Escherichia coli by expressing the hydrogenase from the cyanobacterium Synechocystis sp. PCC 6803
  Maeda, BMC biotechnology 2007
  • “...dehydrogenase membrane protein [31, 32] sdhD b0722 9.2 succinate dehydrogenase membrane protein [32, 34] treB b4240 9.2 subunit of EIITre [34] treC b4239 6.1 trehalose-6-phosphate hydrolase [31-33] pspA b1304 9.2 regulatory protein for the phage shock protein operon [32] pspB b1305 8.0 stimulates PspC-mediated transcriptional activation...”
• DNA microarray analyses of the long-term adaptive response of Escherichia coli to acetate and propionate
  Polen, Applied and environmental microbiology 2003
  • “...1 ORF, hypothetical protein 0.28* 0.40* 0.88 b4239 b4240 treC treB 1 1 Trehalase-6-phosphate hydrolase PTS enzyme II, trehalose specific 0.31* 0.23 0.38 0.25*...”
• Genome-wide transcriptional profiling of the Escherichia coli responses to superoxide stress and sodium salicylate
  Pomposiello, Journal of bacteriology 2001
  • “...TABLE 2--Continued Gene type b Gene Ratio b3316 b0023 b0121 b4240 b2607 b3384 b0170 b3339 b2014 rpsS rpsT speE treB trmD trpS tsf tufA yeeF 0.2 0.4 0.4 0.4...”
• The Thioredoxin Fold Protein (TFP2) from Extreme Acidophilic Leptospirillum sp. CF-1 Is a Chaperedoxin-like Protein That Prevents the Aggregation of Proteins under Oxidative Stress
  Muñoz-Villagrán, International journal of molecular sciences 2024
  • “...ribose ABC transporter ATP binding subunit rbsA 6.05 0.018 P0A9C9 fructose-1.6-bisphosphatase 2 glpX 4.71 0.010 P36672 trehalose-specific PTS enzyme IIBC component treB 7.67 0.004 P0A6K6 phosphopentomutase deoB 5.02 0.027 H. Coenzyme transport and metabolism P76085 phenylacetate-CoA ligase paaK 5.49 0.049 P0A8Y1 pyrimidine 5-nucleotidase YjjG yjjG 3.95...”
• Biodistribution of ⁸⁹Zr-DFO-labeled avian pathogenic Escherichia coli outer membrane vesicles by PET imaging in chickens
  Li, Poultry science 2023
  • “...EMRA Defense mechanisms Cell inner membrane 370 P0C0L7 PROP Function unknown Cell inner membrane 371 P36672 PTTBC Carbohydrate transport and metabolism Cell inner membrane 372 P0ABI4 CORA Inorganic ion transport and metabolism Cell inner membrane 373 P0A843 TATE Intracellular trafficking, secretion, and vesicular transport Cell inner...”
• Molecular analysis of treB encoding the Escherichia coli enzyme II specific for trehalose
  Klein, Journal of bacteriology 1995
  • “...submitted to the Swissprot database under accession number P36672. VOL. 177, 1995 TREHALOSE ENZYME II OF THE PTS 4045 Downloaded from http://jb.asm.org/ on May...”

YE3774 PTS system, trehalose-specific IIBC component from Yersinia enterocolitica subsp. enterocolitica 8081
31% identity, 96% coverage

• Transcriptional analysis of long-term adaptation of Yersinia enterocolitica to low-temperature growth
  Bresolin, Journal of bacteriology 2006
  • “...P-YE3697-luxCDABE 0.90 Metabolism 15 YE3774 Protein-Npiphosphohistidine-sugar phosphotransferase Sugar-binding periplasmic protein P-YE3774-luxCDABEYE3773 0.98...”
  • “...encodes a sugar-binding periplasmic protein, and upstream of YE3774, which encodes a putative phosphotrehalase as part of a phosphotransferase system. This is...”
• Application of comparative phylogenomics to study the evolution of Yersinia enterocolitica and to identify genetic differences relating to pathogenicity
  Howard, Journal of bacteriology 2006
  • “...YE1222; xylose, YE2511 and YE4122; trehalose, YE3690, YE3773, YE3774, and YE3775. However, these CDSs were present in all test isolates; thus, if they are...”

LMON_0743 beta-glucoside-specific PTS transporter subunit IIABC from Listeria monocytogenes EGD
lmo0738 similar to phosphotransferase system (PTS) beta-glucoside-specific enzyme IIABC component from Listeria monocytogenes EGD-e
32% identity, 74% coverage

• Strand specific RNA-sequencing and membrane lipid profiling reveals growth phase-dependent cold stress response mechanisms in Listeria monocytogenes
  Hingston, PloS one 2017
  • “...-1.36 -1.52 -0.35 10.41 LMON_0742 Hypothetical protein + lmo0737 2 0.04 -0.98 -1.86 1.08 10.49 LMON_0743 PTS system, D-allose-specific + lmo0738 2 -0.61 -0.29 -0.59 1.52 9.56 LMON_0744 6-phospho-beta-glucosidase + lmo0739 2 -0.85 -0.15 -0.41 0.86 8.78 LMON_2673 PTS system, lactose/cellobiose specific IIB subunit lmo2650 2...”
• RECON gene disruption enhances host resistance to enable genome-wide evaluation of intracellular pathogen fitness during infection
  Stamm, mBio 2024
  • “...with 1 10 5 CFU of the indicated strains ( n = 3 for alsR lmo0738 and n = 5 for all other strains) and CFU were enumerated from livers at 72 hpi. Mean WT and alsR CFU were calculated from at least four independent experiments....”
  • “...( Fig. 4G ; Fig. S4J). In contrast, alsR lmo0736 , alsR lmo0737 , alsR lmo0738, and alsR lmo0739 CFU were similar to alsR CFU ( Fig. 4G ; Fig. S4K through N). In all, no single ALO gene deletion rescued the growth of alsR to...”
• Listeria monocytogenes GshF contributes to oxidative stress tolerance via regulation of the phosphoenolpyruvate-carbohydrate phosphotransferase system
  Chen, Microbiology spectrum 2023
  • “...3.13 Yes/down lmo0632 PTS fructose transporter subunit IIC lmo0633 lmo0633 PTS fructose transporter subunit IIB lmo0738 lmo0738 PTS beta-glucoside transporter subunit IIABC lmo0781 1.33 Yes/down lmo0781 PTS mannose transporter subunit IID lmo0782 3.54 Yes/down lmo0782 PTS mannose transporter subunit IIC lmo0783 1.43 Yes/down lmo0783 PTS mannose...”
• DegU-mediated suppression of carbohydrate uptake in Listeria monocytogenes increases adaptation to oxidative stress
  Chen, Applied and environmental microbiology 2023 (secret)
• New Insights into the Lactic Acid Resistance Determinants of Listeria monocytogenes Based on Transposon Sequencing and Transcriptome Sequencing Analyses
  Liu, Microbiology spectrum 2023
  • “...sorbitol transporter subunit IIBC 0.1233 5.02E-05 lmo0544 lmo0544 PTS sorbitol transporter subunit IIC 0.0485 9.23E-05 lmo0738 lmo0738 PTS beta-glucoside transporter subunit IIABC 0.0009 0.00E+00 lmo0781 lmo0781 PTS mannose transporter subunit IID 0.4964 3.58E-05 lmo0874 lmo0874 PTS sugar transporter subunit IIA 0.1111 3.00E-02 lmo0875 lmo0875 PTS beta-glucoside...”
• Horizontal Gene Transfer and Loss of Serotype-Specific Genes in Listeria monocytogenes Can Lead to Incorrect Serotype Designations with a Commonly-Employed Molecular Serotyping Scheme
  Brown, Microbiology spectrum 2023
  • “...Interestingly, the GC content of the cassette was heterogeneous, with some genes (e.g., lmo0737 , lmo0738 ) having GC values similar to the L. monocytogenes chromosomal average of approximately 38% ( 33 ), while the GC content of others (e.g., lmo0734 , lmo0735 ) was much...”
• YjbH mediates the oxidative stress response and infection by regulating SpxA1 and the phosphoenolpyruvate-carbohydrate phosphotransferase system (PTS) in Listeria monocytogenes
  Cheng, Gut microbes 2021
  • “...IIB Yes lmo0633 PTS fructose-specific enzyme IIB Yes lmo2799 PTS mannitol-specific enzyme IIBC 10.27 Yes lmo0738 PTS beta-glucoside-specific enzyme IIABC 9.85 Yes lmo2666 PTS galacticol-specific enzyme IIB 4.79 Yes lmo2650 PTS L-ascorbate-specific enzyme IIB 4.02 Yes lmo1255 PTS trehalose-specific enzyme IIBC 2.93 Yes lmo2002 PTS mannose-specific...”
• Identification and Characterization of als Genes Involved in D-Allose Metabolism in Lineage II Strain of Listeria monocytogenes
  Zhang, Frontiers in microbiology 2018
  • “...lmo0737 might be the equivalent to alsK , being responsible for phosphorylation for D-allose. Gene lmo0738 is annotated as encoding a PTS beta-glucoside transporter subunit IIABC in EGD-e, which has the same function as the products of alsA, B , and C , namely transferring D-allose...”
  • “...reported to be dispensable in D-allose metabolism in other bacteria. Nonetheless, absence of lmo0737 and lmo0738 decreased the growth rate in D-allose MWB medium. The requirement for lmo0734 to lmo0736 and the dispensability of lmo0738 to lmo0739 suggested that lmo0734 to lmo0736 are irreplaceable, while other...”
• A Comprehensive Evaluation of the Genetic Relatedness of Listeria monocytogenes Serotype 4b Variant Strains
  Burall, Frontiers in public health 2017
  • “...regulator (lmo0734), a putative ribulose-5-phosphate 3-epimerase (lmo0735), a putative ribose-5-phosphate isomerase (lmo0736), phosphotransferase system IIABC (lmo0738), and a glucosidase (lmo0739). The protein encoded by lmo0737 has no annotated function. Prior work generating a deletion of this region in EGD-e, a laboratory-adapted 1/2a strain, found no corresponding...”
  • “...4bV had serine in all but one strain, instead of a proline, at site 237. Lmo0738 had four amino acid substitutions: alanine to valine at amino acid 40, valine to isoleucine at 470, asparagine to serine at 483, and leucine to isoleucine at position 538. Lmo0738...”
• More

MS1237 PTS trehalose transporter subunit IIBC from [Mannheimia] succiniciproducens MBEL55E
MS1237 PtsG protein from Mannheimia succiniciproducens MBEL55E
31% identity, 94% coverage

• Mannheimia succiniciproducens phosphotransferase system for sucrose utilization
  Lee, Applied and environmental microbiology 2010
  • “...The genes, MS0784, MS0807, MS0909, MS1233, and MS1237, were knocked out from the chromosome of the wild-type M. succiniciproducens MBEL55E strain...”
  • “...succiniciproducens sucrose utilization system involves MS0784 or MS1237 for sucrose PTS, MS0909 for sucrose 6-phosphate hydrolase, and MS1233 for fructokinase...”

Cbei_2320 PTS system, trehalose-specific IIBC subunit from Clostridium beijerincki NCIMB 8052
33% identity, 96% coverage

• Transcriptomic characterization of recombinant <i>Clostridium beijerinckii</i> NCIMB 8052 expressing methylglyoxal synthase and glyoxal reductase from <i>Clostridium pasteurianum</i> ATCC 6013
  Kumar, Applied and environmental microbiology 2024
  • “...1.66 2.47E 84 Cbei_0337 srlE ABR32525.1 PTS system glucitol/sorbitol-specific transporter subunit IIBC 1.60 6.65E 48 Cbei_2320 treP ABR34480.1 PTS system trehalose-specific transporter subunit IIBC 1.28 1.86E 21 a , not applicable. Coenzyme metabolism The mRNAs of genes involved in de novo biosynthesis of NAD (via L-aspartate)...”

LBA0725 phosphotransferase system enzyme II from Lactobacillus acidophilus NCFM
34% identity, 68% coverage

• Microbial Unmasking of Plant Glycosides
  Biernat, mBio 2018
  • “...highly expressed upon exposure to all three plant glucosides and contained the phosphotransferase (PTS) transporter LBA0725 and the phospho--glucosidase (P-Bgl) LBA0726. A second gene locus containing a related but distinct PTS, LBA0227, and a second type of the P-Bgl, LBA0225, was upregulated following growth on amygdalin...”
• Lactobacillus acidophilus Metabolizes Dietary Plant Glucosides and Externalizes Their Bioactive Phytochemicals
  Theilmann, mBio 2017
  • “...b Log 2 ratio c Amy/Glc Esc/Glc Sal/Glc LBA0227 PTS EIIC G 9.9 0.8 0.9 LBA0725 PTS EIIABC G 9.7 9.8 8.9 LBA0726 Phospho--glucosidase (GH1) G 7.2 6.9 6.2 LBA1436 Glycerol uptake facilitator protein G 7.2 4.9 3.8 LBA0631 Hypothetical protein 7.2 2.9 2.9 LBA1435 Hypothetical...”
  • “...genes encode a LicT transcriptional antiterminator (LBA0724), an EIIABC component of a phosphotransferase system (PTS; LBA0725), a phospho--glucosidase (P-Bgl; LBA0726) of glycoside hydrolase family 1 (GH1) according to the CAZy database ( 34 ), and a hypothetical protein (LBA0728) ( Fig.2A ). These genes, except for...”
• The Differential Proteome of the Probiotic Lactobacillus acidophilus NCFM Grown on the Potential Prebiotic Cellobiose Shows Upregulation of Two β -Glycoside Hydrolases
  van, BioMed research international 2015
  • “...1 , spots 16 and 18) encoded in a gene cluster together with another PTS (LBA0725; Figure 3 ) indicating a role in cellobiose utilization ( Figure 3 ). This PTS LBA0725 has been reported to have 62% amino acid sequence identity to a PTS (ORF...”
• Transcriptional analysis of prebiotic uptake and catabolism by Lactobacillus acidophilus NCFM
  Andersen, PloS one 2012
  • “...including -1,4 or -1,6 glucoside specific PTS permeases, showed a clear segregation of LBA0227 and LBA0725, the latter clustering with a functionally characterized cellobiose PTS permease from L. gasseri ATCC 33323 [34] , consistent with the observed upregulation of LBA0725 on cellobiose. Notably, the PTS permease...”
  • “...domains LBA0879 and LBA0884 were also upregulated by cellobiose, albeit at a lower level than LBA0725. These two proteins clustered distantly on the phylogenetic tree, indicating functional divergence and a likely preference for structurally-related substrates such as sophorose (- d -Glc p -(12)- d -Glc p...”

BSQ49_09740 beta-glucoside-specific PTS transporter subunit IIABC from Liquorilactobacillus hordei
33% identity, 73% coverage

• Living the Sweet Life: How Liquorilactobacillus hordei TMW 1.1822 Changes Its Behavior in the Presence of Sucrose in Comparison to Glucose
  Bechtner, Foods (Basel, Switzerland) 2020
  • “...fig|468911.3.peg.1810; fig|468911.3.peg.1910 BSQ49_09735; BSQ49_09265 29 0.41 4.17 PTS system, beta-glucoside specific IIABC components Carbohydrates fig|468911.3.peg.1911 BSQ49_09740 30 0.49 2.41 Transcriptional antiterminator BglB Carbohydrates fig|468911.3.peg.1912 BSQ49_09745 31 0.40 3.87 Transcriptional regulator (LacI family) fig|468911.3.peg.1949 BSQ49_09920 32 1.12 3.98 MFS transporter, sucrose-specific fig|468911.3.peg.1950 BSQ49_09925 33 0.46 6.18 Glucohydrolase...”

YPO3697 trehalose(maltose)-specific PTS system components IIBC from Yersinia pestis CO92
33% identity, 96% coverage

• Growth of Yersinia pseudotuberculosis in human plasma: impacts on virulence and metabolic gene expression
  Rosso, BMC microbiology 2008
  • “...YPO0577 ExuT transport protein 1.866 (0.001) YPTB3495 YPO3550 probable phosphosugar isomerase 0.736 (0.042) YPTB3536 (treB) YPO3697 PTS system. trehalose-specific IIBC component 0.34 (< 0.001) 1.832 (0.015) YPTB3537 (treC) YPO3696 putative trehalose-6-phosphate hydrolase 0.279 (< 0.001) YPTB3609 YPO3620 putative carbohydrate transport protein 1.459 (0.02) YPTB3642 (lamB) YPO3711...”

YPK_0495 PTS system, trehalose-specific IIBC subunit from Yersinia pseudotuberculosis YPIII
YPTB3536 PTS system, trehalose-specific IIBC component from Yersinia pseudotuberculosis IP 32953
32% identity, 96% coverage

• Genome-Scale Mapping Reveals Complex Regulatory Activities of RpoN in Yersinia pseudotuberculosis
  Mahmud, mSystems 2020
  • “...38,54,32 YPK_0280 YPK_0289 44, 132 IrGAs3 549836 4.7 3.3 NA TTGGTCCAGTAATTGCTG + 9.9 54,32,38 YPK_0496 YPK_0495 15, 164 IrGAs4 630656 3.3 2.6 NA ACGGCTCAATTGTTGCAT 9.97 24,54,32,28 YPK_0712 YPK_0713, YPK_0714 19, 20, 140 IrGAs5 1053922 3.6 NA NA CAGGCACGATACGTGCAT + 10.1 54,24,38 YPK_0933 168, 172 IrGAs6 1099750...”
• Growth of Yersinia pseudotuberculosis in human plasma: impacts on virulence and metabolic gene expression
  Rosso, BMC microbiology 2008
  • “...YPTB3479 (exuT) YPO0577 ExuT transport protein 1.866 (0.001) YPTB3495 YPO3550 probable phosphosugar isomerase 0.736 (0.042) YPTB3536 (treB) YPO3697 PTS system. trehalose-specific IIBC component 0.34 (< 0.001) 1.832 (0.015) YPTB3537 (treC) YPO3696 putative trehalose-6-phosphate hydrolase 0.279 (< 0.001) YPTB3609 YPO3620 putative carbohydrate transport protein 1.459 (0.02) YPTB3642...”

LEUM_0901 Trehalose PTS trehalose component IIBC from Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
35% identity, 64% coverage

• Genome-scale modeling and transcriptome analysis of Leuconostoc mesenteroides unravel the redox governed metabolic states in obligate heterofermentative lactic acid bacteria
  Koduru, Scientific reports 2017
  • “...However, the presence of putative genes encoding glucose-PTS components in L. mesenteroides (LEUM_0507, LEUM_0508 and LEUM_0901) as annotated in TransportDB database 35 allowed us to analyze the possible cellular phenotype of L. mesenteroides growing on glucose with and without a glucose-PTS transporter. Accordingly, we tested three...”

OG1RF_11317 sucrose-specific PTS transporter subunit IIBC from Enterococcus faecalis OG1RF
33% identity, 69% coverage

• Comparative Biofilm Assays Using Enterococcus faecalis OG1RF Identify New Determinants of Biofilm Formation
  Willett, mBio 2021
  • “...1 1345158 OG1RF_11288 Transcriptional regulator 3.44E03 1.04 1 1372168 OG1RF_11314 Catalase 1.42E06 1.32 1 1376818 OG1RF_11317 PTS family beta-glucosides porter, IIABC component 7.96E03 1.42 1 1383159 OG1RF_11322 Beta-glucosidase 4.06E02 1.39 1 1403263 OG1RF_11340 Acetaldehyde dehydrogenase 1.87E74 2.96 1 2.17E42 1.79 1 1407029 OG1RF_11344 Ethanolamine ammonia-lyase large...”

EF2598 PTS system, beta-glucoside-specific IIABC component from Enterococcus faecalis V583
Q831B4 PTS system, beta-glucoside-specific IIABC component from Enterococcus faecalis (strain ATCC 700802 / V583)
34% identity, 72% coverage

• Genomic Landscape of Multidrug Resistance and Virulence in Enterococcus faecalis IRMC827A from a Long-Term Patient
  Borgio, Biology 2023
  • “...29375870 c EF1302 Transcriptional regulator 100 100 99 1 10 167 28 Victors 29377084 c EF2598 PTS system, beta-glucoside-specific IIB component/PTS system, beta-glucoside-specific IIC component/PTS system, beta-glucoside-specific IIA component 100 100 99 0.0 29 Victors 29377078 c EF2591 Glyoxalase family protein 100 97 100 1 10...”
• Functional studies of E. faecalis RNase J2 and its role in virulence and fitness
  Gao, PloS one 2017
  • “...protein 2.56 0.013 ef2162 tRNA transferase 3.85 0.022 ef2597 glycosyl hydrolase, family 1 3.33 0.025 ef2598 PTS system component 3.57 0.048 ef2599 transcription antiterminator, BglG family 2.56 0.044 ef2601 conserved hypothetical protein 2.44 0.013 a EF numbers and the encoded protein are from the V583 genome...”
• Gliotoxin-mediated bacterial growth inhibition is caused by specific metal ion depletion
  Downes, Scientific reports 2023
  • “...ligase Unique N/A 3 13.3 Q830C2 PTS system, beta-glucoside-specific IIABC component Unique N/A 3 6.9 Q831B4 Uncharacterized protein Unique N/A 2 55.9 Q834Y7 Histidine kinase Unique N/A 3 9.7 Q837B6 Abhydrolase_3 domain-containing protein Unique N/A 3 14.3 Q838Q5 Glyoxylase family protein* Unique N/A 3 11.2 Q834I3...”
  • “...3 Absent N/A 2 26.5 P59628 PTS system, beta-glucoside-specific IIABC component Absent N/A 5 15.2 Q831B4 6-aminohexanoate-cyclic-dimer hydrolase, putative Absent N/A 10 19.1 Q836S5 Prephenate dehydrogenase Absent N/A 7 23.4 H7C6X1 Mga domain-containing protein Absent N/A 6 15.6 Q82ZN7 Protease synthase and sporulation negative regulatory protein...”

EMQU_2186 beta-glucoside-specific PTS transporter subunit IIABC from Enterococcus mundtii QU 25
32% identity, 63% coverage

• Transcriptome profile of carbon catabolite repression in an efficient l-(+)-lactic acid-producing bacterium Enterococcus mundtii QU25 grown in media with combinations of cellobiose, xylose, and glucose
  Shiwa, PloS one 2020
  • “...in S3 Table . Cellobiose induced genes for five putative PTS genes/clusters (EMQU_03070309, EMQU_08750877, EMQU_1036, EMQU_2186, and EMQU_2681). In addition, the genes for three glycoside hydrolase family 1 proteins (EMQU_0608, EMQU_1037, and EMQU_2185), which were annotated as 6-phospho-beta-glucosidase in KEGG, were significantly upregulated in the cellobiose...”

BCAL_RS06200 PTS system trehalose-specific EIIBC component from Bifidobacterium callitrichos DSM 23973
33% identity, 67% coverage

• The comparative genomics of Bifidobacterium callitrichos reflects dietary carbohydrate utilization within the common marmoset gut
  Albert, Microbial genomics 2018
  • “...BCAL_RS02285 Starch and sucrose metabolism ,-Phosphotrehalase 3.2.1.93 COO72_RS08005 CPA40_RS06370 BCAL_RS06195 Protein-N-phosphohistidinetrehalose phosphotransferase 2.7.1.201 COO72_RS08010 CPA40_RS06365 BCAL_RS06200 -Fructofuranosidase 3.2.1.26 COO72_RS02000 CPA40_RS06035 BCAL_RS10725 -Glucosidase 3.2.1.20 COO72_RS09510 CPA40_RS01270 BCAL_RS0830 Amylosucrase 2.4.1.4 COO72_RS05900 CPA40_RS04855 BCAL_RS04290 Sucrose phosphorylase 2.4.1.7 COO72_RS10000 CPA40_RS07310 BCAL_RS06670 UTPglucose-1-phosphate uridylyltransferase 2.7.7.9 COO72_RS10475 CPA40_RS09980 BCAL_RS08755 -Amylase 3.2.1.1 COO72_RS11340...”

SPy_0572 beta-glucoside permease IIABC component from Streptococcus pyogenes M1 GAS
33% identity, 65% coverage

• Superantigen SpeA attenuates the biofilm forming capacity of Streptococcus pyogenes
  Babbar, Journal of microbiology (Seoul, Korea) 2019 (PubMed)
  • “...(ciaRH) and response genes (luxS, shr, shp, SPy_0572), hinting towards specific mechanisms underlying the dispersal effect by SpeA. This finding opens...”
  • “...metabolism -Glucoside permease IIABC PROKKA_00585 SPy_0572 COG1263 Carbohydrate transport and metabolism component PROKKA_00568 Phosphoglycerate mutase SPy_0598...”

AOT13_11075 PTS transporter subunit EIIC from Parageobacillus thermoglucosidasius
33% identity, 99% coverage

• Functional characterization of the phosphotransferase system in Parageobacillus thermoglucosidasius
  Bidart, Scientific reports 2023
  • “...described above (see Supplementary Figs. 1 15 ). Cultures of the six knockout strains (AOT13_10525-10530; AOT13_11075; AO13_12555; AO13_15110; AO13_15920 and AO13_18760-18770) had no noticeable growth (or deficient growth in the case of AOT13_11075) when supplementing with a specific carbohydrate suggesting a direct relationship between the knocked-out...”

Ent638_2740 beta-glucoside-specific PTS system components IIABC from Enterobacter sp. 638
33% identity, 66% coverage

• Fate of the H-NS-repressed bgl operon in evolution of Escherichia coli
  Sankar, PLoS genetics 2009
  • “...For Enterobacter : Ent638_2738 RND efflux system, outer membrane lipoprotein, Ent638_2739 glycoside hydrolase, family 1, Ent638_2740 PTS system, -glucoside-specific IIABC, Ent638_2741 transcriptional antiterminator, BglG, and Ent638_2742 dihydrouridine synthase, DuS. For Erwinia ECA1868 hypothetical protein, arbG -glucoside operon antiterminator (ECA1869), arbF -glucoside-specific PTS system components IIABC (ECA1870),...”

ECA1870 PTS system, beta-glucoside-specific IIABC component from Erwinia carotovora subsp. atroseptica SCRI1043
33% identity, 71% coverage

• Fate of the H-NS-repressed bgl operon in evolution of Escherichia coli
  Sankar, PLoS genetics 2009
  • “...Erwinia ECA1868 hypothetical protein, arbG -glucoside operon antiterminator (ECA1869), arbF -glucoside-specific PTS system components IIABC (ECA1870), arbB 6-phospho-,D-glucosidase (ECA1871), ECA1872 putative porin, ECA1873 putative glycosyl hydrolase exoenzyme, and ECA1874 putative inosine-uridine preferring nucleoside hydrolase. In contrast to the bgl operon genes, no orthologs for genes yieI...”

TC 4.A.1.2.14 / ART98499 PTS beta-glucoside transporter, EIIBCA of 672 aas and 12 predicted TMSs from Lactobacillus gasseri
31% identity, 67% coverage

• substrates: beta-glucosides

CD0816 PTS system, IIABC component from Clostridium difficile 630
33% identity, 72% coverage

• Functional genomics reveals that Clostridium difficile Spo0A coordinates sporulation, virulence and metabolism
  Pettit, BMC genomics 2014
  • “...changed to functioning genes based on their presence in the experimental dataset. 2 of these (CD0816 and CD1718) are interrupted by IStrons. The ability of the IStron to be excised from the mRNA transcript and not interfere with gene functionality [ 38 , 39 ] is...”

LM6179_0306, LMRG_RS00135 beta-glucoside-specific PTS transporter subunit IIABC from Listeria monocytogenes 10403S
lmo0027 similar to PTS system, beta-glucosides specific enzyme IIABC from Listeria monocytogenes EGD-e
LMOf6854_0030 PTS system, beta-glucoside-specific, IIABC component from Listeria monocytogenes str. 1/2a F6854
LMRG_02456 PTS system, beta-glucoside-specific, IIABC component from Listeria monocytogenes 10403S
LMOf2365_0030 PTS system, beta-glucoside-specific, IIABC component from Listeria monocytogenes str. 4b F2365
34% identity, 62% coverage

• Genome-wide identification of Listeria monocytogenes CodY-binding sites
  Biswas, Molecular microbiology 2020
  • “...124 3 UPSTREAM 156.7 yes 12. LMRG_RS08950,LMRG_RS08945 purC,purS 647 78 8 INTERNAL,UPSTREAM 140.0 yes 13. LMRG_RS00135 110 6 INTERNAL 116.8 yes 14. LMRG_RS02565/LMRG_RS02570 176 186 ND UPSTREAM/UPSTREAM 115.1 no 14. LMRG_RS02565/LMRG_RS02570 276 91 16 UPSTREAM/UPSTREAM 115.1 yes 14. LMRG_RS02570 86 17 INTERNAL 115.1 no 15. LMRG_RS02730...”
• Transcriptome analysis of Listeria monocytogenes exposed to biocide stress reveals a multi-system response involving cell wall synthesis, sugar uptake, and motility
  Casey, Frontiers in microbiology 2014
  • “...phosphotransferase system (PTS) (HPr protein) 4.33 LM6179_1334 ptsG Putative PTS system, glucose-specific, IIA component 11.72 LM6179_0306 bglP PTS system beta-glucoside-specific EIIBCA component 27.79 LM6179_0618 bglH aryl-phospho-beta-d-glucosidase 11.11 LM6179_2766 LM6179_2766 PTS system protein 69.14 LM6179_2769 LM6179_2769 PTS system mannose/fructose/sorbose family IID subunit 66.88 LM6179_2770 LM6179_2770 PTS system...”
• DegU-mediated suppression of carbohydrate uptake in Listeria monocytogenes increases adaptation to oxidative stress
  Chen, Applied and environmental microbiology 2023 (secret)
• Listeria monocytogenes GshF contributes to oxidative stress tolerance via regulation of the phosphoenolpyruvate-carbohydrate phosphotransferase system
  Chen, Microbiology spectrum 2023
  • “...lmo0023 PTS fructose transporter subunit IIC lmo0024 8.35 Yes/down lmo0024 PTS mannose transporter subunit IID lmo0027 6.99 Yes/down lmo0027 PTS beta-glucoside transporter subunit IIABC lmo0034 2.34 Yes/down lmo0034 PTS cellbiose transporter subunit IIC lmo0096 2.26 Yes/down lmo0096 PTS mannose transporter subunit IIAB lmo0097 3.61 Yes/down lmo0097...”
• New Insights into the Lactic Acid Resistance Determinants of Listeria monocytogenes Based on Transposon Sequencing and Transcriptome Sequencing Analyses
  Liu, Microbiology spectrum 2023
  • “...fructose transporter subunit IIA 0.2244 2.05E-07 lmo0023 lmo0023 PTS fructose transporter subunit IIC 0.0331 6.73E-13 lmo0027 lmo0027 PTS beta-glucoside transporter subunit IIABC 0.0224 9.12E-287 lmo0034 lmo0034 PTS cellobiose transporter subunit IIC 0.2085 2.15E-05 lmo0298 lmo0298 PTS beta-glucoside transporter subunit IIC 0.0113 2.36E-40 lmo0299 lmo0299 PTS beta-glucoside...”
• Roles of Alternative Sigma Factors in Invasion and Growth Characteristics of Listeria monocytogenes 10403S Into Human Epithelial Colorectal Adenocarcinoma Caco-2 Cell
  Rukit, Frontiers in microbiology 2022
  • “...L. monocytogenes during infection. Among intracellularly upregulated genes in sigL strain, glucose utilization genes (e.g., lmo0027 encoding a PTS beta-glucoside transporter subunit EIIBCA, lmo2668-65 operon encoding galactitol PTS) were identified. Congruently, these genes were previously identified as negatively regulated by SigL ( Chaturongakul et al., 2011...”
• Proteomic Analysis of Listeria monocytogenes FBUNT During Biofilm Formation at 10°C in Response to Lactocin AL705
  Melian, Frontiers in microbiology 2021
  • “...caused by bacteriocin interacting with the cytoplasmic membrane. Notably, transport systems such as -glucosidase IIABC (lmo0027), cellobiose (lmo2763), and trehalose (lmo1255) specific PTS proteins were highly overexpressed. In addition, mannose (lmo0098), a specific PTS protein indicating the adaptive response of sessile cells to the bacteriocin, was...”
  • “...up-regulated by bacteriocin-treated sessile cells when compared to untreated biofilm. PTS beta-glucoside transporter subunit IIABC (Lmo0027; FC: 123.9) showed a remarkably high expression, whereas other proteins, such as PTS cellobiose transporter subunit IIC (Lmo2763), subunit IIB (Lmo2762), and subunit IIA (Lmo2765), PTS trehalose transporter subunit IIBC...”
• YjbH mediates the oxidative stress response and infection by regulating SpxA1 and the phosphoenolpyruvate-carbohydrate phosphotransferase system (PTS) in Listeria monocytogenes
  Cheng, Gut microbes 2021
  • “...Yes lmo1255 PTS trehalose-specific enzyme IIBC 2.93 Yes lmo2002 PTS mannose-specific enzyme IIB 2.72 Yes lmo0027 PTS beta-glucosides specific enzyme IIABC 2.55 Yes lmo0022 PTS fructose-specific enzyme IIB 2.24 Yes lmo2685 PTS cellbiose-specific enzyme IIB 2.16 Yes lmo2683 PTS cellbiose-specific enzyme IIB 2.09 Yes lmo2733 PTS...”
• The Combined Effect of Cold and Copper Stresses on the Proliferation and Transcriptional Response of Listeria monocytogenes
  Quesille-Villalobos, Frontiers in microbiology 2019
  • “...= 20; COG class G) such as genes that encode the phosphotransferase system (PTS; genes lmo0027, lmo0298, lmo0299, lmo1997, lmo2000, lmo2001, lmo2124, lmo2125, lmo2665, lmo2666 and lmo2708) ( Figure 2B and Supplementary Table S2 ). The effect of copper over the carbohydrate metabolism has been described...”
• Interaction with enzyme IIBMpo (EIIBMpo) and phosphorylation by phosphorylated EIIBMpo exert antagonistic effects on the transcriptional activator ManR of Listeria monocytogenes
  Zébré, Journal of bacteriology 2015
  • “...permease of the glucose class, which is encoded by lmo0027. However, the glucose transport activities of these transporters can be detected only in mutants that...”
• More
• Physiological and transcriptional characterization of persistent and nonpersistent Listeria monocytogenes isolates
  Fox, Applied and environmental microbiology 2011
  • “...LMOf6854_2061 LMOf6854_0111 LMOf6854_2394 LMOf6854_1066 LMOf6854_2799 LMOf6854_0030 LMOf6854_2784 LMOf6854_2062 manL treB ptsH ptsI LMOf6854_0827 Downregulated...”
• Listeria monocytogenes σ^A Is Sufficient to Survive Gallbladder Bile Exposure
  Boonmee, Frontiers in microbiology 2019
  • “...part of an operon that includes genes encoding a PTS fructose transporter subunit and alpha-mannosidase. LMRG_02456 and LMRG_02567 encode PTS system beta-glucoside-specific components. LMRG_01933 encodes PTS system cellobiose-specific IIB component. LMRG_01669-LMRG_01673 is an operon encoding genes involved in myo-inositol degradation and LMRG_01535 is a phage capsid...”
• Transcriptomics of Listeria monocytogenes Treated With Olive Leaf Extract
  Liu, Frontiers in microbiology 2021
  • “...period (Log 2 FC=5.71, 1.36, 1.47, and 1.13, respectively). At 24h post-treatment, 9 PTS-related genes (LMOf2365_0030, LMOf2365_0113, LMOf2365_0572, LMOf2365_0922, LMOf2365_1272, LMOf2365_2128, LMOf2365_2129, LMOf2365_2130, and LMOf2365_2292) were found to be differentially regulated; 7 of which were found to be downregulated in the presence of OLE while LMOf2365_2129...”

SAK_0915 PTS system, beta-glucoside-specific IIABC component from Streptococcus agalactiae A909
33% identity, 64% coverage

• The Role of Regulator Catabolite Control Protein A (CcpA) in Streptococcus agalactiae Physiology and Stress Response
  Roux, Microbiology spectrum 2022
  • “...PTS system, IID component, mannose/fructose/sorbose family; SAK_0528-0530 , galactitol PTS, IIA, IIC, and IIB subunits; SAK_0915 , PTS system, -glucoside-specific IIABC component; SAK_1377 , PTS system, fructose-specific IIABC component; SAK_1702 , PTS system, sucrose-specific IIABC component; SAK_1893-1895 , PTS system, glucose-specific IIABC component; SAK_1908-1911 , mannose/fructose/sorbose...”
• The sensor histidine kinase RgfC affects group B streptococcal virulence factor expression independent of its response regulator RgfA
  Gendrin, Infection and immunity 2015
  • “...SAK_0399, SAK_1909, SAK_0398, SAK_0400, SAK_0523, SAK_ 0529, SAK_0915, SAK_0530, SAK_0257, and SAK_1920). Increased expression of such genes may facilitate GBS...”

LPL9_RS10760 PTS beta-glucoside transporter subunit IIBCA from Lacticaseibacillus paracasei
33% identity, 68% coverage

• bglG Regulates the Heterogeneity Driven by the Acid Tolerance Response in Lacticaseibacillus paracasei L9
  Shen, Foods (Basel, Switzerland) 2023
  • “...gene expression among subpopulations. A total of 17 genes were significantly changed in acid-derived subpopulations. LPL9_RS10760 (PTS beta-glucoside transporter subunit IIBCA), LPL9_RS14735 (BglG family transcriptional antiterminator), and LPL9_RS00305 (ABC transporter permease) were all related to glucoside metabolism and upregulated in the viable subpopulation. These results all...”
  • “...(FCM-I/Non-Acid) Annotated Function 1 gene2198 LPL9_RS10370 2.0377 1.0162 Amino acid ABC transporter permease 2 gene2284 LPL9_RS10760 1.6958 1.3129 PTS beta-glucoside transporter subunit IIBCA 3 gene807 LPL9_RS03780 1.275 1.0363 Ironsulfur cluster biosynthesis family protein 4 gene66 LPL9_RS00305 1.2064 1.0832 ABC transporter permease 5 gene3139 LPL9_RS14735 1.0483 1.1387...”

abgF / AAC05713.1 PTS-dependent enzyme II from Clostridium longisporum (see paper)
32% identity, 74% coverage

LMOf2365_2762 PTS system, beta-glucoside-specific, IIABC component from Listeria monocytogenes str. 4b F2365
33% identity, 73% coverage

• Transcriptomics of Listeria monocytogenes Treated With Olive Leaf Extract
  Liu, Frontiers in microbiology 2021
  • “...the phosphotransferase transport system (PTS), with the expression of 4 genes (LMOf2365_2305, LMOf2365_2664, LMOf2365_2665, and LMOf2365_2762), being differentially regulated at the 3.5-h treatment period (Log 2 FC=5.71, 1.36, 1.47, and 1.13, respectively). At 24h post-treatment, 9 PTS-related genes (LMOf2365_0030, LMOf2365_0113, LMOf2365_0572, LMOf2365_0922, LMOf2365_1272, LMOf2365_2128, LMOf2365_2129, LMOf2365_2130,...”

B9H01_RS09285 PTS transporter subunit EIIC from Streptococcus suis
34% identity, 92% coverage

• Orphan response regulator CovR plays positive regulative functions in the survivability and pathogenicity of Streptococcus suis serotype 2 isolated from a pig
  Zhang, BMC veterinary research 2023
  • “...B9H01_RS01165 B9H01_RS01165 K02761 celB 0.749690724 B9H01_RS04040 B9H01_RS04040 K02770 fruA 0.819677837 B9H01_RS08580 B9H01_RS08580 K02796 manZ 0.832418165 B9H01_RS09285 B9H01_RS09285 K02810 scrA 0.800577967 The GO analysis of differentially expressed genes was used to annotate the 117 up-regulated genes. Translation, amino acid transport, cell division and DNA recombination were annotated...”

lmo2772 similar to beta-glucoside-specific enzyme IIABC from Listeria monocytogenes EGD-e
33% identity, 73% coverage

• DegU-mediated suppression of carbohydrate uptake in Listeria monocytogenes increases adaptation to oxidative stress
  Chen, Applied and environmental microbiology 2023 (secret)
• Listeria monocytogenes GshF contributes to oxidative stress tolerance via regulation of the phosphoenolpyruvate-carbohydrate phosphotransferase system
  Chen, Microbiology spectrum 2023
  • “...lmo2763 PTS cellbiose transporter subunit IIC lmo2765 2.78 Yes/down lmo2765 PTS cellbiose transporter subunit IIA lmo2772 3.43 lmo2772 PTS beta-glucoside transporter subunit IIABC lmo2780 lmo2780 PTS cellbiose transporter subunit IIA lmo2782 4.30 Yes/down lmo2782 PTS cellbiose transporter subunit IIB lmo2783 3.66 Yes/down lmo2783 PTS cellbiose transporter...”
• New Insights into the Lactic Acid Resistance Determinants of Listeria monocytogenes Based on Transposon Sequencing and Transcriptome Sequencing Analyses
  Liu, Microbiology spectrum 2023
  • “...cellobiose transporter subunit IIC 0.1640 1.13E-16 lmo2765 lmo2765 PTS cellobiose transporter subunit IIA 0.3373 4.58E-02 lmo2772 lmo2772 PTS beta-glucoside transporter subunit IIABC 0.0834 1.54E-13 lmo2782 lmo2782 PTS cellobiose transporter subunit IIB 0.1655 4.48E-02 lmo2787 bvrB beta-Glucoside-specific phosphotransferase enzyme II ABC component 0.2198 3.85E-04 lmo2797 lmo2797 PTS...”
• The Global Regulator CcpA of Listeria monocytogenes Confers Sensitivity to Antimicrobial Fatty Acids
  Thomasen, Frontiers in microbiology 2022
  • “...792bp in lmo0517 ( lmo0517 ); 744bp in lmo2175 ( lmo2175 ); and 1830bp in lmo2772 ( lmo2772 ), the corresponding primers P1, P2, P3 and P4 ( Supplementary Table S7 ) were used, respectively, for a 2-step PCR amplification of the fragments. CcpA complementation mutant...”
  • “...the three most upregulated genes, chosen for mutational analysis, encode a PTS system component ( lmo2772 ) and a hypothetical protein ( lmo0517 ), respectively. Strikingly, these genes were upregulated more than 100-fold in the absence of CcpA ( Supplementary Table S6 ). When going through...”
• YjbH mediates the oxidative stress response and infection by regulating SpxA1 and the phosphoenolpyruvate-carbohydrate phosphotransferase system (PTS) in Listeria monocytogenes
  Cheng, Gut microbes 2021
  • “...Yes lmo0914 PTS cellbiose-specific enzyme IIB 1.79 Yes lmo2373 PTS beta-glucoside-specific enzyme IIB 1.65 Yes lmo2772 PTS glucose/sucrose-specific enzyme IIB 1.52 Yes lmo1035 PTS beta-glucoside-specific enzyme IIABC 1.42 Yes EIIC lmo2763 PTS cellbiose-specific enzyme IIC 8.80 Yes lmo0298 PTS beta-glucoside-specific enzyme IIC 5.62 Yes lmo2096 PTS...”
• Probing the pan-genome of Listeria monocytogenes: new insights into intraspecific niche expansion and genomic diversification
  Deng, BMC genomics 2010
  • “...+ 494 lmo2736 Hypothetical protein IIIA + 494 lmo2771 Similar to beta-glucosidase IIIA + - lmo2772 Similar to PTS system, beta-glucoside-specific enzyme IIABC IIIA + - lmo2847 Similar to rhamnulose-1-phosphate aldolase IIIA + 516 lmo2848 Similar to L-rhamnose isomerase IIIA + 516 lmo2849 Similar to rhamnulokinase...”

F9UUH8 PTS system, beta-glucosides-specific EIIBCA component from Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
lp_3513 beta-glucosides PTS, EIIBCA from Lactobacillus plantarum WCFS1
32% identity, 70% coverage

• Identification of key proteins and pathways in cadmium tolerance of Lactobacillus plantarum strains by proteomic analysis.
  Zhai, Scientific reports 2017
  • “...pts20A; PTS system, cellobiose-specific EIIA component 2.47 F9URP9 pts20B; PTS system, cellobiose-specific EIIB component 2.99 F9UUH8 pts30BCA; PTS system, beta-glucosidespecific EIIBCA component 1.71 F9UUK9 pts35B; PTS system, galactitol-specific EIIB component 2.50 F9ULA5 pts35A; PTS system, galactitol-specific EIIA component 1.54 F9UUH6 lp_3510; PTS-associated protein 1.80 Amino acid...”
• Oleuropein Transcriptionally Primes Lactobacillus plantarum to Interact With Plant Hosts
  Santamaría, Frontiers in microbiology 2019
  • “...in the transport of presently not known -glucosides ( pts15A or lp_1398 , pts30BCA or lp_3513 ) and PTS systems for the transport of N -acetyl-glucosamine (GlcNAc) ( pts18CBA or lp_2531 ), N -acetyl-galactosamine (GalNAc) ( pts19B or lp_2650 ) and GlcNAc/GalNAc ( pts19A or lp_2647...”

CDR20291_2971 PTS transporter subunit EIIC from Clostridioides difficile R20291
CDR20291_2971 PTS system, IIabc component from Clostridium difficile R20291
31% identity, 97% coverage

• One size does not fit all - Trehalose metabolism by Clostridioides difficile is variable across the five phylogenetic lineages
  Marshall, Microbial genomics 2023
  • “...52 ]. Amongst these, treA and four genes located within the same genetic locus ( CDR20291_2971 , pgmB , CDR20291_2973 , and ascB ) showed the highest upregulated fold-change (5.07 to 5.82 log 2 change). Fig. 7. RNA-seq reveals an unidentified putative trehalose metabolism pathway. (...”
  • “...represent the highest upregulated genes in the dataset consisting of the putative trehalose metabolism genes, CDR20291_2971 , pgmB , CDR20291_2973 and ascB3 and the treA gene. ( b ) Genomic organisation of the Lactococcus lactis trehalose metabolism genes and C. difficile R20291 putative trehalose metabolism genes....”

BglS / b3722 β-glucoside specific PTS enzyme II / BglG kinase / BglG phosphatase (EC 2.7.1.199) from Escherichia coli K-12 substr. MG1655 (see paper)
bglF / P08722 β-glucoside specific PTS enzyme II / BglG kinase / BglG phosphatase (EC 2.7.1.199) from Escherichia coli (strain K12) (see 59 papers)
TC 4.A.1.2.2 / P08722 β-Glucoside (salicin, arbutin, cellobiose, etc) group translocator, BglF from Escherichia coli (see 6 papers)
NP_418178 beta-glucoside specific PTS enzyme II/BglG kinase/BglG phosphatase from Escherichia coli str. K-12 substr. MG1655
b3722 fused beta-glucoside-specific PTS enzymes: IIA component/IIB component/IIC component from Escherichia coli str. K-12 substr. MG1655
31% identity, 70% coverage

• substrates: beta-glucosides
  tcdb comment: The bgl operon, encoding BglF, is regulated by antitermination when the RNA antiterminator protein, BglG, binds to one of two RAT sites in the mRNA (Gordon et al. 2015)
• Spatial arrangement of the beta-glucoside transporter from Escherichia coli.
  Yagur-Kroll, Journal of bacteriology 2009
  • GeneRIF: The results demonstrate that the big cytoplasmic loop participates in creating the sugar pathway and explain the observed coupling between translocation of phosphotransferase system sugars from the periplasm to the cytoplasm and their phosphorylation.
• Genetic dissection of the divergent activities of the multifunctional membrane sensor BglF.
  Monderer-Rothkoff, Journal of bacteriology 2007
  • GeneRIF: This study identified distinct sites in BglF that are involved in regulating phosphate flow via the common active-site residue in response to environmental cues.
• Dynamic membrane topology of the Escherichia coli beta-glucoside transporter BglF.
  Yagur-Kroll, The Journal of biological chemistry 2005 (PubMed)
  • GeneRIF: analysis of the Escherichia coli beta-glucoside transporter BglF membrane topology
• Genetic dissection of the divergent activities of the multifunctional membrane sensor BglF
  Monderer-Rothkoff, Journal of bacteriology 2007 (secret)
• The bvr locus of Listeria monocytogenes mediates virulence gene repression by beta-glucosides
  Brehm, Journal of bacteriology 1999
  • “...PTS permease components (accession numbers: ArbF, P26207; BglF, P08722; and BglP, P40739; identities with BvrB: 37, 34, and 32%, respectively). The positions of...”
• Reconfiguring the quorum-sensing regulator SdiA of Escherichia coli to control biofilm formation via indole and N-acylhomoserine lactones
  Lee, Applied and environmental microbiology 2009
  • “...b3311 b3426 b3447 b3453 b1488 b3540 b3541 b3542 b3588 b3704 b3722 b4051 b4067 b4069 b4119 b4149 b4187 b4227 b1197 b4239 b4240 5.3 6.1 8.0 4.0 8.6 12.1 8.0 13.9...”
• Protein disorder is positively correlated with gene expression in Escherichia coli
  Paliy, Journal of proteome research 2008
  • “...(b3255); L) RpoZ (b3649); M) AtpC (b3731); N) AtpD (b3722); O) AtpF (b3736); P) NusG (b3982); Q) GroES (b4142); R) GroEL (b4143). J Proteome Res. Author...”
• Differential gene expression for investigation of Escherichia coli biofilm inhibition by plant extract ursolic acid
  Ren, Applied and environmental microbiology 2005
  • “...1.6 0.0074 1.4 0.0170 1.5 0.0004 b1312 bglF fhuD b1312 b3722 b0152 1.0 1.0000 1.4 0.0546 1.1 0.8560 1.6 0.0319 1.6 0.0053 1.6 0.0032 nikE yhaO yhjX b3480 b3110...”

lp_0264 glucose PTS transporter subunit IIA from Lactiplantibacillus plantarum WCFS1
F9UT61 PTS system, trehalose-specific IIBC component from Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
lp_0264 beta-glucosides PTS, EIIABC from Lactobacillus plantarum WCFS1
33% identity, 60% coverage

• Butanol Tolerance of Lactiplantibacillus plantarum: A Transcriptome Study
  Petrov, Genes 2021
  • “...8-1. We observed the strongest downregulation among the PTS transporters in two C-subunits: lp_0265 and lp_0264. They were 14.69- and 25.45-fold downregulated in 8-1 and 18.57- and 38.68-fold in Ym1, respectively. Based on a 73.2% match with the respective proteins in Listeria monocytogenes , they seem...”
  • “...PTS sugar transporter subunit IIB 2.19 3.02 lp_0265, pts5ABC PTS transporter subunit EIIC 18.57 14.69 lp_0264, pts4ABC PTS transporter subunit EIIC 38.68 25.45 lp_0170, dak3 PTS-dependent dihydroxyacetone kinase phosphotransferase subunit DhaM 4.86 164.91 * The difference in gene expression was estimated as the fold change (FC)...”
• Characterization of transcriptional response of Lactobacillus plantarum under acidic conditions provides insight into bacterial adaptation in fermentative environments.
  Jung, Scientific reports 2020
  • “...hydrolase lp_0263 F9UT60 COG0366 K01226 pts4ABC 1.38 2.08E08 1.88E07 PTS system, trehalose-specific IIBC component lp_0264 F9UT61 COG2190 K02757 lp_0302 3.20 2.46E64 2.09E62 Extracellular transglycosylase lp_0302 F9UTQ7 NOG102536 K01185 lp_0304 1.60 5.83E32 1.85E30 Extracellular transglycosylase lp_0304 F9UTQ8 NOG62861 K01185 lp_0783 2.61 1.48E116 3.01E114 Oligopeptide ABC transporter lp_0783...”
• Identification of key proteins and pathways in cadmium tolerance of Lactobacillus plantarum strains by proteomic analysis.
  Zhai, Scientific reports 2017
  • “...2.73 Q88RZ2 rbsD; D-ribose mutarotase 1.78 Q88S51 rhaA; L-rhamnose isomerase 1.56 PTS system PTS system F9UT61 pts4ABC; PTS system trehalose-specific transporter subunit IIBC 1.86 F9UL45 pts9AB; PTS system, mannose-specific EIIAB component 1.73 F9UL47 pts9D; PTS system, mannose-specific EIID component 1.82 F9UL56 pts10A; PTS system, mannose-specific EIIA...”
• Characterization of transcriptional response of Lactobacillus plantarum under acidic conditions provides insight into bacterial adaptation in fermentative environments
  Jung, Scientific reports 2020
  • “...Trehalose-6-phosphate hydrolase lp_0263 F9UT60 COG0366 K01226 pts4ABC 1.38 2.08E08 1.88E07 PTS system, trehalose-specific IIBC component lp_0264 F9UT61 COG2190 K02757 lp_0302 3.20 2.46E64 2.09E62 Extracellular transglycosylase lp_0302 F9UTQ7 NOG102536 K01185 lp_0304 1.60 5.83E32 1.85E30 Extracellular transglycosylase lp_0304 F9UTQ8 NOG62861 K01185 lp_0783 2.61 1.48E116 3.01E114 Oligopeptide ABC transporter...”
• Transcriptional Reprogramming at Genome-Scale of Lactobacillus plantarum WCFS1 in Response to Olive Oil Challenge
  Esteban-Torres, Frontiers in microbiology 2017
  • “...These genes included those within the trehalose operon [ lp_0262 (transcriptional repressor)], lp_0263 (trehalose-6-phosphate hydrolase), lp_0264 and lp_0265 (PTS system trehalose-specific transporter subunits IIBC), the GABA transporter ( lp_1722 ) and two aquaporins ( lp_0372 and lp_3436 ), which were all downregulated. This profile indicates that...”
• An agr-like two-component regulatory system in Lactobacillus plantarum is involved in production of a novel cyclic peptide and regulation of adherence
  Sturme, Journal of bacteriology 2005
  • “...phosphotransferase system genes lp_0185, lp_0436, and lp_0264, respectively). Cluster 2 encompassed constitutively down-regulated genes, with the highest effect...”
  • “...1 lp_0184 lp_0185 lp_0187 lp_0188 lp_0189 lp_0263 lp_0264 lp_0435 lp_0436 lp_3480 lp_3481 lp_3482 Geneb L. PLANTARUM agr-LIKE TWO-COMPONENT REGULATORY SYSTEM...”

CD3127 PTS system, IIabc component from Clostridium difficile 630
31% identity, 96% coverage

• Transcriptional profiling of Clostridium difficile and Caco-2 cells during infection
  Janvilisri, The Journal of infectious diseases 2010
  • “...include genes involved in carbohydrate utilization through a phosphotransferase system ( CD1078, CD2327, CD3030, CD3082, CD3127 , and CD3276 ) and other transport proteins. These genes might be essential in the pathogenesis of C. difficile as a link between metabolic states of the bacterium and its...”

SSU98_1501 Phosphotransferase system IIC component, glucose/maltose/N-acetylglucosamine-specific from Streptococcus suis 98HAH33
SSU05_1490 Phosphotransferase system IIC component, glucose/maltose/N-acetylglucosamine-specific from Streptococcus suis 05ZYH33
SSU1309 beta-glucoside-specific phosphotransferase system (PTS), IIABC component from Streptococcus suis P1/7
31% identity, 70% coverage

• In vitro transcriptome analysis of two Chinese isolates of Streptococcus suis serotype 2
  Zhang, Genomics, proteomics & bioinformatics 2014
  • “...PTS cellobiose-specific component IIC AgaE SSU98_1232 1.71 PTS, mannose ManZ SSU98_0440 1.80 PTS, mannose BglF SSU98_1501 6.74 PTS IIC component, glucose 05ZYH33 LacF SSU05_1038 1.11 PTS cellobiose-specific component IIA Pts / Crr SSU05_0398 1.56 PTS IIC component, glucose/maltose/ N -acetylglucosamine-specific AgaW SSU05_1218 2.59 PTS, mannose/fructose/ N...”
• The Eukaryote-Like Serine/Threonine Kinase STK Regulates the Growth and Metabolism of Zoonotic Streptococcus suis
  Zhang, Frontiers in cellular and infection microbiology 2017
  • “...involved in various PTSs were down-regulated, including manX/Y/Z (SSU05_17781780)encoding mannose transporter, ptsG/crr/bglF (SSU05_0397, SSU05_0398, and SSU05_1490) encoding maltose/glucose transporter, celC (SSU05_0709) encoding cellobiose transporter, and ulaA/ulaB (SSU05_2062, and SSU05_2063) encoding ascorbate transporter. Down-regulation of these pathways and related genes were potentially consistent with the decreased bacterial...”
• In vitro transcriptome analysis of two Chinese isolates of Streptococcus suis serotype 2
  Zhang, Genomics, proteomics & bioinformatics 2014
  • “...mannose/fructose/ N -acetylgalactosamine-specific component IID ManZ SSU05_0452 2.33 PTS, mannose/fructose/ N -acetylgalactosamine-specific component IID BglF SSU05_1490 5.40 PTS IIC component, glucose/maltose/ N -acetylglucosamine-specific Strain EC ID Gene ID FC Protein Glycolysis/gluconeogenesis pathway 98HAH33 2.7.1.69 SSU98_0384 1.92 PTS IIC component, glucose 3.2.1.86 SSU98_2083 1.02 Alpha-galactosidase 1.1.1.1 SSU98_0274...”
• Precision Genome Engineering in Streptococcus suis Based on a Broad-Host-Range Vector and CRISPR-Cas9 Technology
  Gussak, ACS synthetic biology 2023
  • “...SSU0154 Pgk 1.28 SSU0312 Fba 1.56 SSU0483 Tpi 1.12 SSU0927 Ldh 1.34 SSU1308 bglH 1.41 SSU1309 1.54 SSU1320 Eno 1.46 SSU1451 gpmA 1.47 SSU1836 Pgi 1.07 pyrimidine metabolism SSU0735 pyrR 2.55 SSU0736 pyrB 2.45 SSU0737 carA 2.54 SSU0738 carB 2.64 SSU0860 sntC 1.23 SSU0861 pyrC 2.41...”
• FlpS, the FNR-Like Protein of Streptococcus suis Is an Essential, Oxygen-Sensing Activator of the Arginine Deiminase System
  Willenborg, Pathogens (Basel, Switzerland) 2016
  • “...by our microarray analysis. SSU0357 and SSU1583 presumably encode for glucose-specific PTS whereas SSU0217 and SSU1309 encode for trehalose- and -glucoside PTS, respectively. Glucose and glucose-containing di- and oligosaccharides are the major energy sources of S. suis. Since expression of gapA and gpmA was slightly affected...”

LP_RS14755 beta-glucoside-specific PTS transporter subunit IIABC from Lactiplantibacillus plantarum WCFS1
31% identity, 68% coverage

• Dissecting of the AI-2/LuxS Mediated Growth Characteristics and Bacteriostatic Ability of Lactiplantibacillus plantarum SS-128 by Integration of Transcriptomics and Metabolomics
  Qian, Foods (Basel, Switzerland) 2022
  • “...* 3.28 10 9 K02798 cmtB mannitol PTS system EIIA component 1.59 1.49 10 5 LP_RS14755 PTS system EIIC component 1.74 1.79 10 2 LP_RS12340 PTS system EIIA component 1.67 3.06 10 2 LP_RS12650 PTS system EIIB component 1.52 4.89 10 2 LP_RS12655 PTS system EIIC...”

NJ74_RS04255 PTS beta-glucoside transporter subunit IIABC from Escherichia coli DH5[alpha]
31% identity, 70% coverage

• The Effects and Toxicity of Different Pyrene Concentrations on Escherichia coli Using Transcriptomic Analysis
  Zhu, Microorganisms 2024
  • “...in this pathway were mainly up-regulated from 2.0 to 4.0 fold, with only three genes (NJ74_RS04255, NJ74_RS03620, and NJ74_RS09985) up-regulated from 5.0 to 6.0 fold ( Supplementary Table S11 ). In addition to the aforementioned pathways, the SoxRS system has also been shown to be associated...”

ECA_RS21710 beta-glucoside-specific PTS transporter subunit IIABC from Pectobacterium atrosepticum SCRI1043
31% identity, 71% coverage

• Genome-Wide Analyses of the Temperature-Responsive Genetic Loci of the Pectinolytic Plant Pathogenic Pectobacterium atrosepticum
  Kaczynska, International journal of molecular sciences 2021
  • “...100; CAG72938.1; ECA_RS00065 ; PTU Ribokinase 2.6 COG0524G reduced biofilm formation 10 PbaTn5-B36 100; CAG77284.1; ECA_RS21710 ; PTU IIABC component of phosphoenolpyruvate-dependent sugar phosphotransferase (PTS) system 1.5 COG1263G WT 11 PbaTn5-B52 100; AIK15419.1; ECA_RS18040 ; MTU Transcriptional regulator, XRE family 2.2 ENOG501MXWB WT 12 PbaTn5-B63 100;...”

V518_0294 PTS transporter subunit EIIC from Thermoanaerobacterium aotearoense SCUT27
34% identity, 93% coverage

• Metabolic engineering of Thermoanaerobacterium aotearoense strain SCUT27 for biofuels production from sucrose and molasses
  Dai, Biotechnology for biofuels and bioproducts 2023
  • “...Those three proteins had 36.71%, 35.19% and 28.80% amino acid sequence identity, respectively. Potential ScrA (V518_0294), responsible for sucrose transport, also existed in T. aotearoense SCUT27 with 32.09% amino acid sequence identity. In addition, sucrose-permease system (Tthe_1925-27) were identified in the specific sucrose-metabolism operon of T....”
  • “...probably be attributed to the fact that T. aotearoense SCUT27 has potential native transporter ScrA (V518_0294) for sucrose transport. Fig. 2 Various engineered strains and their traits. A Schematic diagram of the engineering for introducing sucrose metabolic pathways. B Maximum OD, sugar consumption and ethanol production...”

STM474_2675 PTS transporter subunit EIIC from Salmonella enterica subsp. enterica serovar Typhimurium str. ST4/74
STM2570 putative phosphotransferase system IIB components from Salmonella typhimurium LT2
33% identity, 99% coverage

• Importance of sigma factor mutations in increased triclosan resistance in Salmonella Typhimurium
  Gantzhorn, BMC microbiology 2015
  • “...G93V RfbV Abequosyl transferase K177fs RcsB Transcriptional regulator V149fs RpoD RNA polymerase sigma factor T119I STM474_2675 Putative phosphotransferase system IIB component A83V Fis DNA binding protein A78D STM474_0304 Putative RHS-like protein F25V F25V NadE NAD synthetase L214S L214S RpoS RNA polymerase sigma factor R100H SspA Stringent...”
• Live attenuated S. Typhimurium vaccine with improved safety in immuno-compromised mice
  Periaswamy, PloS one 2012
  • “...ssaV STM2616 (WITS 1), ssaV STM2998 (WITS 2), ssaV STM2011 (WITS11), ssaV STM2231 (WITS13), ssaV STM2570 (WITS19). Real-time PCR analysis of the sequence tags established the relative abundance of Z234 (black symbols) as compared to the parental strain and the five other double-mutants analyzed in these...”

BFP66_RS08570 beta-glucoside-specific PTS transporter subunit IIABC from Streptococcus suis
31% identity, 63% coverage

• A novel aquaporin Aagp contributes to Streptococcus suis H₂O₂ efflux and virulence
  Zhu, Virulence 2023
  • “...IICB; BFP66_RS08510 10.66 PTS cellobiose transporter subunit IIC; BFP66_RS08530 53.00 PTS cellbiose transporter subunit IIC; BFP66_RS08570 5.96 PTS beta-glucoside transporter subunit EIIBCA; BFP66_RS09840 2.24 PTS sugar transporter subunit IIC; BFP66_RS09850 4.61 PTS lactose/cellobiose transporter subunit IIA; BFP66_RS09855 3.09 PTS sugar transporter subunit IIB; BFP66_RS05750 3.95 aquaporin...”

LGAS_1669 Trehalose PTS trehalose component IIBC from Lactobacillus gasseri ATCC 33323
30% identity, 67% coverage

• The PTS transporters of Lactobacillus gasseri ATCC 33323
  Francl, BMC microbiology 2010
  • “...to inactivate PTS 15, 20, and 21, respectively (Table 5 ). The amplified PTS 15 (LGAS_1669), 20 (LGAS_1778) and 21 (LGAS_1795) internal regions were 819 bp, 760 bp and 675 bp, respectively. The junction fragments for successful pMJM-4 integration were 999 bp and 1039 bp. The...”

OENOO_63040 PTS system, sucrose-specific IIBC component from Oenococcus oeni ATCC BAA-1163
33% identity, 89% coverage

• A partial proteome reference map of the wine lactic acid bacterium Oenococcus oeni ATCC BAA-1163
  Mohedano, Open biology 2014
  • “...loci (EAV38986 and EAV39008) encoding the aminotransferase OENOO_63016 and the PTS system, sucrose-specific IIBC component OENOO_63040 in ATCC BAA-1163. Neither this gene nor the corresponding locus is present in the genome of the other 13 sequenced strains. This region contains genes encoding for exopolysaccharides (EPS) biosynthesis...”
  • “...heteropolysaccharides catalysed by glycosyltransferases, whose coding genes are located in the specific region OENOO_63027 and OENOO_63040 in the ATCC BAA-1163 genome. In recent years, several works have investigated the contribution of the malolactic fermentation and of the strain-specific variability of O. oeni on the modulation of...”

Cbei_2833 PTS system, beta-glucoside-specific IIABC subunit from Clostridium beijerincki NCIMB 8052
29% identity, 72% coverage

• Sigma Factor Regulated Cellular Response in a Non-solvent Producing Clostridium beijerinckii Degenerated Strain: A Comparative Transcriptome Analysis
  Zhang, Frontiers in microbiology 2017
  • “...Such operons include Fru family Cbei_02390245 and Cbei_2739-2741, Gut (Glucitol) family Cbei_03330340, and Glc family Cbei_2833. The BglG near the operons showed high expression level, including Cbei_0242 (+6.34), Cbei_2738 (+19.95), Cbei_0334 (+2.63), Cbei_2834 (+2.67). Beside sugar transporter genes, genes related to sugar metabolic pathways were up-regulated...”

BWI76_RS19555 Beta-glucoside phosphotransferase system, IIA/IIB/IIC components from Klebsiella michiganensis M5al
33% identity, 66% coverage

• mutant phenotype: Specific phenotype: utilization of D-Salicin and D,L-Malic Acid; the malate phenotype is unexplained

AFK64_20760 PTS transporter subunit EIIC from Cronobacter sakazakii
31% identity, 98% coverage

• Screening of genes involved in interactions with intestinal epithelial cells in Cronobacter sakazakii
  Du, AMB Express 2016
  • “...name Primer sequence Product size (bp) recB AFK64_02315 F CAGGATACCGACCCGCAACA 116 AFK64_02315 R TTTATGCGTTTCGCGGTGC bglF AFK64_20760 F CGGCATCAGCATGTCATAG 139 AFK64_20760 R CTTTAGTGTCTCGGCGAGTTT fnr AFK64_08415 F AATCCCGTTCGAGACGTTAG 104 AFK64_08415 R TCATATCCTGGTCGCCTTTG flhA AFK64_06715 F CGCATCCGCAGTATCCGTAA 129 AFK64_06715 R GCCGATTTCCACGCCTTTC fliR ESA_02516 F CAATCTTGACGCGGATGCTAA 102 ESA_02516 R ACTGGCTGACTCTGTACTTCTGG...”
  • “...AFK64_02315 C. sakazakii, NCTC 8155 Exonuclease V subunit beta 177/184 (96) AM 4 510 bglF, AFK64_20760 C. sakazakii, NCTC 8155 PTS sugar transporter (beta-glucoside component) 493/510 (97) AM 5 340 fnr, AFK64_08415 C. sakazakii, NCTC 8155 Fumarate and nitrate reduction regulatory protein 337/340 (99) AM 6...”

lp_3240 beta-glucosides PTS, EIIABC from Lactobacillus plantarum WCFS1
32% identity, 59% coverage

• Butanol Tolerance of Lactiplantibacillus plantarum: A Transcriptome Study
  Petrov, Genes 2021
  • “...pts18CBA PTS transporter subunit EIIC NC +3.22 lp_0886, pts11BC PTS transporter subunit EIIC NC 3.91 lp_3240, pts28ABC PTS transporter subunit EIIC NC 2.19 lp_0436, pts7C PTS sugar transporter subunit IIC NC 17.13 lp_3507, pts29C PTS sugar transporter subunit IIC NC 6.13 lp_3010, pts23C PTS sugar transporter...”
• D-Alanylation of teichoic acids contributes to Lactobacillus plantarum-mediated Drosophila growth during chronic undernutrition
  Matos, Nature microbiology 2017
  • “...D-ala-D-ala carboxypeptidase ( pbpX2 ) 14-9 IG lp0616-lp0617 Intergenic region between secE and nusG 14-10 lp_3240 PTS system, beta-glucosides-specific EIIABC component ( pts28ABC ) 17-57 lp_2466 Prophage P2b protein 15, terminase large subunit 18-65 lp_1944 Multidrug ABC transporter 22-19 lp_2027 Chaperone, heat shock protein DnaK...”

lp_3240 glucose PTS transporter subunit IIA from Lactiplantibacillus plantarum WCFS1
32% identity, 60% coverage

• Butanol Tolerance of Lactiplantibacillus plantarum: A Transcriptome Study
  Petrov, Genes 2021
  • “...pts18CBA PTS transporter subunit EIIC NC +3.22 lp_0886, pts11BC PTS transporter subunit EIIC NC 3.91 lp_3240, pts28ABC PTS transporter subunit EIIC NC 2.19 lp_0436, pts7C PTS sugar transporter subunit IIC NC 17.13 lp_3507, pts29C PTS sugar transporter subunit IIC NC 6.13 lp_3010, pts23C PTS sugar transporter...”

TC 4.A.1.2.15 / ART98417 PTS beta-glucoside transporter, EIIBCA of 624 aas and 10 predicted TMSs from Lactobacillus gasseri
31% identity, 64% coverage

• substrates: beta-glucosides

SXYL_00528 beta-glucoside-specific PTS transporter subunit IIABC from Staphylococcus xylosus
33% identity, 72% coverage

• Insight into the Genome of Staphylococcus xylosus, a Ubiquitous Species Well Adapted to Meat Products
  Leroy, Microorganisms 2017
  • “...Hydrolase, Fructokinase SXYL_00170 lactate-quinone oxidoreductase others Lactose SXYL_00060, SXYL_00626 Arbutin, EIIBC SXYL_00082 lacR Transcription activator SXYL_00528 Beta-glucoside, EIIABC SXYL_00083-84 lacPH Permease, Beta-galactosidase SXYL_00257-60 Cellobiose, EIIC, EIIBA SXYL_00671 galR Transcriptional regulator SXYL_02148-50 fruAK Fructose, EIIABC, catabolism, repression SXYL_00672-74 galKET Galactokinase, epimerase, P-uridylyltransferase SXYL_00277-78 Fructose, regulation, EII SXYL_00773-76...”

Cbei_3273 PTS system, beta-glucoside-specific IIABC subunit from Clostridium beijerincki NCIMB 8052
30% identity, 72% coverage

• Genome-wide dynamic transcriptional profiling in Clostridium beijerinckii NCIMB 8052 using single-nucleotide resolution RNA-Seq
  Wang, BMC genomics 2012
  • “...clusters encoding the Glc family PTS transporters in C. acetobutylicum . Among them, only Cbei_0751, Cbei_3273, Cbei_4532, Cbei_4533 and Cbei_4705 were actively expressed during the fermentation process, and Cbei_4533 (encoding N-acetylglucosamine-specific IIA subunit) and Cbei_4532 (encoding N-acetylglucosamine-specific IIBC subunit) were especially strongly expressed throughout the batch...”

SGO_0281 PTS system, beta-glucoside-specific IIABC component from Streptococcus gordonii str. Challis substr. CH1
SGO_RS01385 beta-glucoside-specific PTS transporter subunit IIABC from Streptococcus gordonii str. Challis substr. CH1
31% identity, 66% coverage

• Interactions Between Streptococcus gordonii and Fusobacterium nucleatum Altered Bacterial Transcriptional Profiling and Attenuated the Immune Responses of Macrophages
  Liu, Frontiers in cellular and infection microbiology 2021
  • “...gene fusions (red), cooccurrence (blue), and coexpression (black). The genes in the central cluster include SGO_0281 (SGO_RS01385, PTS glucose transporter subunit IIA, up-regulated), SGO_1857 (SGO_RS09095, PTS beta-glucoside transporter subunit IIBCA, down-regulated), and SGO_1858 (SGO_RS09100, sucrose-6-phosphate hydrolase, down-regulated). These genes encode proteins that participate in the carbohydrate...”
• Interactions Between Streptococcus gordonii and Fusobacterium nucleatum Altered Bacterial Transcriptional Profiling and Attenuated the Immune Responses of Macrophages
  Liu, Frontiers in cellular and infection microbiology 2021
  • “...fusions (red), cooccurrence (blue), and coexpression (black). The genes in the central cluster include SGO_0281 (SGO_RS01385, PTS glucose transporter subunit IIA, up-regulated), SGO_1857 (SGO_RS09095, PTS beta-glucoside transporter subunit IIBCA, down-regulated), and SGO_1858 (SGO_RS09100, sucrose-6-phosphate hydrolase, down-regulated). These genes encode proteins that participate in the carbohydrate transport...”

LMOf2365_1056 PTS system, beta-glucoside-specific, IIABC component from Listeria monocytogenes str. 4b F2365
35% identity, 65% coverage

• Contributions of a LysR Transcriptional Regulator to Listeria monocytogenes Virulence and Identification of Its Regulons
  Abdelhamed, Journal of bacteriology 2020 (secret)

CDR20291_2969 PTS system, IIabc component from Clostridium difficile R20291
CDR20291_2969 beta-glucoside-specific PTS transporter subunit IIABC from Clostridioides difficile R20291
31% identity, 70% coverage

• Environmental transmission of Clostridioides difficile ribotype 027 at a long-term care facility; an outbreak investigation guided by whole genome sequencing
  Endres, Infection control and hospital epidemiology 2018
  • “...C C C T T C C C C C C C C C 3531583 CDR20291_2969 PTS system, IIabc component Non-synonymous C T T T T T T T T T T T T T T T T T 3715797 Intergenic T C C C C...”

A6TBM5 Cellobiose-specific PTS permease from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
KPN_02578 putative cellobiose-specific PTS permease from Klebsiella pneumoniae subsp. pneumoniae MGH 78578
33% identity, 73% coverage

• Mutation of kvrA Causes OmpK35 and OmpK36 Porin Downregulation and Reduced Meropenem-Vaborbactam Susceptibility in KPC-Producing Klebsiella pneumoniae
  Dulyayangkul, Antimicrobial agents and chemotherapy 2020 (secret)
• Fate of the H-NS-repressed bgl operon in evolution of Escherichia coli
  Sankar, PLoS genetics 2009
  • “...protein, FMN-linked), KPN_02580 putative carbohydrate-selective porin (not homologous to bglH ), KPN_02579 putative transcriptional antiterminator, KPN_02578 putative cellobiose-specific PTS permease, KPN_02577 putative phospho-,D-glucosidase, KPN_02576 putative channel/filament proteins ( yohG ), as well as yieC Carbohydrate-specific outer membrane porin in cryptic operon (KPN_04128), yieL putative xylanase (KPN_04127),...”

LPST_C2650 sucrose-specific PTS transporter subunit IIBC from Lactiplantibacillus plantarum ST-III
32% identity, 67% coverage

• The Carbohydrate Metabolism of Lactiplantibacillus plantarum
  Cui, International journal of molecular sciences 2021
  • “...catalysis of 6-phosphate sucrose hydrolase to produce 6-phosphate-glucose and fructose. Furthermore, another gene cluster sacPTS26 (LPST_C2650 to LPST_C2652) was found in ST-III strain, and was also involved in the utilization of FOS, was composed of pts26BCA , agl4 and sacR2 [ 40 ]. The genomic analysis...”

lmo1035 similar to phosphotransferase system (PTS) beta-glucoside-specific enzyme IIABC from Listeria monocytogenes EGD-e
34% identity, 65% coverage

• Comparative genomics analysis to explore the biodiversity and mining novel target genes of Listeria monocytogenes strains from different regions
  Zhang, Frontiers in microbiology 2024
  • “...genes Sequence length/bp Presence profile Encoded protein Product size/bp Source In target In non-target bglF_1 lmo1035 1857 343 (100%) 0 PTS system beta-glucoside-specific EIIBCA component 618 This study davD lmo0913 1,467 343 (100%) 0 Glutarate-semialdehyde dehydrogenase 488 This study menE_1 lmo1672 1,409 343 (100%) 0 O-succinylbenzoic...”
• DegU-mediated suppression of carbohydrate uptake in Listeria monocytogenes increases adaptation to oxidative stress
  Chen, Applied and environmental microbiology 2023 (secret)
• Listeria monocytogenes GshF contributes to oxidative stress tolerance via regulation of the phosphoenolpyruvate-carbohydrate phosphotransferase system
  Chen, Microbiology spectrum 2023
  • “...lmo1003 lmo1003 Phosphotransferase system enzyme I lmo1017 1.24 Yes/down lmo1017 PTS glucose transporter subunit IIA lmo1035 lmo1035 PTS beta-glucoside transporter subunit IIABC lmo1095 3.29 Yes/down lmo1095 PTS cellbiose transporter subunit IIB lmo1255 1.52 Yes/up 4.14 Yes/down lmo1255 PTS trehalose transporter subunit IIBC lmo1719 1.64 Yes/down lmo1719...”
• YjbH mediates the oxidative stress response and infection by regulating SpxA1 and the phosphoenolpyruvate-carbohydrate phosphotransferase system (PTS) in Listeria monocytogenes
  Cheng, Gut microbes 2021
  • “...Yes lmo2373 PTS beta-glucoside-specific enzyme IIB 1.65 Yes lmo2772 PTS glucose/sucrose-specific enzyme IIB 1.52 Yes lmo1035 PTS beta-glucoside-specific enzyme IIABC 1.42 Yes EIIC lmo2763 PTS cellbiose-specific enzyme IIC 8.80 Yes lmo0298 PTS beta-glucoside-specific enzyme IIC 5.62 Yes lmo2096 PTS galactitol-specific enzyme IIC 5.35 Yes fruA PTS...”
• Colonisation dynamics of Listeria monocytogenes strains isolated from food production environments
  Gray, Scientific reports 2021
  • “...study) Fold change Gene COG cat Description KEGG enzyme Isolate and TP # PTS system lmo1035 fig|1639.4014.peg.1355 4.22 G PEP-dependent sugar PTS, EIIA 1 7453 24h lmo1719 fig|1639.4014.peg.1473 4.36 G PTS system cellobiose-specific IIA component 2.7.1.205 lmo0427 fig|1639.4014.peg.2115 4.77 G PTS system, Lactose/Cellobiose specific IIB subunit...”
• Small regulatory RNAs from low-GC Gram-positive bacteria
  Brantl, RNA biology 2014
  • “...RilB lmo2104/2105 # iron transport proteins ? RilE comEA/FA, lmo0945 # competence factors ? RliI lmo1035 # phosphotransferase system ? Rli23, 25, 35 lmo0172 # transposases Rli45 rli46 # ? Rli29 lmo9471 # ? Rli30 lmo0506 # ? Only sRNAs are listed for which target genes...”
  • “...involved in iron transport, RliE the competence factors comEA/FA, and RliL a phosphotransferase system ( lmo1035 ). The absence of 15 of the 29 sRNAs recently found in L. monocytogenes 72 in the non-pathogenic L. innocua underlines the importance of riboregulators for pathogenesis and virulence. Rli38...”
• Listeria monocytogenes differential transcriptome analysis reveals temperature-dependent Agr regulation and suggests overlaps with other regulons
  Garmyn, PloS one 2012
  • “...Several genes involved in PTS systems ( lmo0738 , lmo1255 , lmo1973 , lmo1971 , lmo1035 , lmo1901 , lmo2000 , bvrB ) [35] and putative sugar ABC transporters (for example lmo0768 , lmo0767 and lmo0766 ) had higher transcript levels in DG125A compared to EGD-e....”
• Probing the pan-genome of Listeria monocytogenes: new insights into intraspecific niche expansion and genomic diversification
  Deng, BMC genomics 2010
  • “...166 lmo1032 Similar to transketolase IIIA - 166 lmo1033 Similar to transketolase IIIA - 166 lmo1035 Similar to PTS beta-glucoside-specific enzyme IIABC IIIA + 166 lmo1971 Similar to pentitol PTS system enzyme II C component IIIA + - lmo1972 Similar to pentitol PTS system enzyme II...”
• More

LEUM_0508 beta-glucoside-specific PTS system IIABC component from Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
31% identity, 90% coverage

• Glycosyltransferases Expression Changes in Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293 Grown on Different Carbon Sources
  Vallejo-García, Foods (Basel, Switzerland) 2023
  • “...to HPr protein; LEUM_1780, LOG 2 FC = 1.45), and scrA (corresponding to the phosphate-kinase; LEUM_0508, LOG 2 FC = 3.7) are down-regulated, suggesting a minor quantity of CcpA protein and thus, limiting their activity as repressors under these culture conditions. 3.6. The Transcription Factor PerR...”
• Genome-scale modeling and transcriptome analysis of Leuconostoc mesenteroides unravel the redox governed metabolic states in obligate heterofermentative lactic acid bacteria
  Koduru, Scientific reports 2017
  • “...wall synthesis. However, the presence of putative genes encoding glucose-PTS components in L. mesenteroides (LEUM_0507, LEUM_0508 and LEUM_0901) as annotated in TransportDB database 35 allowed us to analyze the possible cellular phenotype of L. mesenteroides growing on glucose with and without a glucose-PTS transporter. Accordingly, we...”

lmo2787 beta-glucoside-specific phosphotransferase enzyme II ABC component from Listeria monocytogenes EGD-e
32% identity, 64% coverage

• Listeria monocytogenes GshF contributes to oxidative stress tolerance via regulation of the phosphoenolpyruvate-carbohydrate phosphotransferase system
  Chen, Microbiology spectrum 2023
  • “...lmo2782 PTS cellbiose transporter subunit IIB lmo2783 3.66 Yes/down lmo2783 PTS cellbiose transporter subunit IIC lmo2787 4.02 Yes/down bvrB Beta-glucoside-specific phosphotransferase enzyme II ABC component lmo2797 2.71 Yes/down lmo2797 PTS mannitol transporter subunit IIA lmo2799 2.55 Yes/down lmo2799 PTS mannitol transporter subunit IIBC a "" means...”
• DegU-mediated suppression of carbohydrate uptake in Listeria monocytogenes increases adaptation to oxidative stress
  Chen, Applied and environmental microbiology 2023 (secret)
• New Insights into the Lactic Acid Resistance Determinants of Listeria monocytogenes Based on Transposon Sequencing and Transcriptome Sequencing Analyses
  Liu, Microbiology spectrum 2023
  • “...beta-glucoside transporter subunit IIABC 0.0834 1.54E-13 lmo2782 lmo2782 PTS cellobiose transporter subunit IIB 0.1655 4.48E-02 lmo2787 bvrB beta-Glucoside-specific phosphotransferase enzyme II ABC component 0.2198 3.85E-04 lmo2797 lmo2797 PTS mannitol transporter subunit IIA 0.0452 8.74E-29 lmo2799 lmo2799 PTS mannitol transporter subunit IIBC 0.0043 5.16E-23 a P adj,...”
• Pyruvate carboxylase plays a crucial role in carbon metabolism of extra- and intracellularly replicating Listeria monocytogenes
  Schär, Journal of bacteriology 2010
  • “...lmo2742d lmo2743 lmo2771b lmo2772b lmo2773b lmo2786 (bvrC) lmo2787 (bvrB)b lmo2788 (bvrA)b lmo2797b lmo2798b lmo2851 Encoded protein 1780 SCHAR ET AL. J....”
• Whole-genome sequence of Listeria welshimeri reveals common steps in genome reduction with Listeria innocua as compared to Listeria monocytogenes
  Hain, Journal of bacteriology 2006
  • “...of -glucoside (lmo0738, lmo0874lmo0876, lmo1035, and lmo2787), fructose (lmo2733 and lmo0503), galactiol (lmo0507 and lmo0508), pentitol (lmo1971lmo1973),...”
• Genome diversification in phylogenetic lineages I and II of Listeria monocytogenes: identification of segments unique to lineage II populations
  Zhang, Journal of bacteriology 2003
  • “...(LPXTG) Lmo2603 (unknown) Lmo2604 (unknown) Lmo2786 (BvrC) Lmo2787 (BvrB) Lmo2788 (BvrA) Similar to A118 prophage Unknown Unknown BLAST result with unfinished...”

PMI3515 PTS system EIIBC component from Proteus mirabilis HI4320
33% identity, 97% coverage

• Twin arginine translocation, ammonia incorporation, and polyamine biosynthesis are crucial for Proteus mirabilis fitness during bloodstream infection
  Armbruster, PLoS pathogens 2019
  • “...spleen including, ptsG , ptsH , ptsI , treB , nagE , PMI2226, PMI2982, and PMI3515. Several genes involved in glycolysis were also identified as infection-specific fitness factors ( ptsG , gnd , edd , and pykA ), and genes involved in pyruvate catabolism ( aceEF...”
• Transcriptome of Proteus mirabilis in the murine urinary tract: virulence and nitrogen assimilation gene expression
  Pearson, Infection and immunity 2011
  • “...PMI3232 PMI0973 PMI0706 PMI0187 PMI1568 PMI1406 PMI2946 PMI3515 PMI2672 PMI2948 PMI0287 PMI2192 PMI0272 PMI3674 PMI1601 PMI1725 PMI3675 PMI2292 PMI2970 PMI1707...”

KP1_3804 putative cellobiose-specific PTS permease from Klebsiella pneumoniae NTUH-K2044
33% identity, 73% coverage

• YjcC, a c-di-GMP phosphodiesterase protein, regulates the oxidative stress response and virulence of Klebsiella pneumoniae CG43
  Huang, PloS one 2013
  • “...KP1_2505 ABC transport system ATP binding protein 4.5 KP1_3173 PTS transporter subunits II ABC 5.0 KP1_3804 Methylgalactoside transporter inner membrane component mglC 4.8 KP1_0277 Methylgalactoside transporter systemSubstrate-binding component mglB 4.2 KP1_3815 Putative ABC transport system component 4.6 KP1_3175 Molybdate ABC transporter system 4.4 KP1_3995 Maltose/maltodextrin transporter...”
• Cellobiose-specific phosphotransferase system of Klebsiella pneumoniae and its importance in biofilm formation and virulence
  Wu, Infection and immunity 2012
  • “...the K. pneumoniae NTUH-K2044 strain (KP1_0780, KP1_2900, and KP1_3804). Although the substrates of these permeases have yet to be clarified, they may share...”

LP_RS13505 sucrose-specific PTS transporter subunit IIBC from Lactiplantibacillus plantarum WCFS1
lp_3219 sucrose PTS, EIIBCA from Lactobacillus plantarum WCFS1
32% identity, 67% coverage

• Dissecting of the AI-2/LuxS Mediated Growth Characteristics and Bacteriostatic Ability of Lactiplantibacillus plantarum SS-128 by Integration of Transcriptomics and Metabolomics
  Qian, Foods (Basel, Switzerland) 2022
  • “...component 1.52 4.89 10 2 LP_RS12655 PTS system EIIC component 2.33 * 9.25 10 10 LP_RS13505 beta-glucoside PTS system EIIBCA component 1.54 8.15 10 3 LP_RS14845 PTS system EIIB component 1.71 1.46 10 2 LP_RS14850 PTS system EIIA component 1.88 2.76 10 4 Pyruvate metabolism K00927...”
• Metabolism of Fructooligosaccharides in Lactobacillus plantarum ST-III via Differential Gene Transcription and Alteration of Cell Membrane Fluidity
  Chen, Applied and environmental microbiology 2015
  • “...al., in whose microarray experiments two sucrose PTSs (lp_3219 and lp_3522) were not differentially expressed (7). Another set of genes induced by FOS...”
• Identification of prebiotic fructooligosaccharide metabolism in Lactobacillus plantarum WCFS1 through microarrays
  Saulnier, Applied and environmental microbiology 2007
  • “...other genes code for a sucrose EII compound PTS (lp_3219 and lp_3522), but they were not differentially expressed in the presence of scFOS compared to glucose....”
  • “...displayed only 35 and 37% degrees of identity with lp_3219 and lp_3522, respectively. The signal values for lp_3219 were very low, and this gene was likely...”

SAK_0354 PTS system, IIBC component from Streptococcus agalactiae A909
30% identity, 98% coverage

• A Vaginal Tract Signal Detected by the Group B Streptococcus SaeRS System Elicits Transcriptomic Changes and Enhances Murine Colonization
  Cook, Infection and immunity 2018
  • “...(strain A909) Phosphotransferase systems sak_0257 sak_0261 sak_0354 sak_0398 sak_0399 sak_0400 sak_0524 sak_0525 sak_0526 sak_0528 sak_0529 sak_0530 sak_1377...”
  • “...sak_1155 sak_0398 sak_0399 sak_0400 sak_1920 sak_1702 sak_0354 sak_0257 Fatty acid biosynthesis and metabolism sak_0416 sak_0417 sak_0418 sak_0419 sak_0420...”

LMJF5203_01731 PTS transporter subunit EIIC from Listeria monocytogenes
33% identity, 92% coverage

• Genetic Separation of Listeria monocytogenes Causing Central Nervous System Infections in Animals
  Aguilar-Bultet, Frontiers in cellular and infection microbiology 2018
  • “...LMJF5203_01290 Uncharacterized 120 Immunity protein 51 LMJF5203_01291 cell surface 1229 LMJF5203_01730 family transcriptional regulator 55 LMJF5203_01731 permease 482 LMJF5203_01732 N-acetylmuramic acid 6-phosphate etherase 296 LMJF5203_01733 family transcriptional regulator 283 LMJF5203_02058 cell surface 2003 LMJF5203_02147 family transcriptional regulator 197 LMJF5203_02312 cell surface 1529 LMJF5203_02537 Leucine Rich repeats...”

SSA_0379 PTS system, beta-glucoside-specific EII component, putative from Streptococcus sanguinis SK36
29% identity, 70% coverage

• Glucose Phosphotransferase System Modulates Pyruvate Metabolism, Bacterial Fitness, and Microbial Ecology in Oral Streptococci
  Zeng, Journal of bacteriology 2023 (secret)

PMI2226 PTS system, IIabc component from Proteus mirabilis HI4320
28% identity, 72% coverage

• Twin arginine translocation, ammonia incorporation, and polyamine biosynthesis are crucial for Proteus mirabilis fitness during bloodstream infection
  Armbruster, PLoS pathogens 2019
  • “...factors in the spleen including, ptsG , ptsH , ptsI , treB , nagE , PMI2226, PMI2982, and PMI3515. Several genes involved in glycolysis were also identified as infection-specific fitness factors ( ptsG , gnd , edd , and pykA ), and genes involved in pyruvate...”

SXYL_00060 PTS cellobiose/arbutin/salicin transporter subunit IIBC from Staphylococcus xylosus
30% identity, 73% coverage

• Insight into the Genome of Staphylococcus xylosus, a Ubiquitous Species Well Adapted to Meat Products
  Leroy, Microorganisms 2017
  • “...SXYL_00886 scrR Repressor SXYL_00577 Lactate permease SXYL_00887-88 scrBK Hydrolase, Fructokinase SXYL_00170 lactate-quinone oxidoreductase others Lactose SXYL_00060, SXYL_00626 Arbutin, EIIBC SXYL_00082 lacR Transcription activator SXYL_00528 Beta-glucoside, EIIABC SXYL_00083-84 lacPH Permease, Beta-galactosidase SXYL_00257-60 Cellobiose, EIIC, EIIBA SXYL_00671 galR Transcriptional regulator SXYL_02148-50 fruAK Fructose, EIIABC, catabolism, repression SXYL_00672-74 galKET...”

ETAE_1718 beta-glucoside-specific PTS system components IIABC from Edwardsiella tarda EIB202
31% identity, 79% coverage

• Coordinate regulation of carbohydrate metabolism and virulence by PtsH in pathogen Edwardsiella piscicida
  Mao, Applied microbiology and biotechnology 2022
  • “...IID N-Acetylglucosamine EIIBC GlcNAc ETAE_2616 nagE N-Acetylglucosamine-specific PTS system enzyme IIBC subunit -Glucoside EIIABC Glu ETAE_1718 -Glucoside-specific PTS system enzyme IIABC Functional analysis of PTS components respective PTS sugar transport in E. piscicida To verify the utilization of putative PTS sugars, the WT strain was inoculated...”
  • “...(EII B Glc ), crr (EII A Glc ), agaV (EII B GlcNAc ), and ETAE_1718 (EII A Glu ) (Table S1 ) . The growth of these PTS-associated mutants in M9 medium supplemented with glucose or other PTS sugars was assayed (Fig. 2AB ). The...”

spr0505 Phosphotransferase system sugar-specific EII component from Streptococcus pneumoniae R6
SPD_0502 PTS system, beta-glucosides-specific IIABC components from Streptococcus pneumoniae D39
31% identity, 73% coverage

• A non-linear deterministic model for regulation of diauxic lag on cellobiose by the pneumococcal multidomain transcriptional regulator CelR
  Boianelli, PloS one 2012
  • “...lag phase. Analysis of mutants for other PTS systems indicates that a second beta-glucoside PTS (spr0505), not able to support growth on cellobiose, is responsible for the lag during diauxic growth. A mathematical model of the process is devised together with a nonlinear identification procedure which...”
  • “...the CelR EIIA domain is deduced from our growth phenotypes. The putative interaction of the spr0505 EIIBA domains with the PRD domains of CelR is shown as dashed line. In this work we address the contribution of phosphorylation of the phosphorylable cysteine in the EIIB domain...”
• A functional genomics approach to establish the complement of carbohydrate transporters in Streptococcus pneumoniae
  Bidossi, PloS one 2012
  • “...spr0356-8 PTS-Fru mtlAF indel mannitol mannitol [54] SP0474-6-8 SPG00432-4 spr0423-5 PTS-Lac indel mannose SP0577 SPG00525 spr0505 PTS-Glc bglP indel 1-O-Methyl--glucoside beta-glucosides [55] SP0645-6-7 SPG00585-6-7 spr0562-3-4 PTS-Gat gatABC conserved galactose galactose, lactose, galactitol [56] SP0758 SPG00690 spr0668 PTS-Glc malT conserved maltose, maltotriose, maltodextrin and glycogen maltose [58]...”
• Influences of capsule on cell shape and chain formation of wild-type and pcsB mutants of serotype 2 Streptococcus pneumoniae
  Barendt, Journal of bacteriology 2009
  • “...relative expression spr0088 spr0128 spr0446 spr0504 spr0505 spr0506 spr0778 spr0779 spr0780 Increased relative expression spr0096 spr0307 spr0445 spr0565...”
• The five homologous CiaR-controlled Ccn sRNAs of Streptococcus pneumoniae modulate Zn-resistance
  De, PLoS pathogens 2024
  • “...13.7 2.71 SPD_0460 dnaK protein chaperone 3.97 2.01 SPD_0501 licT -glucoside operon antiterminator 2.91 4.77 SPD_0502 bglF -glucoside PTS transporter subunit 3.07 5.65 SPD_0503 bglA-2 6-phospho--glucosidase 2.57 4.79 SPD_0615 glnH3 degenerate glutamine ABC transporter subunit 11.6 4.05 SPD_0616 glnQ3 glutamine ABC transporter subunit 8.90 3.07 SPD_0617...”
  • “...3.50 3.52 SPD_0474 blpZ immunity protein 2.40 2.05 SPD_0501 licT -glucoside operon antiterminator 2.91 5.26 SPD_0502 bglF -glucoside PTS transporter subunit 3.07 4.65 SPD_0503 bglA-2 6-phospho--glucosidase 2.57 3.75 SPD_0537 putative Zn-dependent protease 2.07 2.21 SPD_0615 glnH3 degenerate glutamine ABC transporter subunit 11.6 18.0 SPD_0616 glnQ3 glutamine...”
• Inactivation of Transcriptional Regulator FabT Influences Colony Phase Variation of Streptococcus pneumoniae
  Zhang, mBio 2021
  • “...SPD_0453 hsdS Restriction endonuclease subunit S 2.93 0.000 SPD_0501 licT Transcription antiterminator Lict 1.95 0.000 SPD_0502 PTS glucose transporter subunit IIA 1.67 0.000 SPD_0503 bglA-2 6-Phospho-beta-glucosidase 1.69 0.000 SPD_0646 DegV family protein 1.49 0.000 SPD_0670 VanZ family protein 0.62 0.042 SPD_0671 ABC transporter ATP-binding protein 0.80...”
• Pivotal Roles for Ribonucleases in Streptococcus pneumoniae Pathogenesis
  Sinha, mBio 2021
  • “...dnaJ Chaperone protein DnaJ 2.96 6.49E09 SPD_0501 bglG Beta-glucoside bgl operon antiterminator BglG 13.4 2.46E20 SPD_0502 bglF Beta-glucoside-specific IIBCA components 11.0 2.14E38 SPD_0503 bglA-2 6-Phospho-beta-glucosidase 7.51 4.26E39 SPD_0522 vex2 ABC transporter ATP-binding protein Vex2 1.82 1.82E03 SPD_0523 vex3 Peptide ABC transporter membrane-spanning permease Vex3 1.85 9.48E04...”
• Interplay Between Capsule Expression and Uracil Metabolism in Streptococcus pneumoniae D39
  Carvalho, Frontiers in microbiology 2018
  • “...among the differentially expressed genes (Table S3 ). Noteworthy, eight PTS uptake systems ( spd_0066-9, spd_0502, spd_0559-61, spd_0661, spd_1047-8, spd_1057, spd_1959 , and spd_1992-89 ), and the enzymes involved in the metabolism of the PTS-incoming sugars ( spd_0063, spd_0065, spd_0070-1, spd_0503, spd_0562, spd_1046, spd_1958-7 , and...”
• Pneumococcal 6-Phospho-β-Glucosidase (BglA3) Is Involved in Virulence and Nutrient Metabolism
  Terra, Infection and immunity 2016
  • “...the strains mutated in 6-phospho--glucosidase genes, in SPD_0277, SPD_0502, or both, could grow as well as the wild-type strain on cellobiose, showing that it...”
• Ascorbic acid-dependent gene expression in Streptococcus pneumoniae and the activator function of the transcriptional regulator UlaR2
  Afzal, Frontiers in microbiology 2015
  • “...spd_0169 Riboflavin biosynthesis protein, RibD 2.1 spd_0262 PTS system, mannose/fructose/sorbose family protein, IID component 2.2 spd_0502 PTS system, beta-glucosides-specific IIABC components 2.3 spd_0503 6-Phospho-beta-glucosidase, BglA-2 2.9 spd_0773 PTS system, fructose specific IIABC components 2.4 spd_0888 Adhesion lipoprotein, AdcAII/LmB 3.2 spd_0889 Pneumococcal histidine triad protein D, PhtD...”
• Transcriptional and metabolic effects of glucose on Streptococcus pneumoniae sugar metabolism
  Paixão, Frontiers in microbiology 2015
  • “...phosphotransferase system IIC component 1.91 2.24 1.61 SPD_0360 mtlA PTS system, mannitol-specific IIBC components 0.62 SPD_0502 PTS system, beta-glucosides-specific IIABC components 0.65 0.47 0.73 SPD_0559 PTS system IIA component, putative 1.26 SPD_0560 PTS system, IIB component, putative 1.21 SPD_0561 PTS system, IIC component, putative 1.55 SPD_0661...”

LGG_00603 PTS system, beta-glucoside-specific IIABC component from Lactobacillus rhamnosus GG
30% identity, 58% coverage

• Polymorphisms, Chromosomal Rearrangements, and Mutator Phenotype Development during Experimental Evolution of Lactobacillus rhamnosus GG
  Douillard, Applied and environmental microbiology 2016
  • “...protein (LGG_01708), ABC transporter (LGG_01853), PTS protein (LGG_00603), and other putative/conserved proteins. The reconstruction of the isolate tree (Fig....”

LLNZ_02350 PTS transporter subunit EIIC from Lactococcus cremoris subsp. cremoris NZ9000
llmg_0454 putative beta-glucosides-specific IIBC component from Lactococcus lactis subsp. cremoris MG1363
30% identity, 74% coverage

• Genomics and transcriptomics analysis reveals the mechanism of isobutanol tolerance of a laboratory evolved Lactococcus lactis strain
  Gupta, Scientific reports 2020
  • “...and sucrose metabolism 19 LLNZ_09415 Menaquinone biosynthesis related protein Ubiquinone and other terpenoid-quinone biosynthesis 20 LLNZ_02350 Beta-glucoside-specific PTS system IIABC component Phosphotransferase system (PTS) 21 LLNZ_01670 Nisin biosynthesis two-component system, sensor histidine kinase NisK Two-component system 22 LLNZ_06705 ATP phosphoribosyltransferase regulatory subunit Histidine metabolism 23 LLNZ_02765...”
  • “...like the (PTS system, mannitol-specific IIBC (LLNZ_00105), glycerol uptake facilitator (LLNZ_05675), beta-glucoside-specific PTS system IIABC (LLNZ_02350), sucrose-specific PTS system IIBC (LLNZ_07350) etc.) were also found to be highly upregulated in our study. This demonstrates that the cell had reprogrammed its machinery for sugar uptake while trying...”
• The hierarchy of sugar catabolization in Lactococcus cremoris
  Douwenga, Microbiology spectrum 2023
  • “...and glucose-grown cells. In galactose- and lactose-grown cells, we did not detect the transmembrane component Llmg_0454, even though this is part of the trehalose transporter complex, which consists of components Llmg_0453 and Llmg_0454. Potentially, Llmg_0454 was not found due to technical limitations in membrane protein detection...”
  • “...case, we would expect to find the catabolization capacity of trehalose in galactose-grown cells, where Llmg_0454 is the only missing component. Potentially, the trehalose catabolization rate was below the detection limit for galactose-grown cells. In glucose- and lactose-grown cells, other trehalose pathway proteins are also missing,...”
• Early Transcriptome Response of Lactococcus lactis to Environmental Stresses Reveals Differentially Expressed Small Regulatory RNAs and tRNAs
  van, Frontiers in microbiology 2017
  • “...0.7 2.2 0.6 NCDO_2384 llmg_2477 lysP : Lysine-specific permease 8.0 2.1 4.9 TRANSPORTERS, ABC/PTC/PORIN NCDO_0184 llmg_0454 bglP: PTS system. trehalose-specific IIB component 17.4 2.4 3.2 NCDO_0191 llmg_0446 msmK: Multiple sugar ABC transporter. ATP-binding protein 3.0 4.4 3.8 15.4 NCDO_0199 llmg_0438 ptcA: PTS system. cellobiose-specific IIA component...”
• Engineering trehalose synthesis in Lactococcus lactis for improved stress tolerance
  Carvalho, Applied and environmental microbiology 2011
  • “...(2). The trehalose catabolic genes llmg_0453, llmg_0454, trePP, and pgmB, encoding the trehalose-PTS PTSTre, Tre6P phosphorylase, and -phosphoglucomutase,...”
• Genome sequences of Lactococcus lactis MG1363 (revised) and NZ9000 and comparative physiological studies
  Linares, Journal of bacteriology 2010
  • “...uptake (7), and the trehalose utilization operon of llmg_0454 and trePP. The genes for further downstream steps of carbohydrate utilization, such as pfk, pyk,...”
  • “...Mannitol PTS system mtlR mtlA mtlF mtlD Trehalose metabolism llmg_0454 trePP Other msmK Amino acid transport and metabolism pepN argG argH argE argB argF gltS...”
• Towards enhanced galactose utilization by Lactococcus lactis
  Neves, Applied and environmental microbiology 2010
  • “...llmg_0438 (ptcA) llmg_0440 (ptcC) llmg_0453 (yedE) llmg_0454 (yedF) llmg_0727 (ptnD) llmg_0728 (ptnC) llmg_0729 (ptnAB) llmg_0865 llmg_0866 llmg_0867 llmg_0963...”
  • “...genes encoding the putative trehalose PTS (llmg_0453 and llmg_0454) showed significantly altered expression levels in an L. lactis ccpA mutant (40, 66)....”

SP_0577 PTS system, beta-glucosides-specific IIABC components from Streptococcus pneumoniae TIGR4
31% identity, 73% coverage

• ManLMN is a glucose transporter and central metabolic regulator in Streptococcus pneumoniae
  Fleming, Molecular microbiology 2016
  • “...small protein promoter SP_0576-0578* SP_0576 SP_0577 LicT transcriptional antiterminator b-Glucoside specific PTS system EIIABC SP_0875-0877* SP_0877...”
• Structural insights into the substrate specificity of a 6-phospho-β-glucosidase BglA-2 from Streptococcus pneumoniae TIGR4
  Yu, The Journal of biological chemistry 2013
  • “...antiterminator LicT (SP_0576) and a downstream gene BglP (SP_0577) encoding a -glucoside PEP-PTS transporter. This operon is present in a number of species,...”
  • “...S. pneumoniae TIGR4 reveals three PEP-PTS systems (SP_0303-10, SP_0577, and SP_2021-4), and a sugar efflux transporter that may participate in the utilization...”

PTXBC_STAA3 / Q2FK70 PTS system MurNAc-GlcNAc-specific EIIBC component; EC 2.7.1.- from Staphylococcus aureus (strain USA300) (see paper)
W8U768 PTS system MurNAc-GlcNAc-specific EIIBC component from Staphylococcus aureus
Q2G1G5 PTS system MurNAc-GlcNAc-specific EIIBC component from Staphylococcus aureus (strain NCTC 8325 / PS 47)
SA0186 hypothetical protein from Staphylococcus aureus subsp. aureus N315
SAV0192 similar to PTS system sucrose-specific IIBC component from Staphylococcus aureus subsp. aureus Mu50
SAOUHSC_00158 PTS system component from Staphylococcus aureus subsp. aureus NCTC 8325
SAUSA300_0194 sucrose-specific PTS tranporter protein from Staphylococcus aureus subsp. aureus USA300_FPR3757
MW0166 ORFID:MW0166~hypothetical protein, similar to sucrose phosphotransferase enzyme II from Staphylococcus aureus subsp. aureus MW2
NWMN_0136 sucrose-specific PTS transporter IIBC component protein from Staphylococcus aureus subsp. aureus str. Newman
SACOL0178 PTS system, IIBC components from Staphylococcus aureus subsp. aureus COL
31% identity, 92% coverage

• function: The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. This system is involved in the uptake and phosphorylation of MurNAc-GlcNAc, the principle peptidoglycan turnover product of S.aureus, yielding cytoplasmic MurNAc 6P-GlcNAc.
  catalytic activity: N-acetyl-beta-D-muramate-(1->4)-N-acetyl-D-glucosamine(out) + N(pros)-phospho-L-histidyl-[protein] = 6-phospho-N-acetyl-beta-D- muramate-(1->4)-N-acetyl-D-glucosamine(in) + L-histidyl-[protein] (RHEA:66784)
  disruption phenotype: Cells lacking this gene show an extracellular accumulation of the disaccharide turnover product MurNAc-GlcNAc, but do not accumulate MurNAc.
• Exploring the potential of bis(thiazol-5-yl)phenylmethane derivatives as novel candidates against genetically defined multidrug-resistant Staphylococcus aureus
  Kavaliauskas, PloS one 2024
  • “...MurF, MurG, MurP, MurQ and MurZ (with accession number Q6G7L0, Q5HE76, Q2FXJ0, P0A090, Q2FWH4, Q5HG02, W8U768, Q7A1Y2 and A0A2S6DFC3, respectively). Docking of ligand-protein interaction We resorted to virtual screening using Autodock Vina, a target-specific scoring method useful for virtual screening [ 21 23 ]. The derivatives...”
  • “...) entries: MurA1 (Q6G7L0), MurA2 (Q5HE76), MurC (Q2FXJ0), MurD (P0A090), MurF (Q2FWH4), MurG (Q5HG02), MurP (W8U768), MurQ (Q7A1Y2) and MurZ (A0A2S6DFC3). Proteins with their respective ( PDB ) entries: MurB (1HSK), MurE (4C12) and MurT (6GS2). After performing the initial calculations and identifying S . aureus...”
• Isocyanides inhibit bacterial pathogens by covalent targeting of essential metabolic enzymes
  Geißler, Chemical science 2024
  • “...some play crucial roles in the cell wall recycling process: murP (MurNAcGlcNAc transporter; Uniprot ID: Q2G1G5), mupG (6-phospho- N -acetylmuramidase; Uniprot ID: Q2G1G7) and murQ ( N -acetylmuramic acid 6-phosphate etherase; Uniprot ID: Q2G1G6). Also enzymes of the peptidoglycan hydrolysis, recycling, and salvaging pathways (bifunctional autolysin...”
• Comparative Target Analysis of Chlorinated Biphenyl Antimicrobials Highlights MenG as a Molecular Target of Triclocarban
  Macsics, Applied and environmental microbiology 2020 (secret)
• Exposure of clinical MRSA heterogeneous strains to β-lactams redirects metabolism to optimize energy production through the TCA cycle
  Keaton, PloS one 2013
  • “...(PTS, glucose-specific). SA2434 4.2 PTS system EIIBC component Putative phosphotransferase transport system (PTS), EIIBC component. SA0186 ptsG 4 PTS system glucoside-specific IICBA component Phosphotransferase transport system (PTS), glucoside specific. SA0325 glpT 2.7 glycerol-3-phosphate transporter Transport of glycerol-3-P. SA1533 ackA 3.1 acetate/propionate kinase Involved in pyruvate, propanoate,...”
• Direct targets of CodY in Staphylococcus aureus
  Majerczyk, Journal of bacteriology 2010
  • “...11.7 Transport Amino acid and peptide transport SA0185 SA0186 SA0187 SA0188 SA0991 SA0992 SA0993 SA0994 SA0185, SA0186, SA0187, ggt ggt oppB oppC oppD oppBCDF,...”
  • “...IGSA1963 IGSA0010, SA0011 IGSA028-SA0232 IGSA2322 IGSA0185, SA0186, SA0187, ggt IGoppBCDF, SA0995 IGSA2620 (SA2397 in N315) IGgltAB IGtyrA purEKCSQLFMNHD...”
• Effect of a glucose impulse on the CcpA regulon in Staphylococcus aureus
  Seidl, BMC microbiology 2009
  • “...genes contained putative cre -sites in their promoter regions, or as in the case of SA0186, SA0302, and gntP , belonged to an operon which contained a putative cre -site and were probably under the direct control of CcpA. The up-regulation of the glucose uptake protein...”
• Transcriptome and functional analysis of the eukaryotic-type serine/threonine kinase PknB in Staphylococcus aureus
  Donat, Journal of bacteriology 2009
  • “...arbutin-like IIBC component 3.1 2.9 Phosphotransferase system SA0186 SA0318 SA0320 SA1255 SA2114 glvC 2.8 2.0 1.7 Membrane bioenergetics (electron transport...”
• Living with an imperfect cell wall: compensation of femAB inactivation in Staphylococcus aureus
  Hübscher, BMC genomics 2007
  • “...the phosphotransferase system (PTS) ( scrA ), and a hypothetical protein similar to ScrA ( sa0186 ). Other genes encoding sugar transporters were also induced in BB1305, i.e. sa0208/sa0209 (permease homologue of a maltose/maltodextrin ABC transporter), sa0260 (hypothetical protein similar to the ribose transporter RbsU), and...”
• In vivo survival of teicoplanin-resistant Staphylococcus aureus and fitness cost of teicoplanin resistance
  McCallum, Antimicrobial agents and chemotherapy 2006
  • “...the step-selected teicoplanin-resistant mutant ORF no.a spa SA0185 SA0186 SA0309 SA1007 SA1160 geh nuc SA1898 SA2097 SA2206 SA2255 sbi opp-1A SA2252 opp-1D...”
• Reporter metabolite analysis of transcriptional profiles of a Staphylococcus aureus strain with normal phenotype and its isogenic hemB mutant displaying the small-colony-variant phenotype
  Seggewiss, Journal of bacteriology 2006
  • “...SA0640 0.00 0.00 0.00 0.00 2.52 0.20 0.20 2.01 SA0172 SA0186 SA0639 0.00 0.00 0.01 2.19 0.38 2.04 SA0531 SA0417 SA0655 SA0374 SA2053 SA2434 0.01 0.01 0.01 0.01...”
• Transcription profiling-based identification of Staphylococcus aureus genes regulated by the agr and/or sarA loci
  Dunman, Journal of bacteriology 2001
  • “...SA0253 SA0923 SA1517 SA1961 SA2424 SA0187 SA1140 SA2293 SA0186 SA0021 SA0212 SA0271 SA0363 SA0412 SA1618 SA1937 SA2378 SA2448 SA2430 SA2431 SA2463 SA0746 SA0107...”
• Transcriptomic and Metabolomic Analysis of a Fusidic Acid-Selected fusA Mutant of Staphylococcus aureus
  Gupta, Antibiotics (Basel, Switzerland) 2022
  • “...regard to carbohydrate transporters, 3 (SACOL2146, SACOL2552, and treP ) were downregulated and another 2 (SAV0192 and ptaA ) were upregulated ( Tables S1 and S2 ). The downregulation of SH10001st-2 genes directly involved in pyruvate metabolism (e.g., ddh , encoding D-lactate dehydrogenase, and adh1 ,...”
• Transcriptional Analysis of the Effects of Gambogic Acid and Neogambogic Acid on Methicillin-Resistant Staphylococcus aureus
  Hua, Frontiers in pharmacology 2019
  • “...2.67 3.49 SAV0104 None Na/Pi cotransporter 2.28 2.38 SAV0191 None N-acetylmuramic acid-6-phosphate etherase 2.9 3.42 SAV0192 None PTS system EIIBC component 2.5 2.82 SAV0193 None RpiR family transcriptional regulator 2.25 2.56 SAV0216 None arabinogalactan ABC transporter permease 1.91 2.17 SAV0217 None oxidoreductase 1.86 2.39 SAV0218 None...”
  • “...treatment with GA and NGA. In addition, after GA and NGA treatment, SAV0465 (N-acetylmuramoyl-L-alanine amidase), SAV0192 (N-acetylmuramic acid 6-phosphate etherase) and SAV0192 (phosphatase system sucrose-specific IIBC component) were significantly downregulated. Peptidoglycan forms an envelope structure in which bacteria maintain their morphology. This structure is formed by...”
• Genomic and Long-Term Transcriptomic Imprints Related to the Daptomycin Mechanism of Action Occurring in Daptomycin- and Methicillin-Resistant Staphylococcus aureus Under Daptomycin Exposure
  Cafiso, Frontiers in microbiology 2020
  • “...in SAOUHSC_00177 maltose ABC permease, in the SAOUHSC_02400 putative mannitol-specific PTS component, and in the SAOUHSC_00158 N -acetylmuramic acid transporter belonging to the phosphotransferase system. Cell adhesion Under-expression was shown in the serine-aspartate repeat-containing sdr D, a staphylococcal virulence factor. Unknown function Over-expression was observed in...”
• Lysogenization of Staphylococcus aureus RN450 by phages ϕ11 and ϕ80α leads to the activation of the SigB regulon
  Fernández, Scientific reports 2018
  • “...Up SAOUHSC_00070 sarS 3.26 4.73 Up SAOUHSC_00156 2.47 3.18 Up SAOUHSC_00157 murQ 3.13 4.18 Up SAOUHSC_00158 3.39 4.35 Up SAOUHSC_00160 2.31 3.46 Up SAOUHSC_00183 uhpT 3.72 7.31 Up SAOUHSC_00196 fadB 2.82 4.12 Up SAOUHSC_00257 0.48 0.28 SAOUHSC_00291 2.32 2.18 Up SAOUHSC_00317 2.81 3.78 Up SAOUHSC_00356 3.96...”
• Small RNA teg49 Is Derived from a sarA Transcript and Regulates Virulence Genes Independent of SarA in Staphylococcus aureus
  Manna, Infection and immunity 2018
  • “...downregulated (SAOUHSC_00121/capH, SAOUHSC_00241/rbsU, SAOUHSC_01147/murD, and SAOUHSC_00158), covering a wide range of genetic pathways ranging from metabolism...”
• Novel Regulation of Alpha-Toxin and the Phenol-Soluble Modulins by Peptidyl-Prolyl cis/trans Isomerase Enzymes in Staphylococcus aureus
  Keogh, Toxins 2019
  • “...Energy metabolism SAUSA300_0527 RpoB 2.87 Transcription SAUSA300_2059 AtpG 2.80 Energy metabolism SAUSA300_0528 RpoC 2.63 Transcription SAUSA300_0194 MurP 2.49 Cellular processes (includes toxins and virulence factors) SAUSA300_1565 2.40 Central intermediary metabolism SAUSA300_1685 2.28 Conserved hypothetical protein SAUSA300_2453 NcaC 2.23 Transport and binding proteins SAUSA300_2440 FnbB 2.17 Cell...”
• Recovery of the Peptidoglycan Turnover Product Released by the Autolysin Atl in Staphylococcus aureus Involves the Phosphotransferase System Transporter MurP and the Novel 6-phospho-N-acetylmuramidase MupG
  Kluj, Frontiers in microbiology 2018
  • “...USA300, the murQ etherase gene ( SAUSA300_0193 ) is encoded in an operon together with SAUSA300_0194 , encoding the enzyme IIB and IIC domains of the MurNAc PTS-transporter MurP, SAUSA300_0195 , encoding a MurR-like regulator, and SAUSA300_0192 , encoding a protein with unknown function ( Borisova...”
• Expanded Glucose Import Capability Affords Staphylococcus aureus Optimized Glycolytic Flux during Infection
  Vitko, mBio 2016
  • “...the 10 unique S.aureus alleles are predicted to encode glucose transporters: SAUSA300_0191 ( glcA ), SAUSA300_0194, SAUSA300_0236 ( glcC ), and SAUSA300_0259 (see TableS1 ). Importantly, glucose is (i) largely absent from the skin surface, (ii) the most abundant free carbohydrate in human serum, and (iii)...”
• Peptidoglycan Recycling in Gram-Positive Bacteria Is Crucial for Survival in Stationary Phase
  Borisova, mBio 2016
  • “...(hereinafter referred to as USA300), we identified orthologs of murQ ( SAUSA300_0193 ), murP ( SAUSA300_0194 ), and murR ( SAUSA300_0195 ) of E.coli , organized in a putative operon along with SAUSA300 _ 0192 , whose function is unknown. SAUSA300 _ 0193 0195 encode proteins...”
• Genetic structure of community acquired methicillin-resistant Staphylococcus aureus USA300
  Tewhey, BMC genomics 2012
  • “...family siderophore biosynthesis protein SAUSA300_0123 142320 G T S404I 1 0 sucrose-specific PTS tranporter protein SAUSA300_0194 226384 C T A153V 1 0 sucrose-specific PTS tranporter protein SAUSA300_0194 226642 G A G239D 0 1 choloylglycine hydrolase family protein SAUSA300_0269 321604 C A P194T 0 1 essC protein...”
• The SaeR/S gene regulatory system is essential for innate immune evasion by Staphylococcus aureus
  Voyich, The Journal of infectious diseases 2009
  • “...Inorganic ion transport and metabolism 2.10 ES MW0116 Inorganic ion transport and metabolism 2.14 ES MW0166 Carbohydrate transport and metabolism 2.03 ES MW0167 Transcription 2.00 ES MW0196 unknown 9.49 & 2.88 ME & ES MW0203 unknown 2.52 & 1.62 ME & ES MW0249 unknown 2.08 ES...”
• Inactivation of the Ecs ABC transporter of Staphylococcus aureus attenuates virulence by altering composition and function of bacterial wall
  Jonsson, PloS one 2010
  • “...component 18.0 42.0 mnhD monovalent cation/H + antiporter subunit D 1.9 NWMN_0048 drug transporter 2.0 NWMN_0136 PTS system component 2.7 NWMN_0153 maltose ABC transporter permease protein 2.7 NWMN_0154 maltose ABC transporter permease protein 2.5 NWMN_0199 PTS system IIA component 0.5 NWMN_0211 ABC transporter ATP-binding protein 1.9...”
• Identification of Staphylococcus aureus Cellular Pathways Affected by the Stilbenoid Lead Drug SK-03-92 Using a Microarray
  Schwan, Antibiotics (Basel, Switzerland) 2017
  • “...stress protein family Transporter SACOL0086 2.0 drug transporter, putative SACOL0155 5.7 cation efflux family protein SACOL0178 2.9 PTS system, IIBC components ( scrBC ) SACOL0400 2.6 ascorbate-specific PTS system subunit IIC ( ulaA ) SACOL0454 2.3 sodium:dicarboxylate symporter family protein SACOL1018 2.3 sodium:alanine symporter family protein...”
• Changes in the Staphylococcus aureus transcriptome during early adaptation to the lung
  Chaffin, PloS one 2012
  • “...vivo also included SACOL-2521, a protein, similar to glucarate transporters and sucrose-specific PTS transporter protein SACOL0178. Transcription of Na + /dicarboxylate symporter, SACOL1979, was lower by 7.3 and 2.4 fold after 30 in vivo compared to stationary phase and fresh LB conditions. Nucleosides, purines and pyrimidines...”
• A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome
  Becher, PloS one 2009
  • “...(GlpK), SACOL1319 (GlpF), SACOL0200, SACOL0407 (GlpT)], or consumption of alternative sugars [SACOL1393 (GlcT), SACOL2663, SACOL0516, SACOL0178, SACOL0224, SACOL2316]. Of the proteins down-regulated in stationary phase numerous could be assigned to the category of iron uptake facilitation [SACOL2010, SACOL2277, SACOL2167, SACOL0799, SACOL0099 (SirA), SACOL0704] or to the...”

SAR0193 sucrose-specific PTS tranporter protein from Staphylococcus aureus subsp. aureus MRSA252
31% identity, 92% coverage

• Altered quorum sensing and physiology of Staphylococcus aureus during spaceflight detected by multi-omics data analysis
  Hauserman, NPJ microgravity 2024
  • “...(Table 1 ) and upregulated expression of genes and/or proteins of several sugar transporters (SAR0235, SAR0193, SAR2244, SAR1803) (Supplemental Tables 1 3 ). Several members of TCA cycle, including CitZ, OdhA/B, and SdhA/B displayed increased protein abundance and/or gene expression in spaceflight samples. Altered levels of...”

VPA1744 putative PTS system, sucrose-specific IIBC component from Vibrio parahaemolyticus RIMD 2210633
33% identity, 89% coverage

• Identification of potential type III secretion proteins via heterologous expression of Vibrio parahaemolyticus DNA
  Zhou, Applied and environmental microbiology 2012
  • “...are associated with the flagella. Both vp2633 and vpa1744 are interesting findings because of the possible role of T3SS in nutrient acquisition during...”
  • “...carbohydrate transport and metabolism (19). Secretion of Vpa1744 is consistent with modification of sugar substrates in preparation for transport through the...”

CD0388 PTS system, beta-glucoside-specific IIabc component from Clostridium difficile 630
29% identity, 74% coverage

• Increased sporulation underpins adaptation of Clostridium difficile strain 630 to a biologically-relevant faecal environment, with implications for pathogenicity
  Ternan, Scientific reports 2018
  • “...encoding the IIABC component of the PTS system for uptake of beta-glucosides ( bglF , CD0388) was increased, as was the downstream gene bglA (CD0389) encoding 6-phospho-beta-glucosidase, reflective of the likely increased availability of such glucoside substrates 61 in the FW media. In addition, expression of...”

lp_0265 beta-glucosides PTS, EIIABC from Lactobacillus plantarum WCFS1
lp_0265 glucose PTS transporter subunit IIA from Lactiplantibacillus plantarum WCFS1
30% identity, 60% coverage

• Butanol Tolerance of Lactiplantibacillus plantarum: A Transcriptome Study
  Petrov, Genes 2021
  • “...sensitive strain 8-1. We observed the strongest downregulation among the PTS transporters in two C-subunits: lp_0265 and lp_0264. They were 14.69- and 25.45-fold downregulated in 8-1 and 18.57- and 38.68-fold in Ym1, respectively. Based on a 73.2% match with the respective proteins in Listeria monocytogenes ,...”
  • “...PTS N-acetylgalactosamine transporter IIC 12.45 2.88 lp_3009, pts23B PTS sugar transporter subunit IIB 2.19 3.02 lp_0265, pts5ABC PTS transporter subunit EIIC 18.57 14.69 lp_0264, pts4ABC PTS transporter subunit EIIC 38.68 25.45 lp_0170, dak3 PTS-dependent dihydroxyacetone kinase phosphotransferase subunit DhaM 4.86 164.91 * The difference in gene...”
• Transcriptomic Evidence of Molecular Mechanisms Underlying the Response of Lactobacillus Plantarum WCFS1 to Hydroxytyrosol
  Reverón, Antioxidants (Basel, Switzerland) 2020
  • “...transporters for these substances. These included the lp_3324 (glycine betaine/carnitine/choline transporter), lp_1722 (GABA transporter) and lp_0265 (trehalose PTS transport system) genes, which is coincident with the response of L. plantarum to p-coumaric acid [ 7 ], a phenolic compound that turns leaky the membrane of several...”
• Oleuropein Transcriptionally Primes Lactobacillus plantarum to Interact With Plant Hosts
  Santamaría, Frontiers in microbiology 2019
  • “...lp_0587 ), the sugar alcohol mannitol ( pts2CB or lp_0230 ), threalose ( pts5ABC or lp_0265 ), cellobiose ( pts6C or lp_0286 , pts20A or lp_2780 , pts20B or lp_2781 ) and fructose ( pts16ABC or lp_2097 ) were all induced in presence of OLE. In...”
• Transcriptional Reprogramming at Genome-Scale of Lactobacillus plantarum WCFS1 in Response to Olive Oil Challenge
  Esteban-Torres, Frontiers in microbiology 2017
  • “...3.04 lp_1449 Cell surface protein, CscB family 1.27 3.53 lp_2035 aroE 3-phosphoshikimate 1-carboxyvinyltransferase 1.34 3.71 lp_0265 pts5ABC PTS system trehalose-specific transporter subunit IIBC 2.16 3.23 lp_0007 gyrA DNA gyrase subunit A 0.69 2.93 Linear regression fit analysis was applied and correlation coefficient used to validate the...”
  • “...included those within the trehalose operon [ lp_0262 (transcriptional repressor)], lp_0263 (trehalose-6-phosphate hydrolase), lp_0264 and lp_0265 (PTS system trehalose-specific transporter subunits IIBC), the GABA transporter ( lp_1722 ) and two aquaporins ( lp_0372 and lp_3436 ), which were all downregulated. This profile indicates that these compatible...”
• Involvement of the mannose phosphotransferase system of Lactobacillus plantarum WCFS1 in peroxide stress tolerance
  Stevens, Applied and environmental microbiology 2010
  • “...1.43E-02 2.01 Transport and binding proteins lp_0180 lp_0265 lp_0315 msmK1 pts5ABC potD Multiple sugar ABC transporter, ATP-binding protein PTS system,...”

llmg_1045 similar to PTS system, beta-glucosides specific enzyme IIABC from Lactococcus lactis subsp. cremoris MG1363
32% identity, 62% coverage

• Genome sequences of Lactococcus lactis MG1363 (revised) and NZ9000 and comparative physiological studies
  Linares, Journal of bacteriology 2010
  • “...llmg_0910 llmg_0924 llmg_0944 llmg_0944 llmg_1011 llmg_1045 llmg_1101 llmg_1127 llmg_1128 llmg_pseudo_39 Asn3Ile Synonymous Asp3Glu Pro3Arg llmg_1306 llmg_1518...”
• Towards enhanced galactose utilization by Lactococcus lactis
  Neves, Applied and environmental microbiology 2010
  • “...llmg_0729 (ptnAB) llmg_0865 llmg_0866 llmg_0867 llmg_0963 llmg_1045 (ptbA) llmg_1244 llmg_1426 (yleD) llmg_1568 (fruA) llmg_pseudo54 (yidB) Familya VOL. 76,...”

LSEI_0631 beta-glucoside-specific PTS system IIABC component from Lactobacillus casei ATCC 334
28% identity, 66% coverage

• New Genes Involved in Mild Stress Response Identified by Transposon Mutagenesis in Lactobacillus paracasei
  Palud, Frontiers in microbiology 2018
  • “...for heat and salt stress, LSEI_0389 (putative pseudo gene) for heat and acid stress and LSEI_0631 for all stress conditions. For this last gene, encoding a putative PTS system, expressions were over 4.0 for heat (5.47 3.07), salt (4.45 1.11), acid (4.68 0.77), and oxidative (10.20...”
  • “...0.46 LSEI_0613 Transposase 3.73 1.61 * 4.62 0.85 * 1.08 0.28 1.20 0.19 1.32 0.,41 LSEI_0631 Beta-glucoside- PTS system 5.47 3.07 * 2.13 0.30 * 4.45 1.11 * 4.68 0.77 * 10.2 3.01 * LSEI_1111 HP 2.97 1.74 * 1.21 0.22 1.79 0.56 * 2.02 0.48...”

Z4023 PTS system enzyme II ABC (asc), cryptic, transports specific beta-glucosides from Escherichia coli O157:H7 EDL933
30% identity, 82% coverage

• Clonal and antigenic analysis of serogroup A Neisseria meningitidis with particular reference to epidemiological features of epidemic meningitis in the People's Republic of China
  Wang, Infection and immunity 1992
  • “...3 3 3 3 strains Z4047 Z4110 Z4048 Z4022 Z4107 Z4108 Z4023 Z4105 Z4090 Z4095 Z4094 Z4057 Z4060 Z4015 Z4746 Z4753 Z4063 Z4064 Z4055 Z4083 B40 B256 B373 B473 Z4756...”
  • “...Z4061 Z4755 Z4049, Z4741 Z4068 Z4072 Z4022 Z4107 Z4108 Z4023 Z4105, B499 Z4090, Z4114 Z4093 Z4111 Z4095 Z4094 Z4057 Z4060 Z4015 Z4746 Z4753 Z4063, Z4067, Z4074,...”

UTI89_C3077 PTS enzyme II-asc from Escherichia coli UTI89
30% identity, 82% coverage

• Genetic requirements for uropathogenic <i>E. coli</i> proliferation in the bladder cell infection cycle
  Mediati, mSystems 2024
  • “...2.93 1.48E-02 1.58E-01 UTI89_C0888 clpA Protease ATP-binding subunit (functions with clpP ) 2.83 3.14E-02 2.16E-01 UTI89_C3077 ascF Phosphotransferase enzyme II (group translocation) 2.82 1.46E-02 1.58E-01 UTI89_C4548 argE Acetylornithine deacetylase (ornithine/arginine biosynthesis) 2.32 2.91E-03 5.37E-02 UTI89_C3370 neuC Sialic acid biosynthesis (cell surface capsule biosynthesis) 2.20 7.64E-04 2.61E-02...”
• Glycosuria Alters Uropathogenic Escherichia coli Global Gene Expression and Virulence
  Islam, mSphere 2022
  • “...IIBC UTI89_C1975 gapA 0.0356 1.7083* 1.7599* Glyceraldehyde-3-phosphate dehydrogenase UTI89_C2058 pyk 0.5710 0.4195 1.0021* Pyruvate kinase UTI89_C3077 ascF 1.2493* 0.0906 1.3217* PTS cellobiose/arbutin/salicin transporter subunit IIBC UTI89_C3309 pgk 0.3316 0.6584 1.0055* Phosphoglycerate kinase UTI89_C3903 pckA 0.3553 2.8086* 2.4364* Phosphoenolpyruvate carboxykinase (ATP) UTI89_C4129 aldB 0.6100 2.1970* 2.7870* Aldehyde...”

Sac / b2715 β-glucoside specific PTS enzyme IIBC component (EC 2.7.1.199) from Escherichia coli K-12 substr. MG1655 (see paper)
ascF / P24241 β-glucoside specific PTS enzyme IIBC component (EC 2.7.1.199) from Escherichia coli (strain K12) (see 7 papers)
PTIBC_ECOLI / P24241 PTS system arbutin-, cellobiose-, and salicin-specific EIIBC component; EIIBC-Asc; EII-Asc; EC 2.7.1.- from Escherichia coli (strain K12) (see paper)
TC 4.A.1.2.3 / P24241 β-Glucoside [arbutin-salicin-cellobiose] (ASC) group translocator, AscF (see 5 papers)
b2715 fused cellobiose/arbutin/salicin-specific PTS enzymes: IIB component/IC component from Escherichia coli str. K-12 substr. MG1655
30% identity, 82% coverage

• function: The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active -transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. This system is involved in arbutin, cellobiose, and salicin transport
• substrates: Cellobiose, arbutin, salicin
• luxS-dependent gene regulation in Escherichia coli K-12 revealed by genomic expression profiling
  Wang, Journal of bacteriology 2005
  • “...b1482 b1461 b3267 b3110 yfiA osmC ydcE yhdV yhaO b2715 ascF b3108 b3109 yhaM yhaN a Gene product a Gene zraP ORF, hypothetical protein Putative ferredoxin...”
• Prominent roles of the NorR and Fur regulators in the Escherichia coli transcriptional response to reactive nitrogen species
  Mukhopadhyay, Proceedings of the National Academy of Sciences of the United States of America 2004
  • “...b2717 b0795 b1684 b0127 b4367 b2875 b3106 b4357 b2579 b0484 b3744 b4381 b3774 b0802 b2715 b1200 b1241 b1112 173 338 70 38 2 3 11 2 17 18 1 1 6 5 2 1 15 2 6 7 9...”
• Role of SeqA and Dam in Escherichia coli gene expression: a global/microarray analysis
  Løbner-Olesen, Proceedings of the National Academy of Sciences of the United States of America 2003
  • “...b1262 b1229 b1482 b1739 b4376 b2266 b2026 b2034 b3581 b2715 b2616 b3670 b4035 b2424 b2669 b0243 b4036 b4034 b2422 b2540 b2752 b2698 b2425 b1061 b0958 b1183...”

YE3690 photransferase system, IIBC component from Yersinia enterocolitica subsp. enterocolitica 8081
31% identity, 92% coverage

• Application of comparative phylogenomics to study the evolution of Yersinia enterocolitica and to identify genetic differences relating to pathogenicity
  Howard, Journal of bacteriology 2006
  • “...follows: indole, YE1222; xylose, YE2511 and YE4122; trehalose, YE3690, YE3773, YE3774, and YE3775. However, these CDSs were present in all test isolates; thus,...”

ECs3300 putative PTS enzyme II from Escherichia coli O157:H7 str. Sakai
34% identity, 91% coverage

• Global transcriptional response of Escherichia coli O157:H7 to growth transitions in glucose minimal medium
  Bergholz, BMC microbiology 2007
  • “...ECs3143 yfbG -2.50 1.03 5 ECs3144 yfbH -2.66 0.98 5 ECs3299 yfeU 2.39 -0.89 3 ECs3300 yfeV 2.28 -0.99 3 ECs3305 ypeA 2.05 -0.81 3 ECs3393 hscB -1.37 2.51 7 ECs3748 yqeB 2.23 -0.78 3 ECs4109 mdh 2.05 -1.40 un ECs4269 glpD 4.17 -1.82 3 ECs4408...”

Entcl_0992 PTS cellobiose/arbutin/salicin transporter subunit IIBC from [Enterobacter] lignolyticus SCF1
32% identity, 81% coverage

• Multi-time series RNA-seq analysis of Enterobacter lignolyticus SCF1 during growth in lignin-amended medium
  Orellana, PloS one 2017
  • “...is located in the same operon as the cellobiose-specific form of the phosphotransferase system component (Entcl_0992), suggesting the existence of an operon devoted to the degradation of components of plant material. Previous studies have shown glycoside hydrolases were abundant in a soil-derived consortia adapted to recalcitrant...”
  • “...Entcl_3004 6-phospho-beta-glucosidase (EC 3.2.1.86) 0.437 2.680 -0.150 Entcl_0991 6-phospho-beta-glucosidase (EC 3.2.1.86) ascB -0.915 1.496 -0.362 Entcl_0992 PTS system, arbutin-, cellobiose-, and salicin-specific IIBC component (EC 2.7.1.69) -0.653 2.291 0.463 Entcl_0735 putative laccase (EC 1.10.3.2) 0.523 -0.921 1.354 Entcl_0736 Probable Fe-S oxidoreductase family 2 1.516 1.037 1.106...”

ETEC_2906 PTS cellobiose/arbutin/salicin transporter subunit IIBC from Escherichia coli ETEC H10407
30% identity, 82% coverage

• The molecular basis for control of ETEC enterotoxin expression in response to environment and host
  Haycocks, PLoS pathogens 2015
  • “...) 3048307 TT TGA CGAGCA TCACC (ETEC_2822) (emrB) 3132920 G GTGA CCGGTT TCACA ETEC_2905 / ETEC_2906 ascG / ascF 3161660 TGTGA CCGTGG TC G CA ( ETEC_2933 ) ( nlpD ) 3184337 CG TGA TGCGTG T A ACA (ETEC_2956)/ETEC_2955 (cysI)/cysH 3196088 TGTGA TTACGA TCACA ETEC_2966 /...”

lp_0886 beta-glucosides PTS, EIIBC from Lactobacillus plantarum WCFS1
lp_0886 PTS transporter subunit EIIC from Lactiplantibacillus plantarum WCFS1
28% identity, 89% coverage

• Butanol Tolerance of Lactiplantibacillus plantarum: A Transcriptome Study
  Petrov, Genes 2021
  • “...PTS cellobiose transporter subunit IIC +2.55 NC lp_2531, pts18CBA PTS transporter subunit EIIC NC +3.22 lp_0886, pts11BC PTS transporter subunit EIIC NC 3.91 lp_3240, pts28ABC PTS transporter subunit EIIC NC 2.19 lp_0436, pts7C PTS sugar transporter subunit IIC NC 17.13 lp_3507, pts29C PTS sugar transporter subunit...”

SMU_980, SMU_RS04505 beta-glucoside-specific PTS transporter subunit IIABC from Streptococcus mutans UA159
27% identity, 70% coverage

• Cnm of Streptococcus mutans is important for cell surface structure and membrane permeability
  Naka, Frontiers in cellular and infection microbiology 2022
  • “...ABC transporter ATP-binding protein 1028135 SMU_731 2.372 bglP PTS system beta-glucoside-specific transporter subunit II 1028324 SMU_980 2.359 potA Spermidine/putrescine ABC transporter ATP-binding protein 1028319 SMU_973 2.272 glnQ Amino acid ABC transporter ATP-binding protein 1028758 SMU_1519 2.233 SMU_567 Glutamine ABC transporter permease 1029364 SMU_567 2.125 SMU_1078c ABC...”
• Identification of the antibacterial action mechanism of diterpenoids through transcriptome profiling
  Moon, Frontiers in microbiology 2022
  • “...1.39 3.48 2.10 2.37 SMU_RS08435 PTS beta-glucoside transporter subunit IIBCA scrA 0.68 3.83 2.06 2.13 SMU_RS04505 PTS transporter subunit EIIC bglP 0.62 4.11 2.20 2.14 SMU_RS06770 PTS transporter subunit EIIC lacE 0.65 1.42 1.45 1.69 SMU_RS07235 PTS cellobiose transporter subunit IIC ptcC 1.32 2.91 2.83 3.10...”

MurP / b2429 N-acetylmuramic acid-specific PTS enzyme IICB component / anhydro-N-acetylmuramic acid transporter (EC 2.7.1.192) from Escherichia coli K-12 substr. MG1655 (see 4 papers)
MurP / P77272 N-acetylmuramic acid-specific PTS enzyme IICB component / anhydro-N-acetylmuramic acid transporter from Escherichia coli (strain K12) (see 3 papers)
PTYBC_ECOLI / P77272 PTS system N-acetylmuramic acid-specific EIIBC component; EIIBC-MurNAc; EC 2.7.1.192 from Escherichia coli (strain K12) (see 3 papers)
P77272 protein-Npi-phosphohistidine-N-acetylmuramate phosphotransferase (EC 2.7.1.192) from Escherichia coli (see paper)
TC 4.A.1.2.7 / P77272 N-Acetylmuramic acid porter, MurP (YfeV) from Escherichia coli (see 7 papers)
b2429 N-acetylmuramic acid phosphotransfer permease from Escherichia coli str. K-12 substr. MG1655
SF5M90T_2419 PTS N-acetylmuramic acid transporter subunit IIBC from Shigella flexneri 5a str. M90T
33% identity, 91% coverage

• function: The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. This system is involved in N-acetylmuramic acid (MurNAc) transport, yielding cytoplasmic MurNAc-6-P. Is responsible for growth on MurNAc as the sole source of carbon and energy. Is also able to take up anhydro-N- acetylmuramic acid (anhMurNAc), but cannot phosphorylate the carbon 6, probably because of the 1,6-anhydro ring.
  catalytic activity: N-acetyl-beta-D-muramate(out) + N(pros)-phospho-L-histidyl- [protein] = N-acetyl-beta-D-muramate 6-phosphate(in) + L-histidyl- [protein] (RHEA:33399)
• substrates: N-acetylmuramic acid
• Identification of a phosphotransferase system of Escherichia coli required for growth on N-acetylmuramic acid
  Dahl, Journal of bacteriology 2004
  • “...database search revealed a candidate PTS-EIIBC (b2429, Swiss-Prot P77272) (Fig. 2, YFEV_ECOLI). This gene was predicted to contain solely an EIIBC domain and...”
• In vitro transcription profiling of the σS subunit of bacterial RNA polymerase: re-definition of the σS regulon and identification of σS-specific promoter sequence elements
  Maciag, Nucleic acids research 2011
  • “...hyaABCDEF operon b0977 1.50 as hyaA syd SecY-interacting protein b2793 1.59 murP Acetyl-muramic acid permease b2429 1.59 CRP, MurR ( 73 ) murR Transcriptional repressor of murQP b2427 1.62 tam Trans-aconitate methylatransferase b1519 1.60 S ( 74 ) ydhY Predicted oxidoreductase, Fe-S protein; in ydhYVWXUT operon...”
• Identification of a phosphotransferase system of Escherichia coli required for growth on N-acetylmuramic acid
  Dahl, Journal of bacteriology 2004
  • “...A genomic database search revealed a candidate PTS-EIIBC (b2429, Swiss-Prot P77272) (Fig. 2, YFEV_ECOLI). This gene was predicted to contain solely an EIIBC...”
• DNA microarray analyses of the long-term adaptive response of Escherichia coli to acetate and propionate
  Polen, Applied and environmental microbiology 2003
  • “...2003 1767 TABLE 1--Continued Gene Operon organization Name b2428 b2429 b2430 b2428 b2429 b2430 2 2 2 b2535 csiE b2537 Avg relative mRNA levels obtained on LB...”
• RNA-seq analysis of the influence of anaerobiosis and FNR on Shigella flexneri
  Vergara-Irigaray, BMC genomics 2014
  • “...protein 2.71 SF5M90T_1101 ptsG PTS system, glucose-specific IIBC component 2.27 SF5M90T_3491 treF cytoplasmic trehalase 2.12 SF5M90T_2419 murP PTS system N-acetylmuramic acid transporter subunits EIIBC 2.09 -0.71 SF5M90T_3499 pfkA 6-phosphofructokinase I 2.08 SF5M90T_2096 fructose-bisphosphate aldolase 2.02 2.08 1.86 SF5M90T_1001 agp periplasmic glucose-1-phosphatase 2.00 1.40 1.57 SF5M90T_2887 rpiA...”

CD3097 PTS system, IIabc component from Clostridium difficile 630
30% identity, 61% coverage

• Ferric Uptake Regulator Fur Control of Putative Iron Acquisition Systems in Clostridium difficile
  Ho, Journal of bacteriology 2015
  • “...(effD) cd2241-39 (nanE-nanA) cd2276 cd2738-2737 cd0902 cd3096-3095 cd3097 cd0899 (dinB) cd2593 cd0332 (bclA1) cd2230 (nirC) cd2629 (spoIVA) cd2055 cd0587-0588...”

TC 4.A.1.2.6 / Q9KJ80 β-glucoside (Aesculin/arbutin) porter, BglP from Streptococcus mutans (see paper)
27% identity, 70% coverage

• substrates: arbutin

SERP1900 PTS system, IIBC components from Staphylococcus epidermidis RP62A
SE1890 PTS system sucrose-specific IIBC component from Staphylococcus epidermidis ATCC 12228
30% identity, 93% coverage

• Skin-to-blood pH shift triggers metabolome and proteome global remodelling in Staphylococcus epidermidis
  Gonçalves, Frontiers in microbiology 2022
  • “...substrates concomitantly with their translocation across the cell membrane. Four proteins from this system (PtsG, SERP1900, SERP1968 and SERP2260) specific for glucose, sucrose and fructose transport, and enzymes generating phosphoenolpyruvate from oxaloacetate (PckA) and pyruvate (PpdK and its regulator SERP2169) support the fuelling of glycolysis in...”
• Deciphering the Antibacterial Mode of Action of Alpha-Mangostin on Staphylococcus epidermidis RP62A Through an Integrated Transcriptomic and Proteomic Approach
  Sivaranjani, Frontiers in microbiology 2019
  • “...0 . 003 INF 0 . 003 SERP1872 ureE Urease accessory protein UreE INF 0.003 SERP1900 PTS system, IIBC components INF 0.003 SERP1407 Conserved hypothetical protein INF 0 . 003 INF 0 . 003 SERP1131 Conserved hypothetical protein INF 0 . 003 INF 0 . 003...”
• Identification of antigenic components of Staphylococcus epidermidis expressed during human infection
  Pourmand, Infection and immunity 2006
  • “...L-Lactate 14 1925763-1928363 SE1889 (37-295) SE1890 (1-474) SE1891 (1-124) Conserved hypothetical protein Phosphotransferase system sucrose-specific IIBC...”

llmg_1426 sucrose-specific PTS system IIBC component from Lactococcus lactis subsp. cremoris MG1363
LLNZ_07350 glucose PTS transporter subunit IIA from Lactococcus cremoris subsp. cremoris NZ9000
30% identity, 60% coverage

• Adaptation of Lactococcus lactis to high growth temperature leads to a dramatic increase in acidification rate
  Chen, Scientific reports 2015
  • “...llmg_1474 1.4 9.9E-06 Putative voltage gated chloride channel comGC 1.4 2.6E-08 Putative competence protein ComGC llmg_1426 1.5 3.0E-06 Sucrose-specific PTS system IIBC component comGA 1.6 5.5E-09 Putative competence protein ComGA cbiQ 1.6 3.3E-09 Putative cobalt ABC transporter permease protein arcD1 1.7 4.7E-07 Arginine/ornithine antiporter nha 2.0...”
• Towards enhanced galactose utilization by Lactococcus lactis
  Neves, Applied and environmental microbiology 2010
  • “...llmg_0866 llmg_0867 llmg_0963 llmg_1045 (ptbA) llmg_1244 llmg_1426 (yleD) llmg_1568 (fruA) llmg_pseudo54 (yidB) Familya VOL. 76, 2010 GALACTOSE METABOLISM...”
• Genomics and transcriptomics analysis reveals the mechanism of isobutanol tolerance of a laboratory evolved Lactococcus lactis strain
  Gupta, Scientific reports 2020
  • “...transcripts calculated from RNA-seq and RT-qPCR. S. No Locus_tag Annotation LogFC RNA-seq LogFC RT-qPCR 1 LLNZ_07350 Sucrose specific PTS system IIBC component 5.48 2 2 LLNZ_02240 Carbon starvation protein A 4.3 2.45 3 LLNZ_09555 Multidrug resistance ABC transporter ATP-binding and permease protein 2.84 4.1 5 LLNZ_05785...”
  • “...synthase Arginine biosynthesis 7 LLNZ_06600 Acetolactate synthase catalytic subunit Valine, leucine and isoleucine biosynthesis 8 LLNZ_07350 Sucrose-specific PTS system IIBC component Phosphotransferase system (PTS) 9 LLNZ_01385 Fructose-1,6-bisphosphatase class 3 Glycolysis/gluconeogenesis 10 LLNZ_05080 Phosphoribosylaminoimidazole synthetase Purine metabolism 11 LLNZ_10425 ABC-type oligopeptide transport system, periplasmic component Quorum sensing...”

VC0207 PTS system, sucrose-specific IIBC component, putative from Vibrio cholerae O1 biovar eltor str. N16961
33% identity, 80% coverage

• A simple mechanism for integration of quorum sensing and cAMP signalling inV. cholerae
  Walker, 2023
• Second-generation recombination-based in vivo expression technology for large-scale screening for Vibrio cholerae genes induced during infection of the mouse small intestine
  Osorio, Infection and immunity 2005
  • “...proteins from the TRAP transport systems), VC0207 (PTS system, sucrose-specific IIBC component), VC0201-0202-0203 [iron(III) ABC transporter components;...”
  • “...VC2487 VC2641 VC0488 VC0063 VCA1057 VCA0773 VC0622 VC1111 VC0207 VC0721 VC1658 VC2373 VC0201 VCA0529 VC0874 VC1173 VC0202 VC0203 VC1137 VC1535 VC1275 VC0130...”
• Characterization of Vibrio cholerae RyhB: the RyhB regulon and role of ryhB in biofilm formation
  Mey, Infection and immunity 2005
  • “...VC0201 (2.5) FeoABc ............................................................VC0207 (2.2), VC2078 (2.8) Enterobactin receptor...”
• Unraveling the secret lives of bacteria: use of in vivo expression technology and differential fluorescence induction promoter traps as tools for exploring niche-specific gene expression
  Rediers, Microbiology and molecular biology reviews : MMBR 2005
  • “...uptake Phosphotransferase systems celB pts14C ptsIBCA pts32BC vc0207 orf5-iviL Organism Host or environment Selection Reference gfp-LA gfp-LA purA DFI 299 299...”

CD3137 PTS system, IIabc component from Clostridium difficile 630
29% identity, 63% coverage

• Pleiotropic role of the RNA chaperone protein Hfq in the human pathogen Clostridium difficile
  Boudry, Journal of bacteriology 2014
  • “...CD3030), one mannose (CD3013-CD3015), and one betaglucoside-specific (CD3137) transporter were downregulated in the Hfq-depleted strain while genes encoding a...”
• Temporal differential proteomes of Clostridium difficile in the pig ileal-ligated loop model
  Janvilisri, PloS one 2012
  • “...proteins involved in carbohydrate utilization through phosphotransferase systems (PTS) including PtsG (CD2667), MalX (CD3030), and CD3137 were down-regulated, others including CD0287, GatC (CD2325), PtsH (CD2756), CD3068, and CD3069 were found to be up-regulated. These results suggest that the changes in metabolic states of C. difficile within...”

R4Y45_00085 PTS transporter subunit EIIC from Holzapfeliella sp. He02
29% identity, 86% coverage

• <i>Holzapfeliella saturejae</i> sp. nov. isolated from flowers of winter savoury <i>Satureja montana</i> L
  Alcántara, International journal of systematic and evolutionary microbiology 2025
  • “...HPr of the PTS. It also encoded a few IIA (locus R4Y45_02965) and IIC (loci R4Y45_00085, R4Y45_00770, R4Y45_00775, R4Y45_05800 and R4Y45_06540) sugar-specific components of PTS transporters, although they appear incomplete or as remnants and did not seem to conform functional PTSs (Fig. S5). The inspection of...”

EF2435 PTS system, IIBC components from Enterococcus faecalis V583
28% identity, 94% coverage

• Genes Contributing to the Unique Biology and Intrinsic Antibiotic Resistance of Enterococcus faecalis
  Gilmore, mBio 2020
  • “...which is structurally related to so_3166 from the Shewanella oneidensis so_3166/so_3165 toxin/antitoxin pair. Phyre2 found EF2435 to be highly structurally related to bipartite nucleotidyltransferase genes, including so_3165, encoding the catalytic domain (99.9% certainty over 89% length). The structurally similar so_3166/so_3165 toxin/antitoxin system has been studied in...”

BF29_RS07275 PTS transporter subunit EIIC from Heyndrickxia coagulans DSM 1 = ATCC 7050
26% identity, 92% coverage

• Time-resolved transcriptomic and proteomic profiling of <i>Heyndrickxia coagulans</i> during NaOH-buffered L-lactic acid production
  Huang, Frontiers in microbiology 2023
  • “...their corresponding expression trends. BF29_RS07280 is a member of an operon comprising four genes (BF29_RS07270, BF29_RS07275, and BF29_RS07285), which are predicted to be involved in peptidoglycan recycling. These genes were also found to exhibit significant upregulation after 15h. Peptidoglycan recycling refers to the bacterial importation of...”

Q46072 protein-Npi-phosphohistidine-D-mannose phosphotransferase (EC 2.7.1.191); protein-Npi-phosphohistidine-D-glucose phosphotransferase (EC 2.7.1.199) from Corynebacterium glutamicum (see 2 papers)
ptsM / AAA53546.1 phosphoenolpyruvate sugar phosphotransferase from Corynebacterium glutamicum (see 2 papers)
cg1537 glucose-specific enzyme II BC component of PTS from Corynebacterium glutamicum ATCC 13032
NCgl1305 glucose PTS transporter subunit IIA from Corynebacterium glutamicum ATCC 13032
29% identity, 66% coverage

• CRISPRi-Library-Guided Target Identification for Engineering Carotenoid Production by Corynebacterium glutamicum
  Göttl, Microorganisms 2021
  • “...plasmid carrying the pta (cg3048) sgRNA This work pS_dCas9_ ptsG pS_dCas9 plasmid carrying the ptsG (cg1537) sgRNA This work pS_dCas9_ pyc pS_dCas9 plasmid carrying the pyc (cg0791) sgRNA This work pS_dCas9_ pyk pS_dCas9 plasmid carrying the pyk (cg2291) sgRNA This work pS_dCas9_ ramB pS_dCas9 plasmid carrying...”
• HrrSA orchestrates a systemic response to heme and determines prioritization of terminal cytochrome oxidase expression
  Keppel, Nucleic acids research 2020
  • “...Glucose uptake cg2121 ptsH Phosphocarrier protein HPr, general component of PTS 70 2.1 1.2 0.3 cg1537 ptsG Glucose-specific EIIABC component EIIGlc of PTS 70 1.6 1.1 0.1 cg2091 ppgG Polyphosphate glucokinase 199 266 0.2 0.8 cg0223 iolT1 Myo-Inositol transporter 1, alternative glucose uptake system 73 2.0...”
• Identifying the Growth Modulon of Corynebacterium glutamicum
  Haas, Frontiers in microbiology 2019
  • “...to that of the growth rate. The same trend was true for the genes, ptsG (cg1537) and ptsI (cg2117), encoding the glucose uptake system as well as the gene encoding iolT1 (cg0223) which has been shown to also enable glucose uptake. Genes ppgk (cg2091) and cg2932...”
• Substrate-dependent cluster density dynamics of Corynebacterium glutamicum phosphotransferase system permeases
  Martins, Molecular microbiology 2019
  • “...C. glutamicum PTS for fructose, glucose and sucrose are shown in Fig. 1 . ptsG (cg1537) encodes the glucosespecific membrane integral EIIBCA transporter, while ptsS (cg2925) encodes the sucrosespecific EIIBCA, and ptsF (cg2120) the fructosespecific EIIABC (Fig. 1 ). A fourth putative PTS belongs to the...”
• Impact of CO₂/HCO₃^- Availability on Anaplerotic Flux in Pyruvate Dehydrogenase Complex-Deficient Corynebacterium glutamicum Strains
  Krüger, Journal of bacteriology 2019 (secret)
• Phosphotransferase system-mediated glucose uptake is repressed in phosphoglucoisomerase-deficient Corynebacterium glutamicum strains
  Lindner, Applied and environmental microbiology 2013
  • “...of C. glutamicum WT Inactivation of ptsG (cg1537) in C. glutamicum pgi L-Lysine-producing strain (pycP458S, homV59A, lysCT311I) In-frame deletion of pgi...”
  • “...Derived from pBB1, for constitutive expression of ptsG (cg1537) of C. glutamicum Specr; C. glutamicum/E. coli shuttle vector (Ptac lacIq; pBL1, OriVC.g.,...”
• Maltose uptake by the novel ABC transport system MusEFGK2I causes increased expression of ptsG in Corynebacterium glutamicum
  Henrich, Journal of bacteriology 2013
  • “...of pDrive in cg2701 In-frame deletion of ptsG gene (cg1537) of C. glutamicum WT American Type Culture Collection 41 42 27 This work This work This work...”
  • “...cg2708 to cg2703 (mus genes) and of the ptsG (cg1537) gene were constructed using pK19mobsacB as described TABLE 2 Plasmids used in this study Plasmid Relevant...”
• Protein turnover quantification in a multilabeling approach: from data calculation to evaluation
  Trötschel, Molecular & cellular proteomics : MCP 2012
  • “...LAAGEVVDIVSPLEGK.A (charge 2) from the protein PtsG (Cg1537), a component of the phosphotransferase system. Calculated incorporation rates (ape) of the partly...”
• More
• Transcriptome analysis of Corynebacterium glutamicum in the process of recombinant protein expression in bioreactors
  Sun, PloS one 2017
  • “...kinase, which is a critical gene in the PTS system, was up-regulated by 2.98-fold, and NCgl1305 and NCgl2553 encoding the phosphotransferase system IIC component were up-regulated by 4.54 and 3.86-fold, respectively, both consistently showing the up absorption and transfer of glucose. Increased glucose consumption during the...”
• The DeoR-type transcriptional regulator SugR acts as a repressor for genes encoding the phosphoenolpyruvate:sugar phosphotransferase system (PTS) in Corynebacterium glutamicum
  Gaigalat, BMC molecular biology 2007
  • “...enzyme IIABC cg2121 NCgl1862 ptsH 89 9.1 Phosphocarrier protein HPr, PTS component non clustered cg1537 NCgl1305 ptsG 683 72.6 Glucose-specific PTS component, enzyme IIBCA cg2925 NCgl2553 ptsS 661 69.1 Sucrose-specific PTS component, enzyme IIBCA cg3365 NCgl2933 - 513 52.7 L-ascorbate type PTS component, enzyme IIC cg3366...”
  • “...adhA 3.23 13.00 Alcohol dehydrogenase cg2118 NCgl1859 - 3.00 12.00 Transcriptional regulator protein, DeoR-family cg1537 NCgl1305 ptsG 2.70 11.97 Phosphotransferase system (PTS), glucose-specific enzyme IIBCA component cg2119 NCgl1860 fruK 2.67 11.59 1-Phosphofructokinase cg2025 - - 2.62 11.43 Hypothetical protein cg2034 NCgl1739 - 2.38 11.24 Hypothetical protein...”
• Adaptation of Corynebacterium glutamicum to ammonium limitation: a global analysis using transcriptome and proteome techniques
  Silberbach, Applied and environmental microbiology 2005
  • “...related NCgl0074 NCgl0893 NCgl0894 NCgl0895 NCgl0896 NCgl0897 NCgl1305 NCgl1521 NCgl1875 NCgl1876 NCgl1877 NCgl1878 NCgl1915 NCgl1917 NCgl1918 Acc. no. 2394...”

lp_3522 sucrose PTS, EIIBC from Lactobacillus plantarum WCFS1
26% identity, 91% coverage

• Metabolism of Fructooligosaccharides in Lactobacillus plantarum ST-III via Differential Gene Transcription and Alteration of Cell Membrane Fluidity
  Chen, Applied and environmental microbiology 2015
  • “...whose microarray experiments two sucrose PTSs (lp_3219 and lp_3522) were not differentially expressed (7). Another set of genes induced by FOS metabolism was...”
• Identification of prebiotic fructooligosaccharide metabolism in Lactobacillus plantarum WCFS1 through microarrays
  Saulnier, Applied and environmental microbiology 2007
  • “...code for a sucrose EII compound PTS (lp_3219 and lp_3522), but they were not differentially expressed in the presence of scFOS compared to glucose. At the...”
  • “...35 and 37% degrees of identity with lp_3219 and lp_3522, respectively. The signal values for lp_3219 were very low, and this gene was likely unexpressed in any...”

BCUN_1552 glucose PTS transporter subunit IIA from Bifidobacterium cuniculi
27% identity, 63% coverage

• Bifidobacteria exhibit social behavior through carbohydrate resource sharing in the gut
  Milani, Scientific reports 2015
  • “...be internalized by means of ABC transporters (BMAGN_0006-BMAGN_0009 and BCUN_2019-BCUN_2022) and/or PTS systems (BMAGN_0338 and BCUN_1552), of which the corresponding genes were shown to exhibit increased transcription (2.37 fold and 10.42 fold with p<0.001, respectively) relative to mono-association conditions ( Fig. 3 ). Thus, on this...”

D9QA35 PTS transporter subunit EIIC from Corynebacterium pseudotuberculosis (strain C231)
CpC231_0932 glucose PTS transporter subunit IIA from Corynebacterium pseudotuberculosis C231
30% identity, 59% coverage

• Changes in protein abundance are observed in bacterial isolates from a natural host
  Rees, Frontiers in cellular and infection microbiology 2015
  • “...and metabolism D9QA16 gpsA CpC231_0913 Glycerol-3-phosphate dehydrogenase 0.005 1.388 * 0.405 Energy production and conversion D9QA35 ptsG CpC231_0932 Phosphotransferase system II Component 0.800 * 0.370 0.481 Carbohydrate transport and metabolism D9QAE1 fhs CpC231_1040 Formatetetrahydrofolate ligase 1.007 * 0.355 0.293 Nucleotide transport and metabolism D9QAL4 ribD CpC231_1114...”
• Changes in protein abundance are observed in bacterial isolates from a natural host
  Rees, Frontiers in cellular and infection microbiology 2015
  • “...D9QA16 gpsA CpC231_0913 Glycerol-3-phosphate dehydrogenase 0.005 1.388 * 0.405 Energy production and conversion D9QA35 ptsG CpC231_0932 Phosphotransferase system II Component 0.800 * 0.370 0.481 Carbohydrate transport and metabolism D9QAE1 fhs CpC231_1040 Formatetetrahydrofolate ligase 1.007 * 0.355 0.293 Nucleotide transport and metabolism D9QAL4 ribD CpC231_1114 Riboflavin biosynthesis...”

TC 4.A.1.2.5 / Q8GGK3 β-glucoside (methyl-β-glucoside, salicin, arbutin) porter, BglF [a V317A or V317M mutation allows it to transport cellobiose as well] from Corynebacterium glutamicum (Brevibacterium flavum) (see paper)
bglF / AAO15901.1 PTS enzyme II BCA protein from Corynebacterium glutamicum (see paper)
29% identity, 63% coverage

• substrates: Methyl-beta-glucosides, arbutin, salicin

AH67_02320 glucose PTS transporter subunit IIA from Bifidobacterium pseudolongum PV8-2
26% identity, 64% coverage

• The extracellular proteome of two Bifidobacterium species reveals different adaptation strategies to low iron conditions
  Vazquez-Gutierrez, BMC genomics 2017
  • “...adenylate kinase AH67_02185 AH68_02020 hypothetical protein AH67_02295 x x AH68_02050 PTS mannose transporter subunit IIABC AH67_02320 x AH68_02165 amidase AH67_02505 x AH68_02170 peptidase P60 AH67_02510 x x AH68_02465 branched-chain amino acid ABC transporter substrate-binding protein AH67_02445 x x AH68_02570 amidase AH67_03020 x x AH68_02580 ABC transporter...”

AH68_02050 glucose PTS transporter subunit IIA from Bifidobacterium catenulatum PV20-2
27% identity, 65% coverage

• The extracellular proteome of two Bifidobacterium species reveals different adaptation strategies to low iron conditions
  Vazquez-Gutierrez, BMC genomics 2017
  • “...50S ribosomal protein L4 AH67_02085 AH68_01885 adenylate kinase AH67_02185 AH68_02020 hypothetical protein AH67_02295 x x AH68_02050 PTS mannose transporter subunit IIABC AH67_02320 x AH68_02165 amidase AH67_02505 x AH68_02170 peptidase P60 AH67_02510 x x AH68_02465 branched-chain amino acid ABC transporter substrate-binding protein AH67_02445 x x AH68_02570 amidase...”

BAD_RS01940 glucose PTS transporter subunit IIA from Bifidobacterium adolescentis ATCC 15703
24% identity, 65% coverage

• Combining of transcriptome and metabolome analyses for understanding the utilization and metabolic pathways of Xylo-oligosaccharide in Bifidobacterium adolescentis ATCC 15703
  Yang, Food science & nutrition 2019
  • “...transporter permease F:CTTCGTGCCGTATGTCGTTT 58.7 246 R:TGGCTGCTTCATACAGTTCC 57.9 BAD_RS00875 Phosphoenolpyruvateprotein phosphotransferase F:TGTTCCGTACCGAATTCCTGT 59.5 117 R:TGCGGATCACGACCTTCTT 58.5 BAD_RS01940 PTS betaglucoside transporter subunit EIIBCA F:ACGCTCGGCTACGACTTCAT 59.9 200 R:AGCTTGTACCGCAGGTGGAT 58.5 BAD_RS06365 Betaglucosidase F:CTTCTACATCACCGCCTACCA 57.8 167 R:TATCGAGGACCACGTTCTTAAA 57.2 BAD_RS02270 Betaxylosidase F:CCAGCCAGCTTGATATGAGAG 57.6 154 R:TCGGCGGTGACCAAATAA 57.8 BAD_RS03990 Glutamate synthase [NADPH] large subunit...”
  • “...& Sinderen, 2007 ). Compared with xylose treatment, PTS betaglucoside transporter subunit EIIBCA (encoded by BAD_RS01940) and phosphoenolpyruvateprotein phosphotransferase (encoded by BAD_RS00875) were downregulated in B.adolescentis 15703 grown on XOS. Meanwhile, metabolites including upregulated DSorbitol 6phosphate (meta_761), Dmannose (meta_166) and downregulated Lascorbic acid (meta_312), DGlucose 6phosphate...”

BDP_0482 ptsG PTS system, glucose-specific IIABC component from Bifidobacterium dentium Bd1
27% identity, 64% coverage

• Analysis of predicted carbohydrate transport systems encoded by Bifidobacterium bifidum PRL2010
  Turroni, Applied and environmental microbiology 2012
  • “...BAD_0476 BAD_0775 BAD_0079 B. adolescentis ATCC 15703 BDP_0482 BDP_1646 BDP_0656 BDP_0660 BDP_1208 BDP_0116 B. dentium Bd1 BIF_00311 BIF_00684 BIF_00071...”

BMAGN_0338 glucose PTS transporter subunit IIA from Bifidobacterium magnum
25% identity, 64% coverage

• Bifidobacteria exhibit social behavior through carbohydrate resource sharing in the gut
  Milani, Scientific reports 2015
  • “...presumed to be internalized by means of ABC transporters (BMAGN_0006-BMAGN_0009 and BCUN_2019-BCUN_2022) and/or PTS systems (BMAGN_0338 and BCUN_1552), of which the corresponding genes were shown to exhibit increased transcription (2.37 fold and 10.42 fold with p<0.001, respectively) relative to mono-association conditions ( Fig. 3 ). Thus,...”

NO343_04795 PTS transporter subunit EIIC from Mycoplasma capricolum subsp. capricolum
27% identity, 65% coverage

• First Report and Comparative Genomic Analysis of Mycoplasma capricolum subsp. capricolum HN-B in Hainan Island, China
  Zhang, Microorganisms 2022
  • “...system EIICBA or EIICB component. NO343_02675 encodes the sucrose PTS system EIIBCA or EIIBC component. NO343_04795 encodes the sucrose PTS system EIIBCA or EIIBC component. NO343_01605 and NO343_04800 encode 1-phosphofructokinase. Ten different types of EII were identified in Mcc HN-B. These enzymes enable the PTS system...”

PFREUD_01380 glucose PTS transporter subunit IIA from Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
26% identity, 39% coverage

• Mutations and genomic islands can explain the strain dependency of sugar utilization in 21 strains of Propionibacterium freudenreichii
  Loux, BMC genomics 2015
  • “...Table 4 ). They are encoded by sacL (with orthologs in all sequenced strains) and PFREUD_01380 (with orthologs in CIRM-BIA 118, 121, 134, 138). Mannose 6-phosphate is then transformed into fructose 6-phosphate by a phosphomannose isomerase encoded by man A (PFREUD_18490). Fructose 6-phosphate can then enter...”

Bbr_1594 glucose PTS transporter subunit IIA from Bifidobacterium breve UCC2003
26% identity, 53% coverage

• Bifidobacterial biofilm formation is a multifactorial adaptive phenomenon in response to bile exposure
  Kelly, Scientific reports 2020
  • “...tag Putative Function Fold change in expression (Up regulation) P-value Bbr_0376 Hypothetical protein 10.08 9.18E14 Bbr_1594 PTS system fructose/glucose ( fruA ) 6.09 4.99E15 Bbr_0925 Permease MFS superfamily 5.49 0.000125407 Bbr_0204 Multi-domain protein fatty acids or polyketide synthesis 4.33 1.79E10 Bbr_1558 Permease of ABC transporter 4.16...”
  • “...significantly upregulated following 0.5% bile exposure. Transcription of a gene encoding a putative PEP-PTS system (Bbr_1594), which previously was shown to be induced by glucose 48 , was upregulated sixfold under the imposed bile exposure conditions. Similarly, genes predicted to encode an ABC-type transporter permease (Bbr_1558),...”
• Comparative genomics and genotype-phenotype associations in Bifidobacterium breve
  Bottacini, Scientific reports 2018
  • “...Bbr_100, an ABC transporter Bbr_0026-27, an additional -fructofuranosidase Bbr_1324 and a fructose phosphotransferase PTS system Bbr_1594) 23 , 28 , 42 . Of the 35 substrates for which differential growth was observed among B . breve strains, some of these (e.g. starch and starch-like polysaccharides, lacto-...”
• Analysis of predicted carbohydrate transport systems encoded by Bifidobacterium bifidum PRL2010
  Turroni, Applied and environmental microbiology 2012
  • “...BL_1163 BL_1638 BL_1639 BL_1640 BL_1498 BL_0534 Bbr_1594 Bbr_1551 Bbr_0528 Bbr_0531 Bbr_1590 Bbr_1589 Bbr_1588 Bbr_1111 Bbr_1880 Bbr_0101 Bbr_1892 Blon_2183...”

Blon_2183 PTS system, glucose subfamily, IIA subunit from Bifidobacterium longum subsp. infantis ATCC 15697
26% identity, 53% coverage

• Strain-specific strategies of 2'-fucosyllactose, 3-fucosyllactose, and difucosyllactose assimilation by Bifidobacterium longum subsp. infantis Bi-26 and ATCC 15697
  Zabel, Scientific reports 2020
  • “...a transposase insertion in the antiterminator required for activity of the -glucoside-specific PTS transport system (Blon_2183) involved in recognition and uptake of glucose from the external environment 26 . This transposase is not present in Bi-26, but present in the type strain and several other strains...”
  • “...insertion within predicted antiterminator of BglG family (Blon_2180) had inactivated the predicted glucose PTS transporter Blon_2183. Furthermore, the small number of DEGs implies that there are no other functional transport systems for glucose uptake in the type strain making this strain technically blind to the presence...”
• Release and utilization of N-acetyl-D-glucosamine from human milk oligosaccharides by Bifidobacterium longum subsp. infantis
  Garrido, Anaerobe 2012
  • “...induced by glucose, probably associated to another PTS system that imports glucose in B. infantis (Blon_2183). 4. Discussion Certain infant-borne Bifidobacterium species are known to efficiently consume HMO, one of the most abundant components of human milk [ 20 , 22 ]. B. infantis is characterized...”
• Analysis of predicted carbohydrate transport systems encoded by Bifidobacterium bifidum PRL2010
  Turroni, Applied and environmental microbiology 2012
  • “...Bbr_1589 Bbr_1588 Bbr_1111 Bbr_1880 Bbr_0101 Bbr_1892 Blon_2183 Blon_2331 Blon_0342 Blon_2015 Blon_2177 Blon_2176 Blon_2175 Blon_1050 Blon_2471 Blon_0129 B....”

BBMN68_1665 glucose PTS transporter subunit IIA from Bifidobacterium longum subsp. longum BBMN68
26% identity, 37% coverage

• Mechanism analysis of acid tolerance response of bifidobacterium longum subsp. longum BBMN 68 by gene expression profile using RNA-sequencing
  Jin, PloS one 2012
  • “...the MFS and ABC transport system, there were genes ( BBMN68_1151 , BBMN68_1152 , and BBMN68_1665 ) encoding the three components (EI, HPr, and EII) of the glucose-specific phosphoenolpyruvate-linked phosphotransferase system (PTS) in BBMN68 genome. The expression of the genes encoding the components in PTS showed...”

BL1632 PtsG from Bifidobacterium longum NCC2705
26% identity, 37% coverage

• Preferential sugar utilization by bifidobacterial species
  Murakami, Microbiome research reports 2023
  • “...investigated the homolog distribution of the glcP , ptsG , and licT gene cluster (BL1631, BL1632, and BL1633 in B. longum NCC2705), which are reportedly involved in the preferential utilization of lactose in NCC2705 [ 20 ] . Of the 40 isolates, 12 strains had all...”
• Lactose-over-glucose preference in Bifidobacterium longum NCC2705: glcP, encoding a glucose transporter, is subject to lactose repression
  Parche, Journal of bacteriology 2006
  • “...BL1630-F1, TCAAGCGTGTGCCCTACGA BL1630-R1, GTGCTCGCGGAAGTCGAA BL1632 ( ptsG) AAN25420 BL1632-F1, CACCGACGCCGAACAAA BL1632-R1, GCGTGAAGTGACGGGATGTA BL1633...”

Asuc_1575 triosephosphate isomerase from Actinobacillus succinogenes 130Z
44% identity, 17% coverage

• Development of highly efficient and specific base editors in Actinobacillus succinogenes for enhancing succinic acid production
  Chen, Biotechnology for biofuels and bioproducts 2023
  • “...simultaneously in A. succinogenes , nCas9(D10A)-ABE and Td-CBEs were constructed containing two sgRNAs. Asuc_1034 and Asuc_1575 were target genes of nCas9(D10A)-ABE and Td-CBEs, respectively. After being transformed to A. succinogenes , ten colonies were randomly picked for sequencing. The results showed that simultaneous A-to-G base editing...”
  • “...at multiple loci in A.succinogenes . However, simultaneous C-to-T base editing at two sites of Asuc_1575 was achieved with efficiency of 10% by Td-CBE and Td-CBEmax. The editing efficiency of the first site was 100%, and the editing efficiency of the second site was only 10%....”

SAOUHSC_02662 PTS system sucrose-specific IIBC component from Staphylococcus aureus subsp. aureus NCTC 8325
49% identity, 15% coverage

• Regulation of neutrophil myeloperoxidase inhibitor SPIN by the small RNA Teg49 in Staphylococcus aureus
  Cengher, Molecular microbiology 2022
  • “...protein with NETI domain (YebG-like, DNA damage sensing) SAOUHSC_00899 0.35 3.08E-23 2.95E-21 argG Argininosuccinate synthase SAOUHSC_02662 0.29 3.80E-16 1.90E-14 scrA PTS system sucrose-specific transporter subunit IIBC Notes : RNA-Seq performed with wild type Staphylococcus aureus SH1000, a Teg49 mutant, and an inducible pEPSA:Teg49 complemented strain. It...”

str0512 beta-glucoside-specific PTS system IIABC component, truncated from Streptococcus thermophilus CNRZ1066
stu0512 beta-glucoside PTS system component IIABC, truncated from Streptococcus thermophilus LMG 18311
30% identity, 27% coverage

• Specialized adaptation of a lactic acid bacterium to the milk environment: the comparative genomics of Streptococcus thermophilus LMD-9
  Goh, Microbial cell factories 2011
  • “...stu0189 str0189 STER0446 Fructose PTS IIA, trunc. stu0401 str0401 STER0544 Beta-glucoside PTS EIIABC, trunc. stu0512 str0512 STER1862 Trehalose PTS EIIABC, trunc. stu1890 str1890 ABC transporter STER0856 ABC transporter, substrate-binding protein stu0808 str0808 STER0857 Sugar ABC transporter, ATPase component stu0809 str0809 STER0858 Sugar ABC transporter, permease component...”
• Specialized adaptation of a lactic acid bacterium to the milk environment: the comparative genomics of Streptococcus thermophilus LMD-9
  Goh, Microbial cell factories 2011
  • “...trunc. stu0189 str0189 STER0446 Fructose PTS IIA, trunc. stu0401 str0401 STER0544 Beta-glucoside PTS EIIABC, trunc. stu0512 str0512 STER1862 Trehalose PTS EIIABC, trunc. stu1890 str1890 ABC transporter STER0856 ABC transporter, substrate-binding protein stu0808 str0808 STER0857 Sugar ABC transporter, ATPase component stu0809 str0809 STER0858 Sugar ABC transporter, permease...”

SERP1290 PTS system, IIBC components from Staphylococcus epidermidis RP62A
48% identity, 14% coverage

• A New Bioactive Compound From the Marine Sponge-Derived Streptomyces sp. SBT348 Inhibits Staphylococcal Growth and Biofilm Formation
  Balasubramanian, Frontiers in microbiology 2018
  • “...5.81E-45 malA Alpha-glucosidase -2.4798 3.93E-27 Gnd 6-phosphogluconate dehydrogenase decarboxylating -2.3314 5.38E-91 pfkA 6-phosphofructokinase -2.5866 9.06E-34 SERP1290 PTS system IIBC components 2.6442 1.92E-32 Tal Transaldolase -2.1920 4.46E-19 sceD SceD protein 4.8221 7.26E-69 lacR Lactose phosphotransferase system repressor 2.0861 7.09E-16 sdhA L -serine dehydratase iron-sulfur-dependent alpha subunit -2.1059...”

PTWCB_BACSU / O34521 PTS system N-acetylglucosamine-specific EIICB component; EIICB-Nag; EC 2.7.1.193 from Bacillus subtilis (strain 168) (see 4 papers)
TC 4.A.1.1.7 / O34521 The N-acetylglucosamine IICB porter (NagP; YflF) (45% identical to 4.A.1.1.2) from Bacillus subtilis (see 2 papers)
BSU07700 phosphotransferase system (PTS) N-acetylglucosamine-specific enzyme IICB component from Bacillus subtilis subsp. subtilis str. 168
48% identity, 13% coverage

• function: The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active -transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane (By similarity). This system is involved in N-acetylglucosamine transport (PubMed:23667565).
  catalytic activity: N-acetyl-D-glucosamine(out) + N(pros)-phospho-L-histidyl- [protein] = N-acetyl-D-glucosamine 6-phosphate(in) + L-histidyl- [protein] (RHEA:49240)
  subunit: Interacts with FloT.
  disruption phenotype: Deletion of the gene almost completely prevents growth on N-acetylglucosamine, but has no effect on growth on glucosamine (PubMed:23667565, PubMed:30038046). The gamP-nagP double mutant can still grow normally on glucosamine (PubMed:23667565).
• substrates: N-acetylglucosamine
• Regulon of the N-acetylglucosamine utilization regulator NagR in Bacillus subtilis
  Bertram, Journal of bacteriology 2011
  • “...mutant compared to parental strain B. subtilis WH558 BSU07700 Category and KEGG no. TABLE 3. Transcriptome analysis for definition of YvoA (NagR) regulon in...”

SA1547 PTS system, N-acetylglucosamine-specific IIABC component from Staphylococcus aureus subsp. aureus N315
41% identity, 14% coverage

• Prevalence and molecular characterization of cefotaxime-resistant Salmonella strains recovered from retail meat samples in Shenzhen, China, during 2014-2017
  Yang, Microbiology spectrum 2023
  • “...oqxAB, mcr-1.1 IncHI2 247,705 SA1541 2016 Typhimurium Pork >16 0.5 0.5 CTX-M-55/65 qnrS1 IncHI2 228,062 SA1547 2016 Typhimurium Pork >16 1 1 CTX-M-65 qnrS1, qnrVC5 IncHI2 228,062 SA1551 2016 Typhimurium Chicken >16 1 0.5 CTX-M-65 qnrS1 IncHI2 228,062 SA1559 2016 Typhimurium Pork >16 1 1 CTX-M-65...”
• Differential gene expression profiling of Staphylococcus aureus cultivated under biofilm and planktonic conditions
  Resch, Applied and environmental microbiology 2005
  • “...2.604 SA0589 SA0531 SA2142 SA2200 SA1183 SA2201 SA1519 SA0682 SA1547 6.344 5.629 5.002 3.714 3.878 3.447 3.367 3.299 2.98 SA2202 2.7 SA0813 SA1699 SA0793 SA2172...”

C4IM61 Pts system, N-acetylglucosamine-specific iibc component from Clostridium butyricum E4 str. BoNT E BL5262
42% identity, 14% coverage

• Indoleacrylic Acid Produced by Commensal Peptostreptococcus Species Suppresses Inflammation
  Wlodarska, Cell host & microbe 2017
  • “...A0A099I9R0 Pts acetylgalactosamine transporter subunit IID Clostridium innocuum A0A0P0LQS4 N-acetylglucosamine related transporter, NagX Bacteroides vulgatus C4IM61 Pts system, N-acetylglucosamine-specific iibc Clostridium butyricum A0A099I8F5 Pts N-acetylglucosamine transporter subunit IIBC Clostridium innocuum B1BM12 Pts system, N-acetylglucosamine-specific IIBC Clostridium perfringens A0A0H2YS35 Pts system, N-acetylglucosamine-specific IIBC Clostridium perfringens B5CQC8 Pts...”

c3408 PTS system, maltose and glucose-specific IIABC component from Escherichia coli CFT073
NRG857_13905 PTS transporter subunit EIIC from Escherichia coli O83:H1 str. NRG 857C
39% identity, 13% coverage

• PafR, a novel transcription regulator, is important for pathogenesis in uropathogenic Escherichia coli
  Baum, Infection and immunity 2014
  • “...the first two genes of this operon, c3409 and c3408 (here designated pafR and pafP, respectively), was used as a probe for DNA hybridization, it was identified...”
  • “...pafP genes (previously referred to as c3409 and c3408, respectively) in CFT073 were found to be significantly associated with isolates causing clinical...”
• A unique arabinose 5-phosphate isomerase found within a genomic island associated with the uropathogenicity of Escherichia coli CFT073
  Mosberg, Journal of bacteriology 2011
  • “...a "PTS system, maltose and glucose-specific IIABC component" (c3408), and an antiterminator (c3409). The short open reading frame c3410 is listed simply as a...”
  • “...(c3407), a putative phosphotransferase (PTS) system component (c3408), and a putative antiterminator (c3409). The specific function of this operon is unknown,...”
• Genomic islands of uropathogenic Escherichia coli contribute to virulence
  Lloyd, Journal of bacteriology 2009
  • “...phosphotransferase system, maltose- and glucose-specific IIABC component (c3408); and antiterminator (c3409). The c3405-09 gene cluster is also present in...”
  • “...coli K-12 (5). Indeed, we recently identified c3405 and c3408 as UPEC specific (44). APEC strains, the primary cause of colibacillosis in the poultry industry,...”
• Defining genomic islands and uropathogen-specific genes in uropathogenic Escherichia coli
  Lloyd, Journal of bacteriology 2007
  • “...c2523 c2524 c2525 yfaL c3147 c3292 c3304 c3390 c3405 c3408 c3509 c3686 c3750 c3753 c3755 ygiK c3770 c3771 c3772 c3773 c3774 assT c4016 c4017 c4018 c4205 chuS...”
• Genome sequence of adherent-invasive Escherichia coli and comparative genomic analysis with other E. coli pathotypes
  Nash, BMC genomics 2010
  • “...B, isozyme (amino acid catabolism and metabolism) common NRG857_11240 ompC 100 outer membrane protein common NRG857_13905 malX 94 maltose and glucose-specific IIABC component, pathogenicity island associated UPEC NRG857_15695 nlpI 100 lipoprotein common NRG857_17475 gadA 99 glutamate decarboxylase A, isozyme (amino acid catabolism and metabolism) common NRG857_19245...”

B9CK59 3-dehydroquinate dehydratase (EC 4.2.1.10) from Lancefieldella rimae (see paper)
31% identity, 19% coverage

USA300HOU_1715 PTS family porter component IIBC from Staphylococcus aureus subsp. aureus USA300_TCH1516
SAUSA300_1672 phosphotransferase system, N-acetylglucosamine-specific IIBC component from Staphylococcus aureus subsp. aureus USA300_FPR3757
B7H15_09405, SAUSA300_RS09130 N-acetylglucosamine-specific PTS transporter subunit IIBC from Staphylococcus aureus subsp. aureus USA300_FPR3757
40% identity, 14% coverage

• Pre-epidemic evolution of the MRSA USA300 clade and a molecular key for classification
  Bianco, Frontiers in cellular and infection microbiology 2023
  • “...crtN (2703257) , intergenic (2727910) intergenic (201647), USA300HOU_1266 (1352385), ebh (1483188), engA (1544604), comEC (1700414), USA300HOU_1715 (1839546), USA300HOU_1918 (2063960), intergenic (2262458), lacE (2329451), USA300HOU_2279 (2414655), USA300HOU_2654 (2811819) galE (148897) , intergenic (191588) , pbuX (437253) , USA300HOU_0421 (445172) , USA300HOU_042 1 (445217) , set21 (452762) ,...”
• Identification of Methicillin-Resistant Staphylococcus aureus (MRSA) Genetic Factors Involved in Human Endothelial Cells Damage, an Important Phenotype Correlated with Persistent Endovascular Infection
  Xiao, Antibiotics (Basel, Switzerland) 2022
  • “...protein 26.40 12.90 SAUSA300_1964 hypothetical hypothetical protein 26.38 7.19 SAUSA300_0290 hypothetical putative lipoprotein 26.29 8.56 SAUSA300_1672 nagE phosphotransferase system, N-acetylglucosamine-specific IIBC component 26.21 5.46 SAUSA300_2023 rsbW anti-sigma-B factor, serine-protein kinase 26.01 0.14 SAUSA300_0190 ipdC indole-3-pyruvate decarboxylase 25.81 7.93 SAUSA300_2413 hypothetical hypothetical protein 25.79 4.70 SAUSA300_0798 hypothetical...”
• Clinical and in vitro models identify distinct adaptations enhancing Staphylococcus aureus pathogenesis in human macrophages
  Long, PLoS pathogens 2024
  • “..., folB , sirA , B7H15_03165, B7H15_06690) and three with macrophage survival ( recG , B7H15_09405, B7H15_06245). Last, we examined non-synonymous de novo mutations occurring between temporally first- and last-collected CF clinical isolates. This method of comparison provides the most robust control for bias related to...”
• The Staphylococcus aureus Transcriptome during Cystic Fibrosis Lung Infection
  Ibberson, mBio 2019
  • “...-Acetyl-alpha- d -glucosaminyl l -malate synthase SAUSA300_RS07900 xerD Tyrosine recombinase SAUSA300_RS07905 fur Ferric uptake regulator SAUSA300_RS09130 ptaA PTS glucose transporter subunit IIBC SAUSA300_RS11445 fbaA Fructose-bisphosphate aldolase SAUSA300_RS11760 htsA ABC transporter substrate-binding protein SAUSA300_RS12210 AcrB/AcrD/AcrF family protein SAUSA300_RS12780 lctP2 l -Lactate permease SAUSA300_RS13075 hlgC Gamma-hemolysin component C...”

CD1336 PTS system, maltose and glucose-specific IIbc component from Clostridium difficile 630
39% identity, 12% coverage

• Global transcriptional control by glucose and carbon regulator CcpA in Clostridium difficile
  Antunes, Nucleic acids research 2012
  • “...transporters and associated enzymes involved in sugar utilization (CD0468, CD0494, CD2280, gatA , celA and CD1336); and (v) non-PTS sugar utilization ( rbsR and CD1586), sialic acid degradation ( nanE ) or ethanolamine transport (CD0742). Genes implicated in sporulation, such as the major response regulator Spo0A,...”
  • “...NR CD1214 e spo0A e 1.5 1412498 TGTAAAAAGTTTAGTT 42 CD1321 d 1.6 1531839 AGGAAATAGTTAACTT 24 CD1336 1.5 1550212 TAGAAAACGTTTTAAA 41 NR NR CD1385 3.6 1603687 CD1384CD1387 AAGAAAGCGTTTTGAA 111 CD1477 e feoA e 13 1714290 CD1477CD1480 AAGATAACGATTGCTT 52 NR + CD1536 e 15.5 1781719 CD1536 aspB AAGAAAACGATTTTGT...”

ERH_1399 N-acetylglucosamine-specific PTS transporter subunit IIBC from Erysipelothrix rhusiopathiae str. Fujisawa
46% identity, 13% coverage

• Proteomic and Transcriptomic Analyses of Swine Pathogen Erysipelothrix rhusiopathiae Reveal Virulence Repertoire
  Li, PloS one 2016
  • “...PTS glucose transporter subunit IIBC 15.3 5 2.049 Acetyltransferases, including N-acetylases of ribosomal proteins down ERH_1399 gi|336065655 ABC transporter permease 6.1 2 1.522 Phosphotransferase system IIC components, glucose/maltose/N-acetylglucosamine-specific up ERH_0414 gi|336065992 citrate-sodium symporter 9.7 4 2.961 ABC-type sugar transport systems, permease components gi|336065983 GntR family transcriptional...”
• The genome of Erysipelothrix rhusiopathiae, the causative agent of swine erysipelas, reveals new insights into the evolution of firmicutes and the organism's intracellular adaptations
  Ogawa, Journal of bacteriology 2011
  • “...ERH_1220, ERH_1221, ERH_1327, ERH_1393, ERH_1394, ERH_1395, ERH_1396, ERH_1399 23 (38) 1 (1) ERH_1190 132 (234) (alanine, asparagine, glutamine, serine,...”

CAC0532 PTS system, arbutin-like IIBC component from Clostridium acetobutylicum ATCC 824
41% identity, 11% coverage

• Transcriptional analysis of micronutrient zinc-associated response for enhanced carbohydrate utilization and earlier solventogenesis in Clostridium acetobutylicum
  Wu, Scientific reports 2015
  • “...C. acetobutylicum genome sequence analysis 9 , as for disaccharides, the expression of genes malP (CAC0532) and malH (CAC0533), located in an operon for a putative maltose-specific PTS IICB and a maltose-6-phosphate glucosidase, respectively, were 2.66-fold and 1.51-fold upregulated. Additionally, the expression of another two putative...”

Q93Q02 protein-Npi-phosphohistidine-maltose phosphotransferase (EC 2.7.1.208) from Clostridium acetobutylicum (see paper)
41% identity, 11% coverage

RUMGNA_03053 hypothetical protein from Ruminococcus gnavus ATCC 29149
41% identity, 14% coverage

• Utilisation of mucin glycans by the human gut symbiont Ruminococcus gnavus is strain-dependent
  Crost, PloS one 2013
  • “...GlcNAc specific PTS (PTSII Nag ) is present in both E1 (RUGNEv3_10975) and ATCC 29149 (RUMGNA_03053) whereas the GalNAc specific PTS is only present in ATCC 29149 containing the IIA (RUMGNA_00960), IIB (RUMGNA_00962), IIC (RUMGNA_00963) and IID (RUMGNA_00964) components. Only R. gnavus E1 was able to...”

PTOCB_BACSU / P54715 PTS system maltose-specific EIICB component; EC 2.7.1.208 from Bacillus subtilis (strain 168) (see 2 papers)
TC 4.A.1.1.8 / P54715 The maltose IICB porter (MalP; GlvC) (56% identical to 4.A.1.1.4) from Bacillus subtilis (see 3 papers)
38% identity, 11% coverage

• function: The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. This system is involved in maltose transport.
  catalytic activity: D-maltose(out) + N(pros)-phospho-L-histidyl-[protein] = alpha- maltose 6'-phosphate(in) + L-histidyl-[protein] (RHEA:49300)
  disruption phenotype: Cells lacking this gene show no maltose uptake.
• substrates: Maltose

Cbei_4532 PTS system, N-acetylglucosamine-specific IIBC subunit from Clostridium beijerincki NCIMB 8052
42% identity, 12% coverage

• Transcriptional analysis of Clostridium beijerinckii NCIMB 8052 to elucidate role of furfural stress during acetone butanol ethanol fermentation
  Zhang, Biotechnology for biofuels 2013
  • “...glucitol/sorbitol-specific transporter subunit IIC (Cbei_0336) (Figure 1 B). Besides the listed genes, N-acetylglucosamine-specific IIBC subunit (Cbei_4532) and glucose subfamily transporter subunit IIA (Cbei_4533) are also involved in amino sugar and nucleotide sugar metabolism (cbe00520) (Additional file 3 : Table S3). The repression of these genes may...”
• Genome-wide dynamic transcriptional profiling in Clostridium beijerinckii NCIMB 8052 using single-nucleotide resolution RNA-Seq
  Wang, BMC genomics 2012
  • “...encoding the Glc family PTS transporters in C. acetobutylicum . Among them, only Cbei_0751, Cbei_3273, Cbei_4532, Cbei_4533 and Cbei_4705 were actively expressed during the fermentation process, and Cbei_4533 (encoding N-acetylglucosamine-specific IIA subunit) and Cbei_4532 (encoding N-acetylglucosamine-specific IIBC subunit) were especially strongly expressed throughout the batch fermentation...”
  • “...transporters, it could be inferred that the Glc family PTS transporters (especially those encoded by Cbei_4532 and _4533) play important roles during exponential and early stationary phases, while the mannose family PTS transporters may be more closely related to stationary and sporulation events. Self-organizing maps (SOM)...”

MSC_0873 PTS system, glucose-specific, IIBC component from Mycoplasma mycoides subsp. mycoides SC str. PG1
38% identity, 9% coverage

• Identification of genes coding for B cell antigens of Mycoplasma mycoides subsp. mycoides Small Colony (MmmSC) by using phage display
  Miltiadou, BMC microbiology 2009
  • “...(1) ND CAE76659 MSC_0006 PTS system, glucose-specific, IIBC component (PtsG) Yes (4) ND CAE77485 b MSC_0873 IgG2 panning Transposase IS Mmy1 C Yes (1) No CAE77424 MSC_0808 30S ribosomal protein S5 (RpsE) Yes (1) No CAE77346 MSC_0728 Putative glucose-specific IIABC component (PtsG) Yes (1) No CAE76806...”

MSC_0860 PTS system, glucose-specific IIBC component from Mycoplasma mycoides subsp. mycoides SC str. PG1
38% identity, 9% coverage

• Mycoplasmas are no exception to extracellular vesicles release: Revisiting old concepts
  Gaurivaud, PloS one 2018
  • “...which is expected to facilitate EV release and ii) it expresses constitutively the glucose permease (MSC_0860) recognized by the 3f3 monoclonal antibody, which is used as a marker (see hereafter) [ 17 ]. They were propagated at 37C under 5% CO 2 in complete mycoplasma medium...”
  • “...200 g/ml of gentamicin. EV production was quantified by immunodetection of the Mmm glucose permease (MSC_0860), a protein present in the membrane of Mmm EV ( S1 Table ) and specifically detected with high sensitivity by the 3f3 monoclonal antibody [ 19 ]. A correlation was...”

New Search

Statistics

How It Works

PaperBLAST builds a database of protein sequences that are linked to scientific articles. These links come from automated text searches against the articles in EuropePMC and from manually-curated information from GeneRIF, UniProtKB/Swiss-Prot, BRENDA, CAZy (as made available by dbCAN), BioLiP, CharProtDB, MetaCyc, EcoCyc, TCDB, REBASE, the Fitness Browser, and a subset of the European Nucleotide Archive with the /experiment tag. Given this database and a protein sequence query, PaperBLAST uses protein-protein BLAST to find similar sequences with E < 0.001.

To build the database, we query EuropePMC with locus tags, with RefSeq protein identifiers, and with UniProt accessions. We obtain the locus tags from RefSeq or from MicrobesOnline. We use queries of the form "locus_tag AND genus_name" to try to ensure that the paper is actually discussing that gene. Because EuropePMC indexes most recent biomedical papers, even if they are not open access, some of the links may be to papers that you cannot read or that our computers cannot read. We query each of these identifiers that appears in the open access part of EuropePMC, as well as every locus tag that appears in the 500 most-referenced genomes, so that a gene may appear in the PaperBLAST results even though none of the papers that mention it are open access. We also incorporate text-mined links from EuropePMC that link open access articles to UniProt or RefSeq identifiers. (This yields some additional links because EuropePMC uses different heuristics for their text mining than we do.)

For every article that mentions a locus tag, a RefSeq protein identifier, or a UniProt accession, we try to select one or two snippets of text that refer to the protein. If we cannot get access to the full text, we try to select a snippet from the abstract, but unfortunately, unique identifiers such as locus tags are rarely provided in abstracts.

PaperBLAST also incorporates manually-curated protein functions:

• Proteins from NCBI's RefSeq are included if a GeneRIF entry links the gene to an article in PubMed^®. GeneRIF also provides a short summary of the article's claim about the protein, which is shown instead of a snippet.
• Proteins from Swiss-Prot (the curated part of UniProt) are included if the curators identified experimental evidence for the protein's function (evidence code ECO:0000269). For these proteins, the fields of the Swiss-Prot entry that describe the protein's function are shown (with bold headings).
• Proteins from BRENDA, a curated database of enzymes, are included if they are linked to a paper in PubMed and their full sequence is known.
• Every protein from the non-redundant subset of BioLiP, a database of ligand-binding sites and catalytic residues in protein structures, is included. Since BioLiP itself does not include descriptions of the proteins, those are taken from the Protein Data Bank. Descriptions from PDB rely on the original submitter of the structure and cannot be updated by others, so they may be less reliable. (For SitesBLAST and Sites on a Tree, we use a larger subset of BioLiP so that every ligand is represented among a group of structures with similar sequences, but for PaperBLAST, we use the non-redundant set provided by BioLiP.)
• Every protein from EcoCyc, a curated database of the proteins in Escherichia coli K-12, is included, regardless of whether they are characterized or not.
• Proteins from the MetaCyc metabolic pathway database are included if they are linked to a paper in PubMed and their full sequence is known.
• Proteins from the Transport Classification Database (TCDB) are included if they have known substrate(s), have reference(s), and are not described as uncharacterized or putative. (Some of the references are not visible on the PaperBLAST web site.)
• Every protein from CharProtDB, a database of experimentally characterized protein annotations, is included.
• Proteins from the CAZy database of carbohydrate-active enzymes are included if they are associated with an Enzyme Classification number. Even though CAZy does not provide links from individual protein sequences to papers, these should all be experimentally-characterized proteins.
• Proteins from the REBASE database of restriction enzymes are included if they have known specificity.
• Every protein with an evidence-based reannotation (based on mutant phenotypes) in the Fitness Browser is included.
• Sequence-specific transcription factors (including sigma factors and DNA-binding response regulators) with experimentally-determined DNA binding sites from the PRODORIC database of gene regulation in prokaryotes.
• Putative transcription factors from RegPrecise that have manually-curated predictions for their binding sites. These predictions are based on conserved putative regulatory sites across genomes that contain similar transcription factors, so PaperBLAST clusters the TFs at 70% identity and retains just one member of each cluster.
• Coding sequence (CDS) features from the European Nucleotide Archive (ENA) are included if the /experiment tag is set (implying that there is experimental evidence for the annotation), the nucleotide entry links to paper(s) in PubMed, and the nucleotide entry is from the STD data class (implying that these are targeted annotated sequences, not from shotgun sequencing). Also, to filter out genes whose transcription or translation was detected, but whose function was not studied, nucleotide entries or papers with more than 25 such proteins are excluded. Descriptions from ENA rely on the original submitter of the sequence and cannot be updated by others, so they may be less reliable.

Except for GeneRIF and ENA, the curated entries include a short curated description of the protein's function. For entries from BioLiP, the protein's function may not be known beyond binding to the ligand. Many of these entries also link to articles in PubMed.

For more information see the PaperBLAST paper (mSystems 2017) or the code. You can download PaperBLAST's database here.

Changes to PaperBLAST since the paper was written:

• November 2023: incorporated PRODORIC and RegPrecise. Many PRODORIC entries were not linked to a protein sequence (no UniProt identifier), so we added this information.
• February 2023: BioLiP changed their download format. PaperBLAST now includes their non-redundant subset. SitesBLAST and Sites on a Tree use a larger non-redundant subset that ensures that every ligand is represented within each cluster. This should ensure that every binding site is represented.
• June 2022: incorporated some coding sequences from ENA with the /experiment tag.
• March 2022: incorporated BioLiP.
• April 2020: incorporated TCDB.
• April 2019: EuropePMC now returns table entries in their search results. This has expanded PaperBLAST's database, but most of the new entries are of low relevance, and the resulting snippets are often just lists of locus tags with annotations.
• February 2018: the alignment page reports the conservation of the hit's functional sites (if available from from Swiss-Prot or UniProt)
• January 2018: incorporated BRENDA.
• December 2017: incorporated MetaCyc, CharProtDB, CAZy, REBASE, and the reannotations from the Fitness Browser.
• September 2017: EuropePMC no longer returns some table entries in their search results. This has shrunk PaperBLAST's database, but has also reduced the number of low-relevance hits.

Many of these changes are described in Interactive tools for functional annotation of bacterial genomes.

Secrets

PaperBLAST cannot provide snippets for many of the papers that are published in non-open-access journals. This limitation applies even if the paper is marked as "free" on the publisher's web site and is available in PubmedCentral or EuropePMC. If a journal that you publish in is marked as "secret," please consider publishing elsewhere.

Omissions from the PaperBLAST Database

Many important articles are missing from PaperBLAST, either because the article's full text is not in EuropePMC (as for many older articles), or because the paper does not mention a protein identifier such as a locus tag, or because of PaperBLAST's heuristics. If you notice an article that characterizes a protein's function but is missing from PaperBLAST, please notify the curators at UniProt or add an entry to GeneRIF. Entries in either of these databases will eventually be incorporated into PaperBLAST. Note that to add an entry to UniProt, you will need to find the UniProt identifier for the protein. If the protein is not already in UniProt, you can ask them to create an entry. To add an entry to GeneRIF, you will need an NCBI Gene identifier, but unfortunately many prokaryotic proteins in RefSeq do not have corresponding Gene identifers.

References

PaperBLAST: Text-mining papers for information about homologs.
M. N. Price and A. P. Arkin (2017). mSystems, 10.1128/mSystems.00039-17.

Europe PMC in 2017.
M. Levchenko et al (2017). Nucleic Acids Research, 10.1093/nar/gkx1005.

Gene indexing: characterization and analysis of NLM's GeneRIFs.
J. A. Mitchell et al (2003). AMIA Annu Symp Proc 2003:460-464.

UniProt: the universal protein knowledgebase.
The UniProt Consortium (2016). Nucleic Acids Research, 10.1093/nar/gkw1099.

BRENDA in 2017: new perspectives and new tools in BRENDA.
S. Placzek et al (2017). Nucleic Acids Research, 10.1093/nar/gkw952.

The EcoCyc database: reflecting new knowledge about Escherichia coli K-12.
I. M. Keeseler et al (2016). Nucleic Acids Research, 10.1093/nar/gkw1003.

The MetaCyc database of metabolic pathways and enzymes.
R. Caspi et al (2018). Nucleic Acids Research, 10.1093/nar/gkx935.

CharProtDB: a database of experimentally characterized protein annotations.
R. Madupu et al (2012). Nucleic Acids Research, 10.1093/nar/gkr1133.

The carbohydrate-active enzymes database (CAZy) in 2013.
V. Lombard et al (2014). Nucleic Acids Research, 10.1093/nar/gkt1178.

The Transporter Classification Database (TCDB): recent advances
M. H. Saier, Jr. et al (2016). Nucleic Acids Research, 10.1093/nar/gkv1103.

REBASE - a database for DNA restriction and modification: enzymes, genes and genomes.
R. J. Roberts et al (2015). Nucleic Acids Research, 10.1093/nar/gku1046.

Deep annotation of protein function across diverse bacteria from mutant phenotypes.
M. N. Price et al (2016). bioRxiv, 10.1101/072470.