PaperBLAST
PaperBLAST Hits for TCDB::Q8RJU8 NgcG, component of N-Acetylglucosamine/N,N'-diacetyl chitobiose porter (NgcK (C) not identified) (Streptomyces olivaceoviridis (Streptomyces corchorusii)) (307 a.a., MKTTEPPAPV...)
Show query sequence
>TCDB::Q8RJU8 NgcG, component of N-Acetylglucosamine/N,N'-diacetyl chitobiose porter (NgcK (C) not identified) (Streptomyces olivaceoviridis (Streptomyces corchorusii))
MKTTEPPAPVPAEPGTTVTKTDAPPAPPQKEKKEGTVLNVFSHGILVLWAFMVVLPLLWA
VMTSFKDDASIFGSPWSLPDKLHFDNWSRAWTEAHMGDYFLNTVLVVGGSLIGTLVLGSM
AAYVLARFDFPGNRFIYYLFIGGMSFPIMLALVPLFYVVNNMGLLNTLHGLILVYIAYSL
PFTVFFLTAFFRTLPSSVAEAAFVDGASHTRTFFQIMLPMAKPGLISVGIFNFLGQWNQY
MLPTVLNTDPDKRVLTQGLVQLAVSQGYKGDWSGLFAGLVMAMLPVLAAYIIFQRQVVQG
LTAGALK
Running BLASTp...
Found 250 similar proteins in the literature:
TC 3.A.1.1.18 / Q8RJU8 NgcG, component of N-Acetylglucosamine/N,N'-diacetyl chitobiose porter (NgcK (C) not identified) from Streptomyces olivaceoviridis (Streptomyces corchorusii) (see paper)
100% identity, 100% coverage
- substrates: N,N'-diacetyl chitobiose, N-acetylglucosamine
NGCG_STRCO / O50501 Diacetylchitobiose uptake system permease protein NgcG from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) (see paper)
SCO6007 probable transmembrane transport protein from Streptomyces coelicolor A3(2)
50% identity, 97% coverage
- function: Part of the ABC transporter complex NgcEFG-MsiK involved in N,N'-diacetylchitobiose ((GlcNAc)2) uptake. Responsible for the translocation of the substrate across the membrane.
subunit: The complex is composed of two ATP-binding proteins (MsiK), two transmembrane proteins (NgcF and NgcG) and a solute-binding protein (NgcE). - NgcESco Acts as a Lower-Affinity Binding Protein of an ABC Transporter for the Uptake of N,N'-Diacetylchitobiose in Streptomyces coelicolor A3(2)
Iinuma, Microbes and environments 2018 - “...cluster includes two additional ORFs encoding the putative ABC-type integral membrane proteins ( SCO6006 and SCO6007 ) that form a transporter permease ( Fig. S1 ). Regarding most streptomycetes sugar ABC transporters, the gene for the ATPase component was not included in the cluster and energy...”
- “...identity for the SCO6005 protein and NgcE, 44% for SCO6006 and NgcF, and 50% between SCO6007 and NgcG ( Fig. S1 ). In contrast, the other streptomycetes NgcE orthologues share between 80 to 91% amino acid identities throughout the full-length sequence. These low amino acid identities...”
- The ROK family regulator Rok7B7 pleiotropically affects xylose utilization, carbon catabolite repression, and antibiotic production in streptomyces coelicolor
Świątek, Journal of bacteriology 2013 - “...by two sugar transport operons, namely, SCO6005 to SCO6007 (upstream) and the xylose transporter operon xylFGH (SCO6009 to SCO6011; downstream), with its gene...”
- “...is transported via DasABC (51). Since SCO6005 to SCO6007 shows limited sequence similarity to NgcEFG (around 35% amino acid identity), it likely transports a...”
- The dasABC gene cluster, adjacent to dasR, encodes a novel ABC transporter for the uptake of N,N'-diacetylchitobiose in Streptomyces coelicolor A3(2)
Saito, Applied and environmental microbiology 2007 - “...occurred (Fig. 5B). Putative ORFs (SCO6005, SCO6006, and SCO6007) corresponding to the ngcEFG genes of S. olivaceoviridis are present in the S. coelicolor A3(2)...”
Blon_0885 binding-protein-dependent transport systems inner membrane component from Bifidobacterium longum subsp. infantis ATCC 15697
36% identity, 91% coverage
Tsac_1464 carbohydrate ABC transporter permease from Thermoanaerobacterium saccharolyticum JW/SL-YS485
33% identity, 91% coverage
Csac_0694 binding-protein-dependent transport systems inner membrane component from Caldicellulosiruptor saccharolyticus DSM 8903
35% identity, 85% coverage
TC 3.A.1.1.41 / G4FGN6 ABC-type transporter, integral membrane subunit, component of Trehalose porter. Also binds sucrose (Boucher and Noll, 2011). Induced by glucose and trehalose. Directly regulated by trehalose-responsive regulator TreR from Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)
34% identity, 86% coverage
Balac_0516 putative binding protein-dependent transporter from Bifidobacterium animalis subsp. lactis Bl-04
37% identity, 85% coverage
BCAN_A0240 binding-protein-dependent transport systems inner membrane component from Brucella canis ATCC 23365
34% identity, 91% coverage
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...BMEI1713, malK BruAb10233 BR0238 BOV_0231 BCAN_A0241 OSP Maltose import IM BMEI1714, malG BruAb10231 BR0237 BOV_0230 BCAN_A0240 OSP Maltose import IM BMEI1715, malF BruAb10232 BR0236 BOV_0229 BCAN_A0239 OSP Maltose import BP BMEI1716 BruAb10230 BR0235 BOV_0228 BCAN_A0238 76 OSP Oligosaccharide or polyol import ABC BMEII0112, ugpC BruAb21119 BRA1183...”
SPO_RS09345 carbohydrate ABC transporter permease from Ruegeria pomeroyi DSS-3
35% identity, 86% coverage
MSMEG_5147 sugar ABC-transporter integral membrane protein from Mycobacterium smegmatis str. MC2 155
32% identity, 93% coverage
PGA1_c27950 N-Acetyl-D-glucosamine ABC transport system, permease component 2 from Phaeobacter inhibens DSM 17395
33% identity, 88% coverage
- mutant phenotype: Specific phenotypes on N-Acetyl-D-Glucosamine.
BR0237 sugar ABC transporter, permease protein from Brucella suis 1330
BOV_0230 sugar ABC transporter, permease protein from Brucella ovis ATCC 25840
33% identity, 91% coverage
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...import ABC BMEI1713, malK BruAb10233 BR0238 BOV_0231 BCAN_A0241 OSP Maltose import IM BMEI1714, malG BruAb10231 BR0237 BOV_0230 BCAN_A0240 OSP Maltose import IM BMEI1715, malF BruAb10232 BR0236 BOV_0229 BCAN_A0239 OSP Maltose import BP BMEI1716 BruAb10230 BR0235 BOV_0228 BCAN_A0238 76 OSP Oligosaccharide or polyol import ABC BMEII0112, ugpC...”
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...ABC BMEI1713, malK BruAb10233 BR0238 BOV_0231 BCAN_A0241 OSP Maltose import IM BMEI1714, malG BruAb10231 BR0237 BOV_0230 BCAN_A0240 OSP Maltose import IM BMEI1715, malF BruAb10232 BR0236 BOV_0229 BCAN_A0239 OSP Maltose import BP BMEI1716 BruAb10230 BR0235 BOV_0228 BCAN_A0238 76 OSP Oligosaccharide or polyol import ABC BMEII0112, ugpC BruAb21119...”
TC 3.A.1.1.25 / Q72H66 Maltose transport system permease protein malG aka TT_C1629, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose from Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) (see paper)
WP_011173998 carbohydrate ABC transporter permease from Thermus thermophilus
TTC1629 No description from Thermus thermophilus HB27
34% identity, 82% coverage
BMEI1714 MALTOSE TRANSPORT SYSTEM PERMEASE PROTEIN MALG from Brucella melitensis 16M
33% identity, 91% coverage
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...75 OSP Maltose import ABC BMEI1713, malK BruAb10233 BR0238 BOV_0231 BCAN_A0241 OSP Maltose import IM BMEI1714, malG BruAb10231 BR0237 BOV_0230 BCAN_A0240 OSP Maltose import IM BMEI1715, malF BruAb10232 BR0236 BOV_0229 BCAN_A0239 OSP Maltose import BP BMEI1716 BruAb10230 BR0235 BOV_0228 BCAN_A0238 76 OSP Oligosaccharide or polyol import...”
BAB1_0240 Binding-protein-dependent transport systems inner membrane component from Brucella melitensis biovar Abortus 2308
33% identity, 91% coverage
NWMN_0154 hypothetical protein from Staphylococcus aureus subsp. aureus str. Newman
32% identity, 91% coverage
SAUSA300_0211 maltose ABC transporter, permease protein from Staphylococcus aureus subsp. aureus USA300_FPR3757
SA0209 hypothetical protein from Staphylococcus aureus subsp. aureus N315
SAV0216 maltose/maltodextrin transport permease homolog from Staphylococcus aureus subsp. aureus Mu50
SAR0208 putative sugar transport system permease from Staphylococcus aureus subsp. aureus MRSA252
SACOL0195 maltose ABC transporter, permease protein from Staphylococcus aureus subsp. aureus COL
31% identity, 90% coverage
- Human Urine Alters Methicillin-Resistant Staphylococcus aureus Virulence and Transcriptome
Paudel, Applied and environmental microbiology 2021 (secret) - Isothermal titration calorimetry analysis of the binding between the maltodextrin binding protein malE of Staphylococcus aureus with maltodextrins of various lengths
Takemiya, Biochemical and biophysical research communications 2024 (secret) - Transcriptional profiles of the response of methicillin-resistant Staphylococcus aureus to pentacyclic triterpenoids
Chung, PloS one 2013 - “...transduction mechanisms SA1883 kdpE KDP operon transcriptional regulatory protein 2.7 Signal transduction mechanisms Aminoacyl-tRNA biosynthesis SA0209 serS Seryl-tRNA synthetase 2.7 Translation SA0475 lysS Lysyl-tRNA synthetase 3.3 Translation SA1106 proS Propyl-tRNA synthase 2.3 Translation SA1287 asnC Asparaginyl-tRNA synthase 2.3 Translation SA1506 thrS Threonyl-tRNA synthase I 2.6 Translation...”
- Exposure of clinical MRSA heterogeneous strains to β-lactams redirects metabolism to optimize energy production through the TCA cycle
Keaton, PloS one 2013 - “...permease ( lctP , SA0106), probable homolog of lactate permease (SA2156), hypothetical maltose/maltodextrin permease homolog (SA0209) and glycerol-3-phosphate transporter ( glpT , SA0325). Amino Acid Transport and Metabolism and Cell Wall Precursors The second group of genes displaying differential expression between SA13011-HeR/HoR strains included up-regulation of...”
- walK and clpP mutations confer reduced vancomycin susceptibility in Staphylococcus aureus
Shoji, Antimicrobial agents and chemotherapy 2011 - “...1.86 2.28 2.22 2.16 2.54 2.52 2.24 SA0110 SA0111 SA0209 SA0229 SA0639 SA0640 SA0677 SA0891 SA1213 SA1214 SA1979 SA2234 SA2235 SA2236 SA2237 clpP gene SA0723...”
- Transcriptome and functional analysis of the eukaryotic-type serine/threonine kinase PknB in Staphylococcus aureus
Donat, Journal of bacteriology 2009 - “...2.3 2.8 ABC transporter or transporter proteins SA0209 SA0599 SA1243 SA1744 SA1745 SA2227 Maltose/maltodextrin transport permease homolog ATP-binding cassette...”
- Characterization of a strain of community-associated methicillin-resistant Staphylococcus aureus widely disseminated in the United States
Tenover, Journal of clinical microbiology 2006 - “...Cell wall protein Cell wall protein SA2659 SA0209 SA1869 SA1868 SA1867 SA1866 SA1865 Aureolysin Coagulase Serine protease Serine protease Serine protease...”
- Reporter metabolite analysis of transcriptional profiles of a Staphylococcus aureus strain with normal phenotype and its isogenic hemB mutant displaying the small-colony-variant phenotype
Seggewiss, Journal of bacteriology 2006 - “...ET AL. J. BACTERIOL. TABLE 2--Continued Fold changeb SA0432 SA0209 SA0206 SA0640 0.00 0.00 0.00 0.00 2.52 0.20 0.20 2.01 SA0172 SA0186 SA0639 0.00 0.00 0.01...”
- Comparative genomics of Staphylococcus aureus musculoskeletal isolates
Cassat, Journal of bacteriology 2005 - “...ORF in strain: ORF description a b SA0024 SA0078 SA0209 SA0317 SA0712 SA0857 SA0860 SA1028 SA1056 SA1057 SA1357 SA1864 SA1865 SA1866 SA1867 SA1868 SA1869 SA1970...”
- More
- Transcriptional Analysis of the Effects of Gambogic Acid and Neogambogic Acid on Methicillin-Resistant Staphylococcus aureus
Hua, Frontiers in pharmacology 2019 - “...None PTS system EIIBC component 2.5 2.82 SAV0193 None RpiR family transcriptional regulator 2.25 2.56 SAV0216 None arabinogalactan ABC transporter permease 1.91 2.17 SAV0217 None oxidoreductase 1.86 2.39 SAV0218 None NADH-dependent dehydrogenase 1.86 2.34 SAV0219 None xylose isomerase 1.58 2.16 SAV0222 uhpT antiporter [Staphylococcus sugar phosphate...”
- The Staphylococcus aureus response to unsaturated long chain free fatty acids: survival mechanisms and virulence implications
Kenny, PloS one 2009 - “...SAR2117 groES 10 kDa chaperonin 2.78 1.92E-04 Metabolism SAR0189 putative thiamine pyrophosphate enzyme 2.94 1.51E-04 SAR0208 putative sugar transport system permease 2.94 2.68E-02 SAR0209 putative oxidoreductase 4.75 1.21E-02 SAR0210 putative oxidoreductase 9.09 3.75E-03 SAR0527 putative phosphotransferase 4.55 7.03E-08 SAR0752 putative phosphofructokinase 2.44 3.20E-02 SAR0753 fruA fructose-specific...”
- In vitro and in vivo models of Staphylococcus aureus endophthalmitis implicate specific nutrients in ocular infection
Sadaka, PloS one 2014 - “...(1.2) 4.2 (1.4) SACOL0194 Maltose ABC transporter permease protein 11.1 (1.5) 3.3 (1.4) 3.7 (1.4) SACOL0195 Maltose ABC transporter permease protein 13.9 (1.5) 3.7 (1.4) 3.4 (1.5) SACOL0196 Oxidoreductase, Gfo/Idh/MocA family 12.6 (1.5) 3.3 (1.3) 3.9 (1.5) SACOL0197 Oxidoreductase, Gfo/Idh/MocA family 10.2 (1.4) 3.2 (1.1) 3.2...”
BAD_RS02265 carbohydrate ABC transporter permease from Bifidobacterium adolescentis ATCC 15703
33% identity, 83% coverage
- Combining of transcriptome and metabolome analyses for understanding the utilization and metabolic pathways of Xylo-oligosaccharide in Bifidobacterium adolescentis ATCC 15703
Yang, Food science & nutrition 2019 - “...protein 2,060.19 319.83 BAD_RS00390 2.33 BR1785 Branchedchain amino acid ABC transporter substratebinding protein 30.52 6.05 BAD_RS02265 2.38 yurM Thiamine ABC transporter ATPbinding protein 2,679.25 514.59 BAD_RS02260 2.34 malF Sugar ABC transporter permease 2,356.22 466 BAD_RS00385 2.28 livF ABCtype branchedchain amino acid transport systems ATPase component 25.2...”
- “...(encoded by BAD_RS00815, BAD_RS08280, BAD_RS00810, BAD_RS08205, BAD_RS03705, BAD_RS02260, BAD_RS07410) and transporter ATPbinding protein (encoded by BAD_RS02265, BAD_RS00495, BAD_RS04090, BAD_RS08375) were upregulated (Table 3 ), the same situation occurs in metabolites, including Lthreonine (meta_58), cellobiose (meta_991), Dmannose (meta_166), Lisoleucine (meta_82), maltotriose (meta_1695), Dbiotin (meta_651), and glycerol (meta_15)...”
BAS0537 glycerol-3-phosphate ABC transporter, permease protein, putative from Bacillus anthracis str. Sterne
AW20_2179 carbohydrate ABC transporter permease from Bacillus anthracis str. Sterne
33% identity, 88% coverage
BRA0519 sugar ABC transporter, permease protein from Brucella suis 1330
BMEII0752 MALTOSE TRANSPORT SYSTEM PERMEASE PROTEIN MALG from Brucella melitensis 16M
BCAN_B0518 hypothetical protein from Brucella canis ATCC 23365
33% identity, 91% coverage
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...import ABC BMEII0750 BruAb20702 BRA0521 BOV_A0454 BCAN_B0520 OSP Oligosaccharide or polyol import IM BMEII0752 BruAb20704 BRA0519 BOV_A0452 BCAN_B0518 OSP Oligosaccharide or polyol import IM BMEII0753 BruAb20705 BRA0518 BOV_A0451 BCAN_B0517 OSP Oligosaccharide or polyol import BP BMEII0754 BruAb20706 BRA0516 BOV_A0449 BCAN_B0516 OSP Oligosaccharide or polyol import BP...”
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...or polyol import ABC BMEII0750 BruAb20702 BRA0521 BOV_A0454 BCAN_B0520 OSP Oligosaccharide or polyol import IM BMEII0752 BruAb20704 BRA0519 BOV_A0452 BCAN_B0518 OSP Oligosaccharide or polyol import IM BMEII0753 BruAb20705 BRA0518 BOV_A0451 BCAN_B0517 OSP Oligosaccharide or polyol import BP BMEII0754 BruAb20706 BRA0516 BOV_A0449 BCAN_B0516 OSP Oligosaccharide or polyol...”
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...BMEII0750 BruAb20702 BRA0521 BOV_A0454 BCAN_B0520 OSP Oligosaccharide or polyol import IM BMEII0752 BruAb20704 BRA0519 BOV_A0452 BCAN_B0518 OSP Oligosaccharide or polyol import IM BMEII0753 BruAb20705 BRA0518 BOV_A0451 BCAN_B0517 OSP Oligosaccharide or polyol import BP BMEII0754 BruAb20706 BRA0516 BOV_A0449 BCAN_B0516 OSP Oligosaccharide or polyol import BP BMEII0755 81...”
OB3121 sugar ABC transporter permease from Oceanobacillus iheyensis HTE831
32% identity, 83% coverage
- Reconstruction of xylose utilization pathway and regulons in Firmicutes
Gu, BMC genomics 2010 - “...xyloside transport via a committed ABC cassette was predicted for Oceanobacillus iheyensis ( OB3123 - OB3121 ) and several other species. The Xyn ABC transport system is homologous to an oligosaccharide ABC transporter from the Streptococcus mutans (~24% identity; [ 25 ]). The functional prediction is...”
GK0706 maltose/maltodextrin transport system (permease) from Geobacillus kaustophilus HTA426
33% identity, 84% coverage
BOV_A0452 sugar ABC transporter, permease protein from Brucella ovis ATCC 25840
32% identity, 91% coverage
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...ABC BMEII0750 BruAb20702 BRA0521 BOV_A0454 BCAN_B0520 OSP Oligosaccharide or polyol import IM BMEII0752 BruAb20704 BRA0519 BOV_A0452 BCAN_B0518 OSP Oligosaccharide or polyol import IM BMEII0753 BruAb20705 BRA0518 BOV_A0451 BCAN_B0517 OSP Oligosaccharide or polyol import BP BMEII0754 BruAb20706 BRA0516 BOV_A0449 BCAN_B0516 OSP Oligosaccharide or polyol import BP BMEII0755...”
SCO2944 sugar transporter membrane protein from Streptomyces coelicolor A3(2)
34% identity, 85% coverage
RVY76_RS12735 carbohydrate ABC transporter permease from Palleronia sp. LCG004
28% identity, 93% coverage
BL105A_1886, Bbr_1858 carbohydrate ABC transporter permease from Bifidobacterium longum
32% identity, 90% coverage
TC 3.A.1.1.44 / Q9KZ08 Putative maltose permease, component of MalEFG (K unknown), involved in maltose and maltodextrin uptake from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
SCO2229 maltose permease from Streptomyces coelicolor A3(2)
30% identity, 100% coverage
SM_b21105 ABC transporter for L-Fucose, permease component 2 from Sinorhizobium meliloti 1021
32% identity, 91% coverage
- mutant phenotype: Specific phenotypes on L-Fucose.
AOT13_07020 sugar ABC transporter permease from Parageobacillus thermoglucosidasius
32% identity, 91% coverage
SMc02871 ABC transporter for N-Acetyl-D-glucosamine, permease protein 2 from Sinorhizobium meliloti 1021
31% identity, 86% coverage
- mutant phenotype: Specific phenotypes on N-Acetyl-D-Glucosamine; N-Acetyl-D-Glucosamine.
B8809_1751 carbohydrate ABC transporter permease from Bifidobacterium longum subsp. longum
BL0190 sugar permease of ABC transporter system from Bifidobacterium longum NCC2705
30% identity, 96% coverage
TEL01S_RS00535 carbohydrate ABC transporter permease from Pseudothermotoga elfii DSM 9442 = NBRC 107921
31% identity, 90% coverage
MALG_THELN / Q7LYX6 Trehalose/maltose transport system permease protein MalG from Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) (see 3 papers)
TC 3.A.1.1.7 / O51925 MalG aka PF1741, component of Maltose/trehalose porter (see paper)
PF1741 trehalose/maltose transport inner membrane protein from Pyrococcus furiosus DSM 3638
32% identity, 85% coverage
- function: Part of the ABC transporter complex MalEFGK involved in trehalose/maltose import. Responsible for the translocation of the substrate across the membrane.
subunit: The complex is composed of two ATP-binding proteins (MalK), two transmembrane proteins (MalG and MalF) and a solute-binding protein (MalE). - substrates: Maltose, Trehalose
- Carbohydrate metabolism in Archaea: current insights into unusual enzymes and pathways and their regulation
Bräsen, Microbiology and molecular biology reviews : MMBR 2014 - “...transporters, specific for trehalose/maltose (TM system [PF1739 to PF1741 and PF1744]) and maltodextrins (MD system [PF1933 and PF1936 to PF1938]), were found...”
- Impact of substrate glycoside linkage and elemental sulfur on bioenergetics of and hydrogen production by the hyperthermophilic archaeon Pyrococcus furiosus
Chou, Applied and environmental microbiology 2007 - “...6845 6846 CHOU ET AL. ose transporter (PF1739 to PF1741) and a TrmB homolog (PF1743) known to regulate maltose uptake (30), was minimally affected by the...”
- “...binding module Membrane protein, DUF835 Mal I operon PF1739 PF1740 PF1741 PF1742 PF1743 PF1744 PF1745 PF1746 PF1747 PF1748 PF1749 1.6 NC NC 1.7 1.8 1.6 NC NC NC...”
- Transcriptional and biochemical analysis of starch metabolism in the hyperthermophilic archaeon Pyrococcus furiosus
Lee, Journal of bacteriology 2006 - “...phosphorylase Maltose/trehalose-binding protein (Mal-I) PF1740 PF1741 PF1742 PF1743 PF1744 PF1933 PF1935*d PF1936 PF1937 PF1938 Maltose/trehalose transport...”
- “...E. coli. One is the Mal-I transporter (PF1739 to PF1741, PF1744), which in P. furiosus has been shown to recognize and transport maltose and trehalose but not...”
- Metabolic and evolutionary relationships among Pyrococcus Species: genetic exchange within a hydrothermal vent environment
Hamilton-Brehm, Journal of bacteriology 2005 - “...transporter (malEFG and malK, represented by PF1739 to PF1741 and PF1744, respectively), as well as a trehalose-degrading enzyme (PF1742) (1, 32, 36, 37, 44,...”
- “...PF0796 PF0797 PF0798 PF1337 PF1339 PF1340 PF1737 PF1738 PF1339 PF1740 PF1741 PF1742 PF1743 PF1744 PF1745 PF1746 PF1747 PF1748 PF1749 PF1750 PF1751 * * * * * * *...”
- Whole-genome DNA microarray analysis of a hyperthermophile and an archaeon: Pyrococcus furiosus grown on carbohydrates or peptides
Schut, Journal of bacteriology 2003 - “...PF1710 PF1711 PF1713 PF1739 [Maltose transport] PF1740 PF1741 PF1742 PF1784 PF1852 PF1870 [Maltose transport] PF1935 PF1936 PF1937 PF1938 PF1951 PF1975 Mean...”
- Biochemical evidence for the presence of two alpha-glucoside ABC-transport systems in the hyperthermophilic archaeon Pyrococcus furiosus
Koning, Archaea (Vancouver, B.C.) 2002 - “...furiosus Escherichia coli MalE PF1938 PF1937 PF1936 PF1933 PF1739 PF1740 PF1741 PF1744 1 2 Identity. Similarity. 1 MalF MalG MalK 2 28 (46) 35 (56) 33 (55) 47...”
smoH / Q7CS31 ABC-type 3-(6-sulfo-α-D-quinovosyl)-sn-glycerol transporter permease subunit from Agrobacterium fabrum (strain C58 / ATCC 33970) (see paper)
Atu3284 ABC transporter, membrane spanning protein (sugar) from Agrobacterium tumefaciens str. C58 (Cereon)
32% identity, 82% coverage
- Oxidative desulfurization pathway for complete catabolism of sulfoquinovose by bacteria
Sharma, Proceedings of the National Academy of Sciences of the United States of America 2022 - “...( Atu3277 - Atu3285 ) for cells grown on SQ. Proteins encoded by Atu3283 and Atu3284 were not observed; however, they are predicted to be integral membrane proteins that can be difficult to detect using conventional proteomic workflows ( 14 ). Thus, the gene cluster Atu3277-Atu3285...”
- “...the gene cluster identified through proteomics, Atu3281 ( smoE ), Atu3283 ( smoG ), and Atu3284 ( smoH ) were annotated as an ABC transporter system, with Atu3282 ( smoF ) encoding an associated periplasmic solute-binding protein. The substrate preferences of solute-binding proteins are useful for...”
ERH_1244 carbohydrate ABC transporter permease from Erysipelothrix rhusiopathiae str. Fujisawa
33% identity, 91% coverage
- Proteomic and Transcriptomic Analyses of Swine Pathogen Erysipelothrix rhusiopathiae Reveal Virulence Repertoire
Li, PloS one 2016 - “...systems, permease components gi|509078903 ABC transporter, permease protein 6.6 2 1.617 Predicted transcriptional regulators down ERH_1244 gi|336066105 ACT domain-containing protein 30.3 3 1.705 ABC-type sugar transport system, permease component up ERH_0867 gi|322464145 putative endoribonuclease L-PSP 27.1 3 1.806 ACT domain-containing protein gi|336065349 DNA binding helix-turn helix...”
- The genome of Erysipelothrix rhusiopathiae, the causative agent of swine erysipelas, reveals new insights into the evolution of firmicutes and the organism's intracellular adaptations
Ogawa, Journal of bacteriology 2011 - “...ERH_0414, ERH_0417, ERH_1083, ERH_1084, ERH_1085, ERH_1244, ERH_1245, ERH_1246, ERH_1523 ERH_0895, ERH_0896, ERH_1350, ERH_1351, ERH_1352, ERH_1517. ERH_1518,...”
BH1866 sugar transport system (permease) (binding protein dependent transporter) from Bacillus halodurans C-125
30% identity, 91% coverage
SSA_0076 ABC sugar transporter, permease protein, putative from Streptococcus sanguinis SK36
28% identity, 90% coverage
RUMGNA_02696 hypothetical protein from Ruminococcus gnavus ATCC 29149
30% identity, 90% coverage
- Elucidation of a sialic acid metabolism pathway in mucus-foraging Ruminococcus gnavus unravels mechanisms of bacterial adaptation to the gut
Bell, Nature microbiology 2019 - “...single ABC transporter, orthologous to the uncharacterised Steptococcus pneumoniae SAT2 system (Sp_1690-2), including two permeases (RUMGNA_02696 and 02697) and Rg SBP (RUMNGA_02698). R. gnavus SAT2 transporter is expected to be coupled with an MsiK-like ATPase encoded elsewhere in the genome, with RUMGNA_03040 sharing 59% identity with...”
- The mucin-degradation strategy of Ruminococcus gnavus: The importance of intramolecular trans-sialidases
Crost, Gut microbes 2016 - “...transporter composed of a solute-binding protein (RUMGNA_02698 or RGNV35913_01296) and two putative permeases (RUMGNA_02697 and RUMGNA_02696, or RGNV35913_01295 and RGNV35913_01294) ( Fig.5A ). It is not known whether this transporter is specific of the 2,7-anhydro-Neu5Ac or could also transport Neu5Ac. Once inside the cell, 2,7-anhydro-Neu5Ac could...”
- “...solute-binding protein (RUMGNA_02698 in ATCC 29149;RGNV35913_01296 in ATCC 35913) and two putative permeases (RUMGNA_02697 and RUMGNA_02696 in ATCC 29149; RGNV35913_01295 and RGNV35913_01294 in ATCC 35913) and then hydrolyzed into Neu5Ac, possibly by the action of RUMGNA_02701 or RGNV35913_01299, before being catabolized into GlcNAc-6-P following the traditional...”
- Utilisation of mucin glycans by the human gut symbiont Ruminococcus gnavus is strain-dependent
Crost, PloS one 2013 - “...following 3 genes code for a predicted solute-binding protein (RUMGNA_02698) and two putative permeases (RUMGNA_02697, RUMGNA_02696), components of a sugar ABC transporter; RUMGNA_02696gp has specific homology with putative sialic acid transporters of the SAT2 family [54] . The following gene has no known function. The sialidase...”
- “...pairs). To confirm this bioinformatics analysis, RT-PCR analysis using primer sets encompassing the neighboring ORFs (RUMGNA_02696 to RUMGNA_02691) was performed on total RNA extracted from a mid-logarithmic phase culture of R. gnavus ATCC 29149 grown with mucins or 3SL as sole carbon source. The data showed...”
RL0093 putative transmembrane component of ABC transporter from Rhizobium leguminosarum bv. viciae 3841
27% identity, 94% coverage
SGO_0122 ABC transporter permease protein SP1688 from Streptococcus gordonii str. Challis substr. CH1
30% identity, 90% coverage
all4824 permease protein of sugar ABC transporter from Nostoc sp. PCC 7120
33% identity, 86% coverage
- Metagenomic analysis of soybean endosphere microbiome to reveal signatures of microbes for health and disease
Chouhan, Journal, genetic engineering & biotechnology 2023 - “...Nostoc sp. PCC 7120 all5344 468 Nostoc sp. PCC 7120 all1863 864 Trichormus variabilis NIES-23 all4824 798 Trichormus variabilis ATCC 29413 all0781 1590 Trichormus variabilis ATCC 29413 all4426 1254 Pathway analysis Pathway analysis is a powerful tool to understand the biological significance of gene lists generated...”
- Chemoheterotrophic growth of the Cyanobacterium Anabaena sp. strain PCC 7120 dependent on a functional cytochrome c oxidase
Stebegg, Journal of bacteriology 2012 - “...7120, 16 genes (all0261, all1027, all1823, all1916, all4824, all5282, alr0738, alr0789, alr2532, alr2722, alr3705, alr4277, alr4781, alr5362, alr5367, and...”
Bbr_1656 carbohydrate ABC transporter permease from Bifidobacterium breve UCC2003
30% identity, 95% coverage
LMOf2365_1756 ABC transporter, permease protein from Listeria monocytogenes str. 4b F2365
lin1843 similar to sugar ABC transporter, permease protein from Listeria innocua Clip11262
30% identity, 91% coverage
C289_0778 carbohydrate ABC transporter permease from Anoxybacillus ayderensis
32% identity, 85% coverage
- A high molecular-mass Anoxybacillus sp. SK3-4 amylopullulanase: characterization and its relationship in carbohydrate utilization
Kahar, International journal of molecular sciences 2013 - “...(C289_0857, C289_1909, and C289_2139). Several putative sugar transporters (C289_0465, C289_0466, C289_0467, C289_0603, C289_0763, C289_0764, C289_0765, C289_0778, C289_0779, C289_0780, C289_1015, C289_1174, C289_1392, C289_1394, C289_1910, C289_1911, and C289_1912) were also found in the Blast2GO annotation. The draft genome was submitted to the National Center for Biotechnology Information (NCBI)...”
Csac_2491 binding-protein-dependent transport systems inner membrane component from Caldicellulosiruptor saccharolyticus DSM 8903
30% identity, 82% coverage
lmo0767 similar to ABC transporter, permease protein from Listeria monocytogenes EGD-e
30% identity, 83% coverage
- The PAMP c-di-AMP Is Essential for Listeria monocytogenes Growth in Rich but Not Minimal Media due to a Toxic Increase in (p)ppGpp. [corrected]
Whiteley, Cell host & microbe 2015 - “...RNA binding domain protein similar to yabR LMRG 02640::121 43 1.2 72 2.6 102 2.7 lmo0767 Sugar ABC transporter permease LMRG 00455::222 42 1.4 80 0.9 100 1.3 lmo1884 Xanthine uptake transporter similar to pbuX LMRG 01031::319 41 0.7 77 1.5 107 2.9 P lmo0974 Promoter...”
- Stress response and adaptation of Listeria monocytogenes 08-5923 exposed to a sublethal dose of carnocyclin A
Liu, Applied and environmental microbiology 2014 - “...abc mfs ywzB mptAB mptC celA celB celC lmo0767 lmo1250 lmo2527 lmo0096 lmo0097 lmo2765 lmo2762 lmo2763 ABC transporter, permease protein Major facilitator...”
- Listeria monocytogenes differential transcriptome analysis reveals temperature-dependent Agr regulation and suggests overlaps with other regulons
Garmyn, PloS one 2012 - “..., lmo2000 , bvrB ) [35] and putative sugar ABC transporters (for example lmo0768 , lmo0767 and lmo0766 ) had higher transcript levels in DG125A compared to EGD-e. Two genes with higher transcript level ( lmo1884 and pyrP ) encode permeases for xanthine and uracil. Both...”
- Probing the pan-genome of Listeria monocytogenes: new insights into intraspecific niche expansion and genomic diversification
Deng, BMC genomics 2010 - “...IIIA + 119 lmo0766 Similar to putative sugar ABC transporter, permease protein IIIA + - lmo0767 Similar to ABC transporter, permease protein IIIA + - lmo1031 Hypothetical protein IIIA - 166 lmo1032 Similar to transketolase IIIA - 166 lmo1033 Similar to transketolase IIIA - 166 lmo1035...”
CPE0373 probable suger ABC transporter from Clostridium perfringens str. 13
31% identity, 88% coverage
SP_1895 sugar ABC transporter, permease protein from Streptococcus pneumoniae TIGR4
32% identity, 91% coverage
SPD_1675 sugar ABC transporter, permease protein from Streptococcus pneumoniae D39
32% identity, 91% coverage
- N-acetylglucosamine-Mediated Expression of nagA and nagB in Streptococcus pneumoniae
Afzal, Frontiers in cellular and infection microbiology 2016 - “...spd_1676 Sugar ABC transporter, RafF 6.6 spd_1634 Galactokinase, GalK 6.5 spd_1633 Galactose-1-phosphate uridylyltransferase, GalT 6.3 spd_1675 Sugar ABC transporter, RafG 5.6 spd_1047 PTS system, lactose-specific IIBC components, LacE 5.4 spd_0283 PTS system, IIC component 5.2 spd_1974 Hypothetical protein 4.8 spd_1046 6-phospho--galactosidase, LacG 4.4 spd_1049 Transcription antiterminator,...”
- Host glycan sugar-specific pathways in Streptococcus pneumoniae: galactose as a key sugar in colonisation and infection [corrected]
Paixão, PloS one 2015 - “...SPD_0250 Pullulanase, extracellular 2.9 SPD_1989 PTS system transporter subunit IID 2.6 SPD_0427 lacG-1 6-phospho-beta-galactosidase 2.5 SPD_1675 rafG Sugar ABC transporter permease 2.4 SPD_0925 Hydrolase 2.4 SPD_1937 malA Maltodextrose utilization protein MalA 2.3 SPD_0424 PTS system cellobiose-specific transporter subunit IIC 2.2 a Only genes potentially involved in...”
BRA0306 sugar ABC transporter, permease protein from Brucella suis 1330
BCAN_B0307 hypothetical protein from Brucella canis ATCC 23365
32% identity, 83% coverage
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...OSP Maltose import ABC BMEII0940 BruAb20874 BRA0307 BOV_A0282 BCAN_B0308 OSP Maltose import IM BMEII0942 BruAb20875 BRA0306 BOV_A0281 BCAN_B0307 OSP Maltose import IM BMEII0943 BruAb20876 BRA0305 BOV_A0280 BCAN_B0306 OSP Maltose import BP BMEII0944 BOV_A0279 OSP Maltose import BP BMEII0945 BruAb20877 BRA0304 BCAN_B0305 82 OTCN Glycine betaine/L-proline import...”
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...import ABC BMEII0940 BruAb20874 BRA0307 BOV_A0282 BCAN_B0308 OSP Maltose import IM BMEII0942 BruAb20875 BRA0306 BOV_A0281 BCAN_B0307 OSP Maltose import IM BMEII0943 BruAb20876 BRA0305 BOV_A0280 BCAN_B0306 OSP Maltose import BP BMEII0944 BOV_A0279 OSP Maltose import BP BMEII0945 BruAb20877 BRA0304 BCAN_B0305 82 OTCN Glycine betaine/L-proline import ABC BMEI0439,...”
TC 3.A.1.1.24 / Q72KX4 Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) from Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) (see paper)
TTHA0685 sugar ABC transporter, permease protein from Thermus thermophilus HB8
33% identity, 86% coverage
SCO2980 integral membrane transport protein from Streptomyces coelicolor A3(2)
30% identity, 97% coverage
- Genetic analysis of SCO2997, encoding a TagF homologue, indicates a role for wall teichoic acids in sporulation of Streptomyces coelicolor A3(2)
Kleinschnitz, Journal of bacteriology 2011 - “...(SCO2987 and SCO2994), and another ABC transporter (SCO2979/ SCO2980), whereas the tagO homologue (SCO5365) is encoded somewhere else in the genome. A second...”
- “...PBP2, FtsI, SCO3580, and SCO3901 were found (19). Also, SCO2980, an integral membrane transport protein that is encoded by the putative WTA cluster I, showed...”
SPD_1500 ABC transporter, permease protein from Streptococcus pneumoniae D39
SPCG_RS08595 carbohydrate ABC transporter permease from Streptococcus pneumoniae CGSP14
29% identity, 90% coverage
PM1760 unknown from Pasteurella multocida subsp. multocida str. Pm70
30% identity, 90% coverage
Cthe_1018 binding-protein-dependent transport systems inner membrane component from Clostridium thermocellum ATCC 27405
29% identity, 91% coverage
- A blue native-PAGE analysis of membrane protein complexes in Clostridium thermocellum
Peng, BMC microbiology 2011 - “...48 17 Cthe_1557 125974066 ABC transporter related protein ATP-binding protein 30203.7 175 21 47 18 Cthe_1018 125973533 binding-protein-dependent transport systems inner membrane component 31919.9 67 13 23 6 19 Cthe_1840 125974344 cysteine synthase 33392 469 25 57 20 Cthe_1104 125713844 prepilin-type cleavage/methylation 19233.2 183 21 65...”
- “...C10 14 Cthe_3148 ABC transporter related protein 140 C11 16 Cthe_1020 solute-binding protein 190 18 Cthe_1018 binding-protein-dependent transport systems inner membrane component 21 Cthe_1862 ABC transporter related protein C12 17 Cthe_1557 ABC transporter related protein ATP-binding protein 140 C13 22 Cthe_1754 solute-binding protein 170 C14 12...”
SAG0036 sugar ABC transporter, permease protein from Streptococcus agalactiae 2603V/R
28% identity, 90% coverage
TC 3.A.1.1.12 / Q9AI66 PalG, component of Palatinose (isomaltulose; 6-O-α-D-glucopyranosyl-D-fructose) uptake porter from Erwinia rhapontici (see paper)
30% identity, 85% coverage
cg1569 sn-glycerol-3-phosphate transport system permease protein from Corynebacterium glutamicum ATCC 13032
29% identity, 85% coverage
cg0831 sugar ABC transporter, permease protein from Corynebacterium glutamicum ATCC 13032
30% identity, 90% coverage
TC 3.A.1.1.6 / Q48397 CymG, component of Cyclodextrin porter from Klebsiella oxytoca (see paper)
28% identity, 88% coverage
lmo0180 similar to sugar ABC transporter, permease protein from Listeria monocytogenes EGD-e
31% identity, 88% coverage
XF2446 ABC transporter sugar permease from Xylella fastidiosa 9a5c
33% identity, 87% coverage
BMEII0942 MALTOSE TRANSPORT SYSTEM PERMEASE PROTEIN MALG from Brucella melitensis 16M
32% identity, 83% coverage
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...BMEII0755 81 OSP Maltose import ABC BMEII0940 BruAb20874 BRA0307 BOV_A0282 BCAN_B0308 OSP Maltose import IM BMEII0942 BruAb20875 BRA0306 BOV_A0281 BCAN_B0307 OSP Maltose import IM BMEII0943 BruAb20876 BRA0305 BOV_A0280 BCAN_B0306 OSP Maltose import BP BMEII0944 BOV_A0279 OSP Maltose import BP BMEII0945 BruAb20877 BRA0304 BCAN_B0305 82 OTCN Glycine...”
SP_1688 ABC transporter, permease protein from Streptococcus pneumoniae TIGR4
29% identity, 90% coverage
- Multi-omic profiling to assess the effect of iron starvation in Streptococcus pneumoniae TIGR4
Jiménez-Munguía, PeerJ 2018 - “...3/3 Downregulated 38765 SP_1465, SP_1466 2/2 Downregulated 38778 SP_1522, SP_1523 2/7 Downregulated 38815 SP_1686, SP_1687, SP_1688, SP_1689 4/4 Downregulated 38822 SP_1724, SP_1725 2/2 Downregulated 38840 SP_1809, SP_1810 2/2 Downregulated 38867 SP_1920, SP_1922 2/3 Downregulated 38868 SP_1923, SP_1924, SP_1925, SP_1926 4/4 Downregulated 38873 SP_1948, SP_1949 2/2 Downregulated...”
- Insights into the evolution of sialic acid catabolism among bacteria
Almagro-Moreno, BMC evolutionary biology 2009 - “...str . Challis substr. CH1 SAT 2 SGO_0122 1.00E-130 Streptococcus pneumoniae TIGR4 a SAT 2/3 SP_1688 SP_1682 3.00E-131 Streptococcus pneumoniae TIGR4 b Sym SP_1328 8.00E-59 Streptococcus pyogenes M1 GAS SAT 3 Spy_254 seed Streptococcus sanguinis SK36 SAT 2 SSA_0076 seed Vibrio cholerae N16961 TRAP VC1777 seed...”
- Site-specific contributions of glutamine-dependent regulator GlnR and GlnR-regulated genes to virulence of Streptococcus pneumoniae
Hendriksen, Infection and immunity 2008 - “...SP_1306 SP_1356 SP_1357 SP_1358 spr1302 SP_1651 SP_1659 SP_1688 spr1598 SP_1754 spr1620 SP_1811 SP_1817 SP_1869 SP_1870 SP_1871 SP_1872 SP_1887 SP_1888 SP_1889...”
SPD_1493 sugar ABC transporter, permease protein from Streptococcus pneumoniae D39
SPD_RS07935 carbohydrate ABC transporter permease from Streptococcus pneumoniae D39
30% identity, 90% coverage
- N-acetylglucosamine-Mediated Expression of nagA and nagB in Streptococcus pneumoniae
Afzal, Frontiers in cellular and infection microbiology 2016 - “...PTS system, mannose/fructose/sorbose family protein, IID component 3.0 spd_1494 Sugar ABC transporter, permease protein 2.7 spd_1493 Sugar ABC transporter, permease protein 2.4 spd_1866 N-acetylglucosamine-6-phosphate deacetylase, NagA 2.4 spd_1846 PTS system, IIB component 2.3 spd_1246 glucosamine-6-phosphate isomerase, NagB 2.3 spd_0264 PTS system, mannose-specific IIAB components, ManL 2.1...”
- N-acetylgalatosamine-Mediated Regulation of the aga Operon by AgaR in Streptococcus pneumoniae
Afzal, Frontiers in cellular and infection microbiology 2016 - “...lyase, NanA2 3.7 spd_1490 Hypothetical protein 3.5 spd_1491 Hypothetical protein 7.4 spd_1492 Hypothetical protein 3.9 spd_1493 Sugar ABC transporter, permease protein, NanW 4.8 spd_1494 Sugar ABC transporter, permease protein, NanV 2.5 spd_1495 Sugar ABC transporter, sugar-binding protein, NanU 6.4 spd_1496 PTS system, IIBC components, NanP 3.2...”
- Sialic acid-mediated gene expression in Streptococcus pneumoniae and role of NanR as a transcriptional activator of the nan gene cluster
Afzal, Applied and environmental microbiology 2015 - “...(NanP) (spd_1496), three ABC transporters (NanUVW) (spd_1493 to spd_1495), three hypothetical proteins (spd_1490 to spd_1492), an N-acetylneuraminate lyase...”
- “...spd_1330 spd_1488 spd_1489 spd_1490 spd_1491 spd_1492 spd_1493 spd_1494 spd_1495 spd_1496 spd_1497 spd_1504 spd_1505 spd_1800 spd_2012 spd_2013 Downregulated...”
- Transcriptional and metabolic effects of glucose on Streptococcus pneumoniae sugar metabolism
Paixão, Frontiers in microbiology 2015 - “...0.78 SPD_1057 PTS system, IIB component, putative 1.48 SPD_1409 Sugar ABC transporter, ATP-binding protein 0.52 SPD_1493 Sugar ABC transporter, permease protein 0.61 SPD_1494 Sugar ABC transporter, permease protein 0.54 SPD_1495 Sugar ABC transporter, sugar-binding protein 0.56 SPD_1496 PTS system, IIBC components 0.48 0.72 SPD_1832 PTS system,...”
- SPD_0410 negatively regulates capsule polysaccharide synthesis and virulence in <i>Streptococcus pneumoniae</i> D39
Tao, Frontiers in microbiology 2024 - “...SPD_RS00485 spd_0090 ABC transporter substrate-binding 2.16055 2.30E-07 SPD_RS05200 spd_0966 Sugar ABC transporter permease 1.05367 2.61E-07 SPD_RS07935 satC Carbohydrate ABC transporter 1.25945 2.60E-06 SPD_RS07940 satB Sugar ABC transporter permease 1.20096 0.000206 Phosphotransferase system SPD_RS00335 gadV PTS system mannose/fructose/N-acetylgalactosamine-transporter subunit IIB 1.76673 9.74E-06 SPD_RS00340 gadW PTSmannose/fructose/sorbose/N- PTS system...”
- Intracellular replication of Streptococcus pneumoniae inside splenic macrophages serves as a reservoir for septicaemia
Ercoli, Nature microbiology 2018 - “...strain D39 (serotype 2), its non-encapsulated derivative R6 51 , 52 , a sialidase/neuraminidase nanA (SPD_RS07935) deletion mutant 53 , the serotype 4 strain TIGR4 54 , and GFP and RFP fluorescent D39 (kindly provided by Jan Willem Veening, Groningen) 17 , were used in this...”
C289_0467 sugar ABC transporter permease from Anoxybacillus ayderensis
30% identity, 90% coverage
- A high molecular-mass Anoxybacillus sp. SK3-4 amylopullulanase: characterization and its relationship in carbohydrate utilization
Kahar, International journal of molecular sciences 2013 - “...(C289_2260), glycosidase (C289_2139), and oligo-1,6-glucosidase (C289_0857, C289_1909, and C289_2139). Several putative sugar transporters (C289_0465, C289_0466, C289_0467, C289_0603, C289_0763, C289_0764, C289_0765, C289_0778, C289_0779, C289_0780, C289_1015, C289_1174, C289_1392, C289_1394, C289_1910, C289_1911, and C289_1912) were also found in the Blast2GO annotation. The draft genome was submitted to the National...”
BAD_RS00815 carbohydrate ABC transporter permease from Bifidobacterium adolescentis ATCC 15703
30% identity, 86% coverage
- Combining of transcriptome and metabolome analyses for understanding the utilization and metabolic pathways of Xylo-oligosaccharide in Bifidobacterium adolescentis ATCC 15703
Yang, Food science & nutrition 2019 - “...1.58 lipO ABC transporter 10,020.43 3,361.71 BAD_RS08285 1.52 ugpB ABC transporter, solutebinding protein 1,971.94 686.94 BAD_RS00815 1.48 araQ Sugar ABC transporter permease 911.12 326.41 BAD_RS08280 1.46 msmF Sugar ABC transporter permease 1,353.65 491.14 BAD_RS00810 1.45 yurN Sugar ABC transporter permease 762.04 278.86 BAD_RS03705 1.35 ABC transporter...”
- “...for bifidobacteria. Compared to xylose treatment, genes including the sugar transporter permease protein (encoded by BAD_RS00815, BAD_RS08280, BAD_RS00810, BAD_RS08205, BAD_RS03705, BAD_RS02260, BAD_RS07410) and transporter ATPbinding protein (encoded by BAD_RS02265, BAD_RS00495, BAD_RS04090, BAD_RS08375) were upregulated (Table 3 ), the same situation occurs in metabolites, including Lthreonine (meta_58),...”
Blon_0460 binding-protein-dependent transport systems inner membrane component from Bifidobacterium longum subsp. infantis ATCC 15697
32% identity, 95% coverage
DR_1436 ABC transporter, permease protein, MalFG family from Deinococcus radiodurans R1
33% identity, 84% coverage
RLO149_c015770 carbohydrate ABC transporter permease from Roseobacter litoralis Och 149
28% identity, 92% coverage
- Comparative genome analysis and genome-guided physiological analysis of Roseobacter litoralis
Kalhoefer, BMC genomics 2011 - “...4.1.2.21) RLO149_c015740 DgoK: 2-dehydro-3-deoxygalactonokinase (EC 2.7.1.58) RLO149_c015750 short chain dehydrogenase RLO149_c015760 RafA: alpha-galactosidase (EC 3.2.1.22) RLO149_c015770 putative galactoside ABC transporter inner membrane component RLO149_c015780 putative galactoside ABC transporter inner membrane component RLO149_c015790 putative extracellular galactoside-binding protein RLO149_c015800 HTH-type transcriptional regulator, IclR family RLO149_c015810 putative galactoside ABC...”
SSGG_01377 sugar ABC transporter permease from Streptomyces filamentosus NRRL 15998
29% identity, 95% coverage
- Transcriptional analysis of the effect of exogenous decanoic acid stress on Streptomyces roseosporus
Liao, Microbial cell factories 2013 - “...of trehalose (Table 3 ). Expression of genes coding for the putative maltose ABC transporter (SSGG_01377), and Tres (SSGG_05057) which catalyzes the conversion of maltose into Trehalose was elevated. In addition, gene expression of alpha-amylase (SSGG_05058) was induced, which degrade starch to provide the maltose for...”
- “...significant change in expression in DA-stress relative to control Locus Gene description Log 2 stress/control SSGG_01377 putative maltose ABC transporter permease 2.46 SSGG_05057 trehalose synthase 3.09 SSGG_05058 alpha-amylase 2.12 SSGG_03685 fructose-bisphosphate aldolase 1.37 SSGG_06343 phosphopyruvate hydratase 1.63 SSGG_01114 pyruvate kinase 1.30 SSGG_02477 phosphopyruvate hydratase 1.53 Genes...”
BWI75_01850 carbohydrate ABC transporter permease from Gloeocapsopsis dulcis AAB1 = 1H9
30% identity, 86% coverage
GRD61_RS02145 carbohydrate ABC transporter permease from Clavibacter michiganensis subsp. michiganensis
30% identity, 99% coverage
Pf1N1B4_5114 sucrose ABC transporter, permease component 2 from Pseudomonas fluorescens FW300-N1B4
32% identity, 86% coverage
- mutant phenotype: Specific phenotype on sucrose
BSU06990 rhamnogalacturonan permease from Bacillus subtilis subsp. subtilis str. 168
28% identity, 92% coverage
Dshi_0549 ABC transporter for Xylitol, permease component 2 from Dinoroseobacter shibae DFL-12
33% identity, 88% coverage
- mutant phenotype: Specific phenotypes on Xylitol; Xylitol. Phenotype is very specific
Rv2834c PROBABLE Sn-GLYCEROL-3-PHOSPHATE TRANSPORT INTEGRAL MEMBRANE PROTEIN ABC TRANSPORTER UGPE from Mycobacterium tuberculosis H37Rv
30% identity, 82% coverage
- ATP-binding cassette (ABC) import systems of Mycobacterium tuberculosis: target for drug and vaccine development
Soni, Emerging microbes & infections 2020 - “...characterized. Sugar importers Glycerophosphocholine importer (UgpABCE /Rv2832c-Rv2835c) SBP: UgpB (Rv2833c) TMD: UgpA (Rv2835c) and UgpE (Rv2834c) NBD: UgpC (Rv2832c) (two copies) UgpB is a substrate of the twin-arginine translocation (Tat) pathway [ 39 ] Import glycerophosphocholine instead of sn-glycerol-3-phosphate and maltose [ 39 ] Trehalose importer...”
- Genomic epidemiology of multidrug-resistant Mycobacterium tuberculosis during transcontinental spread
Coscolla, The Journal of infectious diseases 2015 - “...... A G Rv2702 K197E 3 017 446 ppgK C G G A Rv2763c Rv2834c D70H T269I 3 073 402 3 140 509 dfrA ugpE C G Rv3201c V399L 3 575 842 ... G G A A Rv3308 Rv3415c...”
- From Corynebacterium glutamicum to Mycobacterium tuberculosis--towards transfers of gene regulatory networks and integrated data analyses with MycoRegNet
Krawczyk, Nucleic acids research 2009 - “...( pstA1 ), Rv2220 ( glnA1 ) Rv2832c ( ugpC ), Rv2833c ( ugpB ), Rv2834c ( ugpE ), Rv2835c ( ugpA ), Rv2918c ( glnD ) Rv2919c ( glnB ), Rv2920c ( amt ), Rv3859c ( gltB ) SOS and stress response Rv0867c ( rpfA...”
- “...( pstA1 ), Rv1095 ( phoH2 ) Rv2832c ( ugpC ), Rv2833c ( ugpB ), Rv2834c ( ugpE ), Rv2835c ( ugpA ) Rv0827c Macroelement and metal homeostasis Rv0827c (-) Rv1994c Macroelement and metal homeostasis Rv1994c (-) IdeR Carbohydrate metabolism Rv0247c (-), Rv3318 ( sdhA )...”
Atu3132 ABC transporter, membrane spanning protein (sugar) from Agrobacterium tumefaciens str. C58 (Cereon)
30% identity, 87% coverage
- Comparative Transcriptome Analysis of Agrobacterium tumefaciens Reveals the Molecular Basis for the Recalcitrant Genetic Transformation of Camellia sinensis L
Jin, Biomolecules 2022 - “...atu4786 and others), maltose ( atu0391 , atu4559 , atu4450 ), oligogalacturonide ( atu3130 , atu3132 ), glucose ( atu3351 , atu3352 ), rhamnose ( atu34873490 ), sn-glycerol 3-phosphate ( ugpC = atu3099 / atu3188 ), branched-chain amino acid ( livH = atu4518 , livG =...”
sugB / P9WG01 ABC-type trehalose transporter integral membrane protein from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
SUGB_MYCTU / P9WG01 Trehalose transport system permease protein SugB from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
TC 3.A.1.1.31 / O50453 PROBABLE SUGAR-TRANSPORT INTEGRAL MEMBRANE PROTEIN ABC TRANSPORTER SUGB, component of The trehalose-recycling ABC transporter, LpqY-SugA-SugB-SugC (essential for virulence) from Mycobacterium tuberculosis (see 3 papers)
Rv1237 PROBABLE SUGAR-TRANSPORT INTEGRAL MEMBRANE PROTEIN ABC TRANSPORTER SUGB from Mycobacterium tuberculosis H37Rv
NP_215753 sugar ABC transporter permease SugB from Mycobacterium tuberculosis H37Rv
31% identity, 83% coverage
- function: Part of the ABC transporter complex LpqY-SugA-SugB-SugC, which is highly specific for uptake of trehalose. Involved in the recycling of extracellular trehalose released from trehalose-containing molecules synthesized by M.tuberculosis. Trehalose uptake is essential for virulence. Probably responsible for the translocation of the substrate across the membrane.
subunit: The complex is composed of two ATP-binding proteins (SugC), two transmembrane proteins (Suga and SugB) and a solute-binding protein (LpqY). - substrates: Trehalose
- Genomic analysis of Mycobacterium brumae sustains its nonpathogenic and immunogenic phenotype
Renau-Mínguez, Frontiers in microbiology 2022 - “...Other virulence factors 72.4 100 Rv1236 sugA 1,378,927 1,379,850 Forward Protein ABC transporter 73.1 93.8 Rv1237 sugB 1,379,855 1,380,679 Forward Protein ABC transporter 81.1 98.9 Rv1238 sugC 1,380,684 1,381,865 Forward Protein ABC transporter 78.7 100 Rv1293 lysA 1,448,028 1,449,371 Forward Other virulence factors 76.1 99.6 Rv1346...”
- Shotgun proteomic profiling of dormant, 'non-culturable' Mycobacterium tuberculosis
Nikitushkin, PloS one 2022 - “...behaviour of proteins of the ABC trehalose transporter complex LpqYSugASugBSugC ( Rv1235 , Rv1236 , Rv1237 , Rv1238 ): out of four annotated in the Mtb genome only Rv1235 and Rv1238 were detected in the current study, albeit with a different sign of FC in dormancy,...”
- Heat-killed Mycolicibacterium aurum Aogashima: An environmental nonpathogenic actinobacteria under development as a safe novel food ingredient
Nouioui, Food science & nutrition 2021 - “...orf03429 Rv1235 28.3 <60% 2E53 sug A orf03428 Rv1236 53.0 <60% 3E91 sug B orf03427 Rv1237 57.1 <60% 3E109 sug C orf03426 Rv1238 53.9 <60% 8E142 Copper uptake Copper exporter ctp V orf03576 Rv0969 54.3 <60% 0 fad D33 orf02653 Rv1345 61.7 <95% 0 Mbt A...”
- ATP-binding cassette (ABC) import systems of Mycobacterium tuberculosis: target for drug and vaccine development
Soni, Emerging microbes & infections 2020 - “...maltose [ 39 ] Trehalose importer (LpqY-SugABC/Rv1235-Rv1238) SBP: LpqY (Rv1235) TMD: SugA (Rv1236) and SugB (Rv1237) NBD: SugC (Rv1238) (two copies) LpqY-SugABC mutant shows reduced virulence in mice [ 43 ] Uptake and recycle disaccharide trehalose [ 43 ] Involved in biofilm formation [ 43 ]...”
- Characterizing the pocketome of Mycobacterium tuberculosis and application in rationalizing polypharmacological target selection
Anand, Scientific reports 2014 - “...HIV-1 strains resistant to multiple protease inhibitors Ritonavir (DB00503;RIT) 0.68 Rv0511; Rv0627; Rv0904c; Rv1092c; Rv1220c; Rv1237; Rv1663; Rv1843c; Rv2026c.; Rv2335; Rv2388c; Rv2678c; Rv2689c; Rv2842c; Rv2935; Rv3303c; Rv3509c; Rv3582c; Rv3825c; Rv3886c; Indicated in combination with other antiretroviral agents for the treatment of HIV-infection. Rosiglitazone (DB00412;BRL) 0.66 Rv0755c;...”
- “...the treatment of Type II diabetes mellitus Amprenavir (DB00701;478) 0.64 Rv0085; Rv0237; Rv0478; Rv0635; Rv1127c; Rv1237; Rv1505c; Rv1542c; Rv1655; Rv1663.2; Rv1843c; Rv1850; Rv2153c; Rv2524c; Rv2524c; Rv2613c; Rv2689c; Rv2931; Rv2938; Rv2939; Rv3135; Rv3245c; Rv3804c; Rv3882c; Rv3883c; Rv3886c; Rv3887c; For the treatment of HIV-1 infection in combination with...”
- A systematic assessment of mature MBP in membrane protein production: overexpression, membrane targeting and purification
Hu, Protein expression and purification 2011 - “...Rv1236 5 33.0 o + Rv1337 6 25.7 o o Rv1457c 6 27.3 o o Rv1237 6 29.1 o o Rv2398c 6 29.3 o o Rv2938 6 29.6 o o Rv2399c 6 29.7 o o Rv2093c 6 33.8 o o Rv0929 6 34.2 o o Rv2881c...”
- Development and analysis of an in vivo-compatible metabolic network of Mycobacterium tuberculosis
Fang, BMC systems biology 2010 - “...phthiocerol dimycocerosate to the biomass objective function [ 62 ] 27 32 33 34 Rv1236 Rv1237 Rv1238 sugA sugB sugC FN Transport Transport of glucose, maltoheptaose, maltose, ribose, trehalose, and xylose into cell (1) Allowed xylose uptake and added xylose to the biomass objective function 28...”
- In vivo inactivation of the mycobacterial integral membrane stearoyl coenzyme A desaturase DesA3 by a C-terminus-specific degradation process
Chang, Journal of bacteriology 2008 - “...in sugar transport Rv1237 .....................................Sugar (maltose) transporter Rv1244 .....................................Unknown lipoprotein...”
- Trehalose-recycling ABC transporter LpqY-SugA-SugB-SugC is essential for virulence of Mycobacterium tuberculosis.
Kalscheuer, Proceedings of the National Academy of Sciences of the United States of America 2010 - GeneRIF: Data show that the LpqY-SugA-SugB-SugC ATP-binding cassette transporter is a recycling system mediating the retrograde transport of released trehalose.
Npun_R2792 binding-protein-dependent transport systems inner membrane component from Nostoc punctiforme
32% identity, 82% coverage
BL0144 permease of ABC transporter possibly for oligosaccharides from Bifidobacterium longum NCC2705
33% identity, 91% coverage
TEL01S_RS00165 carbohydrate ABC transporter permease from Pseudothermotoga elfii DSM 9442 = NBRC 107921
32% identity, 55% coverage
BAA6_1555 carbohydrate ABC transporter permease from Bifidobacterium animalis
32% identity, 91% coverage
LMOf2365_0191 sugar ABC transporter, permease protein from Listeria monocytogenes str. 4b F2365
31% identity, 88% coverage
Balac_1569 MalG-type ABC sugar transport system permease component from Bifidobacterium animalis subsp. lactis Bl-04
32% identity, 91% coverage
- Transcriptional analysis of oligosaccharide utilization by Bifidobacterium lactis Bl-04
Andersen, BMC genomics 2013 - “...kinase xyloside A,C Xylobiose D 18.2 19.0 Balac_1567 4--glucanotransferase glucoside B,D Maltriose E 9.7 14.5 Balac_1569 ABC transporter, permease component glucoside B,D Cellobiose E 5.2 13.7 Balac_1570 ABC transporter, permease component glucoside B,D Cellobiose E 3.7 15.1 Balac_1571 Transcriptional regulator ( lacI type) glucoside B,D Cellobiose...”
- “...all harbored the additional two -helical domain, suggesting the divergence of the maltotriose ABC transporter (Balac_1569, 1570 and 1572) from known maltose ABC transporters. Table 3 Prediction of -helical topology within oligosaccharide transporters identified in B. lactis Bl-04 ORF Predicted substrates Class Predicted TMH 1 Sequence...”
- Genetic and physiological responses of Bifidobacterium animalis subsp. lactis to hydrogen peroxide stress
Oberg, Journal of bacteriology 2013 - “...Balac_1598 Balac_1599 Balac_1601 Balac_1567 Balac_1568 Balac_1569 Balac_1570 Balac_1572 Balac_1573 Bifidobacterium lactis H2O2 Stress Response with no...”
llmg_0490 sugar transport system permease protein from Lactococcus lactis subsp. cremoris MG1363
33% identity, 91% coverage
PA14_23000 putative permease of ABC sugar transporter from Pseudomonas aeruginosa UCBPP-PA14
34% identity, 85% coverage
- Convergent phenotypic evolution towards fosfomycin collateral sensitivity of Pseudomonas aeruginosa antibiotic-resistant mutants
Laborda, Microbial biotechnology 2022 - “...( glcB and PA14_30050 ), as well as of the glucose transporters PA14_22980, PA14_22990 and PA14_23000, yet a decreased expression of lactate dehydrogenase encoding genes ( lldA and lldD ). Moreover, we also found increased expression of some genes that encode amino acid and fatty acid...”
- Transcriptional profiling of Pseudomonas aeruginosa and Staphylococcus aureus during in vitro co-culture
Tognon, BMC genomics 2019 - “...virulence pchF 9.56 pyochelin synthesis virulence PA14_23010 9.47 GltK, ATP-binding component of ABC transporter transport PA14_23000 9.37 permease of ABC sugar transporter transport PA14_22990 9.19 permease of ABC sugar transporter transport PA14_23030 8.63 OprB, Glucose/carbohydrate porin transport bkdA2 8.05 2-oxoisovalerate dehydrogenase subunit beta aa metabolism bdhA...”
- “...operon containing genes for the glucose/carbohydrate specific OprB porin and the adjacent ABC-transporters (PA14_22990 and PA14_23000) (10-fold decrease), the operon containing the OpdO porin and the co-transcribed ABC-transporter PA14_37250 (15 to 20-fold decrease), involved in pyroglutamate/lactam uptake as well as the gluconate permease gene gnuT ....”
MAP1767c hypothetical protein from Mycobacterium avium subsp. paratuberculosis str. k10
28% identity, 82% coverage
PA3188 probable permease of ABC sugar transporter from Pseudomonas aeruginosa PAO1
34% identity, 85% coverage
- Commensal colonization reduces Pseudomonas aeruginosa burden and subsequent airway damage
Stoner, Frontiers in cellular and infection microbiology 2023 - “...the presence of S. salivarius . Genes PA3186 ( oprB ), PA3187 ( gltK ), PA3188 ( gltG ), PA3189 ( gltF ), and PA3190 are involved in glucose uptake. PA3181 ( edaA ), PA3182 ( pgl ), and PA3183 ( zwf ) are involved in...”
- “...PA3186 (glucose outer membrane porin OprB), PA3187 (ATP binding component of ABC sugar transporter GltK), PA3188 (permease of ABC sugar transporter GltG), PA3189 (permease of ABC sugar transporter GltF), PA3190 (binding protein component of ABC sugar transporter), PA3191 (glucose transport sensor GtrS), and PA3192 (two-component response...”
- Catabolite repression control protein antagonist, a novel player in Pseudomonas aeruginosa carbon catabolite repression control
Sonnleitner, Frontiers in microbiology 2023 - “...membrane porin OprB precursor PA3187 9.26 7.80E-18 PA 3187 Probable ATP-binding component of ABC transporter PA3188 14.32 2.74E-8 PA 3188 Probable permease of ABC sugar transporter PA3189 12.67 4.63E-12 PA 3189 Probable permease of ABC sugar transporter PA3190 41.81 2.51E-71 PA 3190 Probable binding protein component...”
- Responses of carbapenemase-producing and non-producing carbapenem-resistant Pseudomonas aeruginosa strains to meropenem revealed by quantitative tandem mass spectrometry proteomics
Salvà-Serra, Frontiers in microbiology 2022 - “...transport protein AroP1 2 4 1.00 0.90 1.34 0.02 2.11 0.00 Up 1.27 0.04 WP_003091470.1 PA3188 GltG Probable permease of ABC sugar transporter 2 7 1.20 0.03 1.23 0.04 3.84 0.01 Down 1.26 0.01 WP_003091471.1 PA3189 GltF Probable permease of ABC sugar transporter 4 11 1.09...”
- Pseudomonas aeruginosa mutants defective in glucose uptake have pleiotropic phenotype and altered virulence in non-mammal infection models
Raneri, Scientific reports 2018 - “...gntP 35.5 0.0 0.6 gluconate permease PA3187 gltK 52.0 0.1 6.7 ABC transporter ATP-binding protein PA3188 gltG 31.6 0.0 0.4 sugar ABC transporter permease PA3189 gltF 3.5 0.3 0.9 probable permease of ABC sugar transporter a Boldface characters, genes analysed by RT-qPCR. b Genes up- and...”
- The development of a new parameter for tracking post-transcriptional regulation allows the detailed map of the Pseudomonas aeruginosa Crc regulon
Corona, Scientific reports 2018 - “...5,5 Transport gltK PA3187 Probable ATP-binding component of ABC transporter 0,22 2,29 6,75 Transport gltG PA3188 Probable permease of ABC sugar transporter 0,46 3,56 10,6 Transport gltB PA3190 Probable binding protein component of ABC sugar transporter 0,2 2,92 8,1 CCM/catabolism glk PA3193 Glucokinase 0,02 1,11 3,15...”
- Gene expression in Pseudomonas aeruginosa swarming motility
Tremblay, BMC genomics 2010 - “...PA4616 1 probable c4-dicarboxylate-binding protein 2.2 PA3187 gltK probable ATP-binding component of ABC transporter 1.5 PA3188 gltG probable permease of ABC sugar transporter 2.0 PA4628 lysP lysine-specific permease 1.7 PA5479 gltP proton-glutamate symporter 1.6 PA0782 3 putA proline dehydrogenase 1.8 PA0783 1 putP sodium/proline symporter PutP...”
- “...molecules PA2322 gntT gluconate permease 2.0 PA3187 2 gltK ATP-binding component of ABC transporter 2.6 PA3188 2 gltG permease of ABC sugar transporter 3.1 PA3189 gltF permease of ABC sugar transporter 2.5 PA3523 1 mexP probable Resistance-Nodulation-Cell Division (RND) efflux membrane fusion protein precursor 4.2 PA3920...”
- Effect of anaerobiosis and nitrate on gene expression in Pseudomonas aeruginosa
Filiatrault, Infection and immunity 2005 - “...PA2629 PA2663 PA2691 PA2763 PA2798 PA2968 PA2969 PA3019 PA3188 PA3221 PA3222 PA3232 PA3234 PA3235 PA3294 PA3327 PA3328 PA3329 PA3330 PA3331 PA3333 PA3334 PA3335...”
- A cystic fibrosis epidemic strain of Pseudomonas aeruginosa displays enhanced virulence and antimicrobial resistance
Salunkhe, Journal of bacteriology 2005 - “...PA1404 PA1431 PA1432 PA2365 PA2445 PA2446 PA3181 PA3182 PA3183 PA3188 PA3190 Gene name GENE EXPRESSION IN A P. AERUGINOSA CF EPIDEMIC STRAIN VOL. 187, 2005 4915...”
- More
CGSSp3BS71_10423 sugar ABC transporter permease from Streptococcus pneumoniae SP3-BS71
29% identity, 90% coverage
BMEII0592 SUGAR TRANSPORT SYSTEM PERMEASE PROTEIN from Brucella melitensis 16M
29% identity, 90% coverage
- Erythritol triggers expression of virulence traits in Brucella melitensis
Petersen, Microbes and infection 2013 - “...1.97 0.61 BMEII0590 Sugar-binding protein 20.38 1.00 BMEII0591 Sugar transport system permease protein 6.93 1.00 BMEII0592 Sugar transport system permease protein 7.56 1.00 BMEII0593 Glucose ABC transporter ATPase 4.11 1.00 Other BMEI0095 Succinoglycan biosynthesis regulator 2.39 0.95 BMEI0102 Universal stress protein family 4.16 1.00 BMEI0347 Phosphoserine...”
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...or polyol import IM BMEII0591 BruAb20538 BRA0691 BOV_A0647 BCAN_B0690 OSP Oligosaccharide or polyol import IM BMEII0592 BruAb20539 BRA0692 BOV_A0646 BCAN_B0689 OSP Oligosaccharide or polyol import ABC BMEII0593 BruAb20540 BRA0690 BOV_A0645 BCAN_B0688 79 OSP SN-glycerol-3-phosphate import ABC BMEII0621, ugpC BruAb20568, ugpC BRA0658, ugpC BOV_A0620 BCAN_B0658 OSP SN-glycerol-3-phosphate...”
SACE_0926 binding-protein-dependent transport systems membrane component from Saccharopolyspora erythraea NRRL 2338
30% identity, 92% coverage
DASC_STRCO / Q9K489 Diacetylchitobiose uptake system permease protein DasC from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) (see paper)
SCO5234 sugar transporter integral membrane protein from Streptomyces coelicolor A3(2)
30% identity, 83% coverage
BOV_A0646 putative sugar ABC transporter, permease protein from Brucella ovis ATCC 25840
BRA0691 sugar ABC transporter, permease protein, putative from Brucella suis 1330
BCAN_B0689 hypothetical protein from Brucella canis ATCC 23365
29% identity, 90% coverage
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...IM BMEII0591 BruAb20538 BRA0691 BOV_A0647 BCAN_B0690 OSP Oligosaccharide or polyol import IM BMEII0592 BruAb20539 BRA0692 BOV_A0646 BCAN_B0689 OSP Oligosaccharide or polyol import ABC BMEII0593 BruAb20540 BRA0690 BOV_A0645 BCAN_B0688 79 OSP SN-glycerol-3-phosphate import ABC BMEII0621, ugpC BruAb20568, ugpC BRA0658, ugpC BOV_A0620 BCAN_B0658 OSP SN-glycerol-3-phosphate import IM BMEII0622,...”
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...import BP BMEII0590 BruAb20537 BRA0693 BOV_A0648 BCAN_B0691 OSP Oligosaccharide or polyol import IM BMEII0591 BruAb20538 BRA0691 BOV_A0647 BCAN_B0690 OSP Oligosaccharide or polyol import IM BMEII0592 BruAb20539 BRA0692 BOV_A0646 BCAN_B0689 OSP Oligosaccharide or polyol import ABC BMEII0593 BruAb20540 BRA0690 BOV_A0645 BCAN_B0688 79 OSP SN-glycerol-3-phosphate import ABC BMEII0621,...”
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...BMEII0591 BruAb20538 BRA0691 BOV_A0647 BCAN_B0690 OSP Oligosaccharide or polyol import IM BMEII0592 BruAb20539 BRA0692 BOV_A0646 BCAN_B0689 OSP Oligosaccharide or polyol import ABC BMEII0593 BruAb20540 BRA0690 BOV_A0645 BCAN_B0688 79 OSP SN-glycerol-3-phosphate import ABC BMEII0621, ugpC BruAb20568, ugpC BRA0658, ugpC BOV_A0620 BCAN_B0658 OSP SN-glycerol-3-phosphate import IM BMEII0622, ugpE...”
RC1_3731 maltose transport system permease protein malG, putative from Rhodospirillum centenum SW
31% identity, 82% coverage
Pden_4440 binding-protein-dependent transport systems inner membrane component from Paracoccus denitrificans PD1222
32% identity, 83% coverage
SACTE_2287 carbohydrate ABC transporter permease from Streptomyces sp. SirexAA-E
30% identity, 87% coverage
- Aerobic deconstruction of cellulosic biomass by an insect-associated Streptomyces
Takasuka, Scientific reports 2013 - “...SACTE_6428 CBM33 Chitin-binding, domain 3 GGGAGCGCTCCCA 9 7.9 SACTE_2347 GH5 CBM2 Beta-mannosidase TGGGAGCGCTCCCA 11 5.0 SACTE_2287 Transport systems inner membrane component TGGGAGCGCTCCCA 15 4.3 SACTE_2289 Family 1 extracellular solute-binding protein TGGGAGCGCTCCCA 19 3.9 SACTE_0352 GCN5-related N-acetyltransferase TGGGAGCGCTCCCA 22 3.6 SACTE_2286 GH1 Glycoside hydrolase 1 GGGAGCGCTCCCA 27...”
APY09_06055 sugar ABC transporter permease from Schaalia odontolytica
30% identity, 92% coverage
ROSINTL182_05477 carbohydrate ABC transporter permease from Roseburia intestinalis L1-82
30% identity, 91% coverage
- The human gut Firmicute Roseburia intestinalis is a primary degrader of dietary β-mannans
La, Nature communications 2019 - “...dissociation constant Internalization of break-down products from -mannan Within the MULL cluster, the three genes (ROSINTL182_05477 ROSINTL182_05479) that encode an ATP-binding cassette (ABC) importer were shown to exhibit the highest level of increased expression during growth on -mannan (and when compared to growth on glucose). The...”
all0261 sugar transport system permease protein from Nostoc sp. PCC 7120
30% identity, 86% coverage
- Global translational control by the transcriptional repressor TrcR in the filamentous cyanobacterium Anabaena sp. PCC 7120
Wang, Communications biology 2023 - “...may constitute an operon, i.e. alr3301 promoter for alr3301 - 3303 , all0263 promoter for all0261 - 0263 , alr0739 promoter for alr0739 - 0740 and alr1537 promoter for alr1537 - 1540 . The EMSA results showed that except for the promoter of all5040 that lacks...”
- “...than 8-fold increase in the transcriptional levels in trcR . Gene ID Fold change Function all0261 4.052915 sugar transport system permease protein all0262 10.63186 threonine dehydratase all0263 23.84687 AAA family ATPase all0767 22.02014 endoribonuclease L-PSP all0768 322.6987 GNAT family N-acetyltransferase all3526 77.33209 RtcB family protein; RNA-splicing...”
- Chemoheterotrophic growth of the Cyanobacterium Anabaena sp. strain PCC 7120 dependent on a functional cytochrome c oxidase
Stebegg, Journal of bacteriology 2012 - “...genomic sequence of PCC 7120, 16 genes (all0261, all1027, all1823, all1916, all4824, all5282, alr0738, alr0789, alr2532, alr2722, alr3705, alr4277, alr4781,...”
BBMN68_219 carbohydrate ABC transporter permease from Bifidobacterium longum subsp. longum BBMN68
30% identity, 82% coverage
CAC0428 Sugar permease from Clostridium acetobutylicum ATCC 824
26% identity, 86% coverage
- Small RNAs in the genus Clostridium
Chen, mBio 2011 - “...37 to 42) based on microarray data (34) include the following: CAC3313 (37), CAP0060 (38), CAC0428 (39), CAC1094 (40), CAC2614 (41), and CAC2179 (42). The negative controls (genes 43 to 47) include the following intergenic region (IR) sequences (Ig stands for intergenic): IgCAC_1350 (43), IgCAC_232 (44),...”
- A proteomic and transcriptional view of acidogenic and solventogenic steady-state cells of Clostridium acetobutylicum in a chemostat culture
Janssen, Applied microbiology and biotechnology 2010 - “...1.8 R CAC0427 Glycerol-3-phosphate ABC transporter, permease component 3.1 3.1 5.7 2.9 3.7 1.3 G CAC0428 Sugar permease 4.2 2.7 11.2 3.5 5.4 3.9 G CAC0429 Glycerol-3-phosphate ABC transporter, periplasmic component 4.6 3.3 9.2 5.7 5.7 2.5 G CAC0430 Glycerophosphoryl diester phosphodiesterase 2.2 3.5 7.1 6.8...”
- “...binding protein involved in sugar transport ( msmX , CAC3237) and the genes cac0427 , cac0428 , and cac0429 of a glycerol-3-phosphate ABC transporter system which are organized in a common operon together with glycerophosphoryl diester phosphodiesterase ( cac0430 ; Karp et al. 2005 ). Additionally,...”
AOT13_11485 carbohydrate ABC transporter permease from Parageobacillus thermoglucosidasius
33% identity, 83% coverage
- Development of a xylose-inducible and glucose-insensitive expression system for Parageobacillus thermoglucosidasius
Wang, Applied microbiology and biotechnology 2024 - “...permease, respectively), were found to be directly upstream of the ara operon ( AOT13_11450 to AOT13_11485 ) (Liang et al. 2022a ), which showed moderate sequence identities to XylF, XylG, and XylH of G. kaustophilus HTA426 (35.8%, 54.6%, and 43.1%, respectively, Fig. S3 and Table S4...”
HMPREF0421_20235 carbohydrate ABC transporter permease from Gardnerella vaginalis ATCC 14019
33% identity, 85% coverage
Ava_2748 Binding-protein-dependent transport systems inner membrane component from Anabaena variabilis ATCC 29413
30% identity, 86% coverage
- Specific Glucoside Transporters Influence Septal Structure and Function in the Filamentous, Heterocyst-Forming Cyanobacterium Anabaena sp. Strain PCC 7120
Nieves-Morión, Journal of bacteriology 2017 - “...mediating esculin uptake. Two genes, Ava_2050 and Ava_2748, that encode possible components of ABC uptake transporters for disaccharides or oligosaccharides,...”
- Cell-specific gene expression in Anabaena variabilis grown phototrophically, mixotrophically, and heterotrophically
Park, BMC genomics 2013 - “...disaccharides and oligosaccharides. Among the twelve CUT1-related genes that were identified (Additional file 7 ), Ava_2748 and Ava_2050 were distinctive. Ava_2748 (membrane protein 2) was upregulated 7- to 31-fold in heterocysts across growth conditions (p0.036), and Ava_2050 (ATP-binding protein) was upregulated 7- and 97-fold in heterocysts...”
- “...the CUT1-related genes are not clustered in the A. variabilis genome. However, the orthologs of Ava_2748 in N. punctiforme (Npun_R2792) and Anabaena 90 (Ana_C20533) are adjacent to genes Npun_R2793 and Ana_C20534, both of which are orthologs of Ava_0461, annotated as membrane protein 1 in a CUT1...”
RL3860 putative transmembrane component of ABC transporter from Rhizobium leguminosarum bv. viciae 3841
29% identity, 95% coverage
YPO1721 putative sugar ABC transporter (permease) from Yersinia pestis CO92
YPTB2360 putative sugar ABC transporter (permease) from Yersinia pseudotuberculosis IP 32953
28% identity, 93% coverage
- Growth of Yersinia pseudotuberculosis in human plasma: impacts on virulence and metabolic gene expression
Rosso, BMC microbiology 2008 - “...YPTB2318 (ppsA) YPO2409 phosphoenolpyruvate synthase 0.463 (0.008) YPTB2356 (kduI) YPO1725 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase 1.444 (0.047) YPTB2360 YPO1721 putative sugar ABC transporter (permease) 1.901 (0.032) YPTB2463 (ptsG) YPO1608 PTS system. glucose-specific IIBC component 4.033 (< 0.001) 1.607 (0.002) YPTB2515 YPO2474 conserved hypothetical protein 0.593 (0.036) YPTB2518 YPO2477 putative...”
- Growth of Yersinia pseudotuberculosis in human plasma: impacts on virulence and metabolic gene expression
Rosso, BMC microbiology 2008 - “...0.001) YPTB2318 (ppsA) YPO2409 phosphoenolpyruvate synthase 0.463 (0.008) YPTB2356 (kduI) YPO1725 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase 1.444 (0.047) YPTB2360 YPO1721 putative sugar ABC transporter (permease) 1.901 (0.032) YPTB2463 (ptsG) YPO1608 PTS system. glucose-specific IIBC component 4.033 (< 0.001) 1.607 (0.002) YPTB2515 YPO2474 conserved hypothetical protein 0.593 (0.036) YPTB2518 YPO2477...”
MELC_BACSU / O34518 Melibiose/raffinose/stachyose import permease protein MelC from Bacillus subtilis (strain 168) (see paper)
BSU30290 maltose and multiple sugars ABC transporter (permease) from Bacillus subtilis subsp. subtilis str. 168
32% identity, 82% coverage
- function: Part of the ABC transporter complex MelEDC-MsmX involved in melibiose, raffinose and stachyose import. Probably responsible for the translocation of the substrate across the membrane.
subunit: The complex is composed of two ATP-binding proteins (MsmX), two transmembrane proteins (MelC and MelD) and a solute-binding protein (MelE).
disruption phenotype: Deletion of the gene abolishes induction in the presence of melibiose and raffinose. - rocF affects the production of tetramethylpyrazine in fermented soybeans with Bacillus subtilis BJ3-2
Liu, BMC biotechnology 2022 - “...Up BSU19050 7.277 27.08 1.88 1.08E-03 3.68E-02 Up BSU30280 10.263 35.571 1.78 4.72E-04 1.96E-02 Up BSU30290 8.444 28.629 1.75 9.44E-04 3.34E-02 Up BSU38080 223.922 747.383 1.74 1.76E-04 9.59E-03 Up BSU31060 17.602 58.817 1.73 2.31E-04 1.16E-02 Up BSU25150 9.698 32.51 1.73 1.03E-03 3.53E-02 Up BSU16740 18.631 61.488...”
SGO_1303 transmembrane permease MsmG from Streptococcus gordonii str. Challis substr. CH1
29% identity, 80% coverage
LBA1440 ABC transporter permease from Lactobacillus acidophilus NCFM
29% identity, 90% coverage
DJ458_RS02925 carbohydrate ABC transporter permease from Staphylococcus pseudintermedius
28% identity, 86% coverage
MSMEG_0517 sugar binding-protein dependent transporter system permease from Mycobacterium smegmatis str. MC2 155
33% identity, 91% coverage
TC 3.A.1.1.28 / Q00751 MsmG aka SMU.880, component of The raffinose/stachyose transporter, MsmEFGK (MalK (3.A.1.1.27) can probably substitute for MsmK; Webb et al., 2008). This system may also transport melibiose, isomaltotriose and sucrose as well as isomaltosaccharides from Streptococcus mutans (see 2 papers)
SMU_RS04090 carbohydrate ABC transporter permease from Streptococcus mutans UA159
30% identity, 90% coverage
- substrates: Raffinose, Stachyose
- Identification of the antibacterial action mechanism of diterpenoids through transcriptome profiling
Moon, Frontiers in microbiology 2022 - “...1.23 1.25 SMU_RS04075 Alpha-galactosidase aga 1.21 SMU_RS04085 Sugar ABC transporter permease msmF 1.76 0.33 0.45 SMU_RS04090 Carbohydrate ABC transporter permease msmG 1.20 0.26 0.14 SMU_RS04100 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC msmK 1.95 0.66 0.59 SMU_RS07115 Sugar ABC transporter permease malF 1.99 0.69 0.62 SMU_RS07120 Sugar...”
all5282 ABC transporter sugar permease from Nostoc sp. PCC 7120
29% identity, 74% coverage
- Chemoheterotrophic growth of the Cyanobacterium Anabaena sp. strain PCC 7120 dependent on a functional cytochrome c oxidase
Stebegg, Journal of bacteriology 2012 - “...16 genes (all0261, all1027, all1823, all1916, all4824, all5282, alr0738, alr0789, alr2532, alr2722, alr3705, alr4277, alr4781, alr5362, alr5367, and alr5368)...”
ML1088 probable ABC-transport protein, inner membrane component from Mycobacterium leprae TN
30% identity, 83% coverage
blr1891 ABC transporter permease protein from Bradyrhizobium japonicum USDA 110
31% identity, 90% coverage
BF29_RS09835 sugar ABC transporter permease from Heyndrickxia coagulans DSM 1 = ATCC 7050
28% identity, 87% coverage
SSUBM407_1447 multiple sugar-binding transport system permease protein from Streptococcus suis BM407
30% identity, 91% coverage
- Rapid evolution of virulence and drug resistance in the emerging zoonotic pathogen Streptococcus suis
Holden, PloS one 2009 - “...kinase 742777..744036 37 Region 6 SSUBM407_1445 glucan 1,6-alpha-glucosidase 1533333..1531717 16 SSUBM407_1446 sucrose phosphorylase 1534855..1533407 32 SSUBM407_1447 multiple sugar-binding transport system permease protein 1535755..1534925 33 SSUBM407_1448 multiple sugar-binding transport system permease protein 1536641..1535766 23 SSUBM407_1449 multiple sugar-binding protein precursor 1538008..1536773 16 Region 7 SSUBM407_1489 conserved hypothetical protein...”
- “...shown to have a role in virulence [103] ; and a binding protein-dependent transport system (SSUBM407_1447 to SSUBM407_1449) orthologous to a system from S. mutans responsible for the uptake of melibiose, raffinose, and isomaltotriose and the metabolism of melibiose, sucrose, and isomaltosaccharides [104] . One of...”
SMc04257 ABC transporter for D-Cellobiose and D-Salicin, permease component 1 from Sinorhizobium meliloti 1021
30% identity, 94% coverage
- mutant phenotype: Specific phenotypes on D-Cellobiose; D-Salicin.
PFREUD_23410 carbohydrate ABC transporter permease from Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
31% identity, 80% coverage
- A unique in vivo experimental approach reveals metabolic adaptation of the probiotic Propionibacterium freudenreichii to the colon environment
Saraoui, BMC genomics 2013 - “...(induced in colon) pvalue microarray FC RT-qPCR (induced in colon) pvalue RT- qPCR Probe name PFREUD_23410 Permease of glycerol 3 P ABC transporter 1.2 Transport/binding proteins and lipoproteins 4,8 5,0E-08 34,0 1,4E-01 CUST_2220_PI426428742 PFREUD_23760 Xanthine/uracil permease 1.2 Transport/binding proteins and lipoproteins 4,5 6,0E-08 3,7 9,0E-02 CUST_2250_PI426428742...”
- “...substrate for P. freudenreichii in the gut environment. Similarly, the glycerol and glycerol 3P transporter PFREUD_23410 was induced +4.7 (confirmed with a fold change of +34 by RT-qPCR), whereas the degradation pathway of glycerol was not induced. Glycerol is another substrate available in the gut as...”
C289_1910 carbohydrate ABC transporter permease from Anoxybacillus ayderensis
29% identity, 81% coverage
- A high molecular-mass Anoxybacillus sp. SK3-4 amylopullulanase: characterization and its relationship in carbohydrate utilization
Kahar, International journal of molecular sciences 2013 - “...transporters (C289_0465, C289_0466, C289_0467, C289_0603, C289_0763, C289_0764, C289_0765, C289_0778, C289_0779, C289_0780, C289_1015, C289_1174, C289_1392, C289_1394, C289_1910, C289_1911, and C289_1912) were also found in the Blast2GO annotation. The draft genome was submitted to the National Center for Biotechnology Information (NCBI) Bioproject with accession no. PRJNA174378. 2.2. Analysis...”
BAD_RS08205 carbohydrate ABC transporter permease from Bifidobacterium adolescentis ATCC 15703
33% identity, 91% coverage
- Combining of transcriptome and metabolome analyses for understanding the utilization and metabolic pathways of Xylo-oligosaccharide in Bifidobacterium adolescentis ATCC 15703
Yang, Food science & nutrition 2019 - “...for oligosaccharides 3,704.78 933.34 BAD_RS00805 1.95 yurO Solutebinding protein of ABC transporter system 2,384.03 618.73 BAD_RS08205 1.88 amyC Sugar ABC transporter permease 2,223.03 603.5 BAD_RS00495 1.76 MT1311 Multidrug ABC transporter ATPbinding protein 276.15 81.69 BAD_RS07050 1.58 lipO ABC transporter 10,020.43 3,361.71 BAD_RS08285 1.52 ugpB ABC transporter,...”
- “...to xylose treatment, genes including the sugar transporter permease protein (encoded by BAD_RS00815, BAD_RS08280, BAD_RS00810, BAD_RS08205, BAD_RS03705, BAD_RS02260, BAD_RS07410) and transporter ATPbinding protein (encoded by BAD_RS02265, BAD_RS00495, BAD_RS04090, BAD_RS08375) were upregulated (Table 3 ), the same situation occurs in metabolites, including Lthreonine (meta_58), cellobiose (meta_991), Dmannose...”
MSMEG_5059 ABC transporter, permease protein SugB from Mycobacterium smegmatis str. MC2 155
29% identity, 83% coverage
- Structural basis of trehalose recycling by the ABC transporter LpqY-SugABC
Liu, Science advances 2020 - “...2 155 genomic DNA and overexpressed in M. smegmatis mc 2 155 . MSMEG_5058 , MSMEG_5059 , and MSMEG_5060 were amplified by polymerase chain reaction (PCR) and inserted into a pM261 vector, with a C-terminal 6 His-tag attached to SugC. The recombinant plasmid was transformed into...”
- “...(SugC)] was mutated to glutamine. A coexpression vector was constructed by amplification of MSMEG_5058 (E164Q), MSMEG_5059 , MSMEG_5060 , and MSMEG_5061 from M. smegmatis strain mc 2 155 genomic DNA by PCR and insertion into a pM261 expression vector with a C-terminal 6 His-tag. LpqY-SugABC was...”
- The growth and survival of Mycobacterium smegmatis is enhanced by co-metabolism of atmospheric H2
Greening, PloS one 2014 - “...RNA samples. Genes were chosen that were downregulated (MSMEG_1203, MSMEG_3706), upregulated (MSMEG_3194, MSMEG_3249, MSMEG_3962, MSMEG_3769, MSMEG_5059), or unchanged (MSMEG_4640) in the microarray. All bars show the expression ratio of genes in hyd 2 vs. wild-type strains. Yellow bars show microarray data. Green bars show qRT-PCR data....”
- A VapBC toxin-antitoxin module is a posttranscriptional regulator of metabolic flux in mycobacteria
McKenzie, Journal of bacteriology 2012 - “...MSMEG_4663 MSMEG_4664 MSMEG_4665 MSMEG_4666 MSMEG_5057 MSMEG_5058 MSMEG_5059 MSMEG_5060 MSMEG_5061 MSMEG_5062 iolB iolD iolE sugK sugG sugF sugE Succinate...”
Balac_0485 sugar ABC transporter permease from Bifidobacterium animalis subsp. lactis Bl-04
30% identity, 84% coverage
- Structural Identity of Galactooligosaccharide Molecules Selectively Utilized by Single Cultures of Probiotic Bacterial Strains
Böger, Journal of agricultural and food chemistry 2019 - “...genomes was checked by cross BLAST searches using the GosDEC gene from B. lactis 04 (Balac_0485, Acc. nr. WP_004268783.1; Balac_0486, Acc. nr. WP_004269047.1) and GalCDE gene from B. breve UCC2003 (Bbr_0417_galc, Acc. nr. WP_015438440.1; Bbr_0418_galD, Acc. nr. WP_025262769.1; Bbr_0419_galE, Acc. nr. WP_003828491.1) as a reference. Total...”
- Transcriptional analysis of oligosaccharide utilization by Bifidobacterium lactis Bl-04
Andersen, BMC genomics 2013 - “...Galactoside A GOS B 36.9 17.9 Balac_0484 -galactosidase, GH42 Galactoside A GOS C 11.4 17.2 Balac_0485 ABC transporter, permease component Galactoside A GOS C 8.4 16.2 Balac_0486 ABC transporter, permease component Galactoside A GOS C 5.7 12.9 Balac_0511 Xylose isomerase xyloside A,C XOS D 13.8 15.1...”
BRA0750 sugar ABC transporter, permease protein, putative from Brucella suis 1330
29% identity, 80% coverage
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...polyol import IM BMEII0541 BruAb20483 BRA0749 BOV_A0700 BCAN_B0757 OSP Oligosaccharide or polyol import IM BruAb20482 BRA0750 BOV_A0699 BCAN_B0756 OSP Oligosaccharide or polyol import BP BMEII0542 BruAb20484 BRA0748 BOV_A0698 BCAN_B0755 OSP Oligosaccharide or polyol import ABC BMEII0544 BruAb20487 BRA0745 BOV_A0696 BCAN_B0753 78 OSP Oligosaccharide or polyol import...”
- The Brucella suis genome reveals fundamental similarities between animal and plant pathogens and symbionts
Paulsen, Proceedings of the National Academy of Sciences of the United States of America 2002 - “...BR0404 BR0391 BR0355 BR0389, BR0390 BR0221 BRA0631-BRA0635 BRA0749, BRA0750 BRA0907 BRA1080 BRA1096 Unique B. melitensis regions 107 764 276 238 845 105 194 339...”
HAH_5144 carbohydrate ABC transporter permease from Haloarcula hispanica ATCC 33960
29% identity, 94% coverage
X276_22865 carbohydrate ABC transporter permease from Clostridium beijerinckii NRRL B-598
30% identity, 90% coverage
- Phenotypic and Genomic Analysis of Clostridium beijerinckii NRRL B-598 Mutants With Increased Butanol Tolerance
Vasylkivska, Frontiers in bioengineering and biotechnology 2020 - “...four strains. EB mutants strain A, B and C included SNPs in the same genes, X276_22865 and X276_03000 encoding a carbohydrate ABC transporter permease and an AAA family ATPase, respectively ( Figure 4 and Table 3 ), and no mutations were observed in these gene when...”
- “...Locus Product Start End Strand Feature Aa_ref Aa_alt Mutant strain A* 1 863781 T G X276_22865 Carbohydrate ABC transporter permease 863698 864525 + I M 2 1661343 C T X276_19395 Peptidase S8 and S53 subtilisin kexin sedolisin 1661151 1662989 + L F 3 2775912 T C...”
BMEII0541 SUGAR TRANSPORT SYSTEM PERMEASE PROTEIN from Brucella melitensis 16M
29% identity, 80% coverage
- Differential expression of iron acquisition genes by Brucella melitensis and Brucella canis during macrophage infection
Eskra, PloS one 2012 - “...regulatory protein, LYSR family - NC 2.25 BMEII0539 BCAN_B0760 hypothetical cytosolic protein - NC 2.37 BMEII0541 BCAN_B0757 sugar transport system permease protein - NC 2.57 BMEII0542 BCAN_B0755 sugar-binding protein - NC 5.25 BMEII0544 BCAN_B0753 SN-glycerol-3-phosphate transport ATP-binding protein ugpC NC 4.46 BMEII0548 BCAN_B0748 glycine betaine/L-proline transport...”
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...or polyol import BP BMEII0115 BruAb21116 BRA1180 BCAN_B1211 77 OSP Oligosaccharide or polyol import IM BMEII0541 BruAb20483 BRA0749 BOV_A0700 BCAN_B0757 OSP Oligosaccharide or polyol import IM BruAb20482 BRA0750 BOV_A0699 BCAN_B0756 OSP Oligosaccharide or polyol import BP BMEII0542 BruAb20484 BRA0748 BOV_A0698 BCAN_B0755 OSP Oligosaccharide or polyol import...”
AT5A_24045 carbohydrate ABC transporter permease from Agrobacterium tumefaciens 5A
28% identity, 90% coverage
- Introducing the ArsR-Regulated Arsenic Stimulon
Rawle, Frontiers in microbiology 2021 - “...transporter substrate-binding protein 2.3 2.6 2.2 AT5A_24035 Sugar ABC transporter nucleotide ATPase 2.0 2.6 2.2 AT5A_24045 Sugar ABC transporter permease 2.0 2.9 2.1 AT5A_24050 Sugar ABC transporter permease 2.40 Gray highlighted data identifies genes uniquely affected in the respective arsR mutant and presumed to be controlled...”
BC4011 Cyclodextrin transport system permease protein from Bacillus cereus ATCC 14579
28% identity, 90% coverage
- Commensal segmented filamentous bacteria-derived retinoic acid primes host defense to intestinal infection
Woo, Cell host & microbe 2021 - “...elegans : Strain BC4011: srl-1(s2500) II; dpy-18(e364) III; unc-46(e177)rol-3(s1040) V. Caenorhabditis Genetics Center WB Strain: BC4011; WormBase: WBVar00241916 D. melanogaster : RNAi of Sxl. y[1] sc[*] v[1]; P{TRiP.HMS00609}attP2 Bloomington Drosophila Stock Center BDSC:34393; FlyBase: FBtp0064874 S. cerevisiae : Strain background: W303 ATCC ATTC: 208353 Mouse: R6/2:...”
- Cas4 Nucleases Define the PAM, Length, and Orientation of DNA Fragments Integrated at CRISPR Loci
Shiimori, Molecular cell 2018 - “...elegans : Strain BC4011: srl-1(s2500) II; dpy-18(e364) III; unc-46(e177)rol-3(s1040) V. Caenorhabditis Genetics Center WB Strain: BC4011; WormBase: WBVar00241916 D. melanogaster : RNAi of Sxl: y[1] sc[*] v[1]; P{TRiP.HMS00609}attP2 Bloomington Drosophila Stock Center BDSC:34393; FlyBase: FBtp0064874 S. cerevisiae : Strain background: W303 ATCC ATTC: 208353 Mouse: R6/2:...”
- Dynamic Human Environmental Exposome Revealed by Longitudinal Personal Monitoring
Jiang, Cell 2018 - “...Organisms/Strains C. elegans : Strain BC4011: srl-1(s2500) II;dpy-18(e364) III;unc-46(e177)rol-3(s1040) V. Caenorhabditis Genetics Center WB Strain: BC4011; WormBase: WBVar00241916 D. melanogaster : RNAi of Sxl: y[1] sc[*] v[1]; P{TRiP.HMS00609}attP2 Bloomington Drosophila Stock Center BDSC:34393; FlyBase: FBtp0064874 S. cerevisiae : Strain background: W303 ATCC ATTC: 208353 Mouse: R6/2:...”
BOV_A0700 putative sugar ABC transporter, permease protein from Brucella ovis ATCC 25840
30% identity, 76% coverage
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...BP BMEII0115 BruAb21116 BRA1180 BCAN_B1211 77 OSP Oligosaccharide or polyol import IM BMEII0541 BruAb20483 BRA0749 BOV_A0700 BCAN_B0757 OSP Oligosaccharide or polyol import IM BruAb20482 BRA0750 BOV_A0699 BCAN_B0756 OSP Oligosaccharide or polyol import BP BMEII0542 BruAb20484 BRA0748 BOV_A0698 BCAN_B0755 OSP Oligosaccharide or polyol import ABC BMEII0544 BruAb20487...”
TC 3.A.1.1.39 / Q9WYR1 Alpha-1,4-digalacturonate porter (Nanavati et al., 2006). Regulated by pectin utilization regulon UxaR from Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)
TM0430 sugar ABC transporter, permease protein from Thermotoga maritima MSB8
29% identity, 84% coverage
Cagg_3718 binding-protein-dependent transport systems inner membrane component from Chloroflexus aggregans DSM 9485
30% identity, 93% coverage
BCAN_B0757 hypothetical protein from Brucella canis ATCC 23365
29% identity, 80% coverage
- Differential expression of iron acquisition genes by Brucella melitensis and Brucella canis during macrophage infection
Eskra, PloS one 2012 - “...protein, LYSR family - NC 2.25 BMEII0539 BCAN_B0760 hypothetical cytosolic protein - NC 2.37 BMEII0541 BCAN_B0757 sugar transport system permease protein - NC 2.57 BMEII0542 BCAN_B0755 sugar-binding protein - NC 5.25 BMEII0544 BCAN_B0753 SN-glycerol-3-phosphate transport ATP-binding protein ugpC NC 4.46 BMEII0548 BCAN_B0748 glycine betaine/L-proline transport ATP-binding...”
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...BMEII0115 BruAb21116 BRA1180 BCAN_B1211 77 OSP Oligosaccharide or polyol import IM BMEII0541 BruAb20483 BRA0749 BOV_A0700 BCAN_B0757 OSP Oligosaccharide or polyol import IM BruAb20482 BRA0750 BOV_A0699 BCAN_B0756 OSP Oligosaccharide or polyol import BP BMEII0542 BruAb20484 BRA0748 BOV_A0698 BCAN_B0755 OSP Oligosaccharide or polyol import ABC BMEII0544 BruAb20487 BRA0745...”
ABC1215 sugar ABC transporter permease from Bacillus clausii KSM-K16
29% identity, 87% coverage
BF29_RS14610 carbohydrate ABC transporter permease from Heyndrickxia coagulans DSM 1 = ATCC 7050
27% identity, 88% coverage
TC 3.A.1.1.45 / Q8NMV5 ABC-type transporter, permease components, component of Maltose transporter, MusEFGKI from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)
NCgl2373 carbohydrate ABC transporter permease from Corynebacterium glutamicum ATCC 13032
cg2703 sugar permease from Corynebacterium glutamicum ATCC 13032
27% identity, 95% coverage
- substrates: Maltose
tcdb comment: All five genes have been reported to be essential for uptake activity (Henrich et al. 2013). The MusI gene product is of 215 aas with 5 TMSs and comprises the founding member of a distinct family of poorly characterized protein in TC family 9.B.28 - The DeoR-type transcriptional regulator SugR acts as a repressor for genes encoding the phosphoenolpyruvate:sugar phosphotransferase system (PTS) in Corynebacterium glutamicum
Gaigalat, BMC molecular biology 2007 - “...- 1.14 11.73 Pyridoxine biosynthesis enzyme cg2033 NCgl1738 - 1.12 10.89 Putative secreted protein cg2703 NCgl2373 - 1.07 11.98 ABC-type putative sugar transporter, permease subunit cg1290 NCgl1094 metE 1.00 14.45 5-Methyltetrahydropteroyltriglutamate-homocysteine methyltransferase cg3096 NCgl2698 - -1.00 13.42 Aldehyde dehydrogenase cg2911 NCgl2539 - -1.00 14.12 ABC-type putative...”
- Maltose uptake by the novel ABC transport system MusEFGK2I causes increased expression of ptsG in Corynebacterium glutamicum
Henrich, Journal of bacteriology 2013 - “...binding protein), musF (cg2704; permease), and musG (cg2703; permease) by combination of data obtained from characterization of maltose uptake and reanalyses...”
- “...of C. glutamicum WT In-frame deletion of genes cg2708 to cg2703 of C. glutamicum WT C. glutamicum WT with insertion of pDrive in cg2708 C. glutamicum WT with...”
- Functional genomics of pH homeostasis in Corynebacterium glutamicum revealed novel links between pH response, oxidative stress, iron homeostasis and methionine synthesis
Follmann, BMC genomics 2009 - “...Trigger factor 0 -1.47 -0.27 4.8 5.4 5.0 - - - - - - 81 cg2703 ABC-type transporter, permease component 6 -1.90 -0.32 - - - - - - - - - 82 cg2705 ABC-type transporter, periplasmic component 0 -1.68 -0.28 4.9 7.0 5.8 6.9 7.7...”
- The DeoR-type transcriptional regulator SugR acts as a repressor for genes encoding the phosphoenolpyruvate:sugar phosphotransferase system (PTS) in Corynebacterium glutamicum
Gaigalat, BMC molecular biology 2007 - “...NCgl0754 - 1.14 11.73 Pyridoxine biosynthesis enzyme cg2033 NCgl1738 - 1.12 10.89 Putative secreted protein cg2703 NCgl2373 - 1.07 11.98 ABC-type putative sugar transporter, permease subunit cg1290 NCgl1094 metE 1.00 14.45 5-Methyltetrahydropteroyltriglutamate-homocysteine methyltransferase cg3096 NCgl2698 - -1.00 13.42 Aldehyde dehydrogenase cg2911 NCgl2539 - -1.00 14.12 ABC-type...”
SCO2660 sugar transport membrane protein from Streptomyces coelicolor A3(2)
29% identity, 100% coverage
TC 3.A.1.1.27 / Q8DT26 MalG, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) from Streptococcus mutans (see paper)
SMU_1570, SMU_RS07120 sugar ABC transporter permease from Streptococcus mutans UA159
27% identity, 91% coverage
- substrates: Maltose, Maltotetraose, Maltotriose, Trehalose
- Identification of the antibacterial action mechanism of diterpenoids through transcriptome profiling
Moon, Frontiers in microbiology 2022 - “...protein UgpC msmK 1.95 0.66 0.59 SMU_RS07115 Sugar ABC transporter permease malF 1.99 0.69 0.62 SMU_RS07120 Sugar ABC transporter permease malG 1.36 0.11 0.03 SMU_RS02605 ROK family glucokinase glk 0.61 3.08 1.60 1.62 SMU_RS01525 Glucose-6-phosphate isomerase pgi 1.43 1.09 1.23 SMU_RS05480 6-Phosphofructokinase pfkA 0.78 1.77 1.82...”
- Genomic and phenotypic characterization of Streptococcus mutans isolates suggests key gene clusters in regulating its interaction with Streptococcus gordonii
Liu, Frontiers in microbiology 2022 - “...SMU_184 ABC transporter metal binding lipoprotein 412 658 <0.001 SMU_48 phosphoribosylamineglycine ligase 477 973 <0.001 SMU_1570 maltose ABC transporter permease 456 966 <0.001 SMU_1232c hypothetical protein 479 1,483 <0.001 SMU_270 PTS system ascorbate-specific transporter subunit IIC 417 680 <0.001 SMU_148 bifunctional acetaldehyde-CoA/alcohol dehydrogenase 3,287 8,200 <0.001...”
- Cnm of Streptococcus mutans is important for cell surface structure and membrane permeability
Naka, Frontiers in cellular and infection microbiology 2022 - “...4.614 SMU_1094 ABC transporter ATP-binding protein 1028415 SMU_1094 3.998 malG Maltose ABC transporter permease 1028808 SMU_1570 3.837 mtlA1 PTS system mannitol-specific transporter subunit IIBC 1028492 SMU_1185 3.792 SMU_241c Amino acid ABC transporter ATP-binding protein 1027838 SMU_241c 3.676 SMU_1899 ABC transporter ATP-binding protein/permease (fragment) 1029097 SMU_1899 3.498...”
- RNA-Seq Reveals Enhanced Sugar Metabolism in Streptococcus mutans Co-cultured with Candida albicans within Mixed-Species Biofilms
He, Frontiers in microbiology 2017 - “...S. mutans , albeit not nearly as effectively as the sucrose PTS. Still, both malG (SMU_1570) and malF (SMU_1569) encoding maltose/maltodextrin ABC transport permease, as well as malX (SMU_1568) encoding maltose/maltodextrin-binding protein were up-regulated in the presence of C. albicans (Supplementary Table S1 ). FIGURE 4...”
YPK_0591 binding-protein-dependent transport systems inner membrane component from Yersinia pseudotuberculosis YPIII
30% identity, 82% coverage
- Genome-Scale Mapping Reveals Complex Regulatory Activities of RpoN in Yersinia pseudotuberculosis
Mahmud, mSystems 2020 - “...54,70,24 YPK_0560 YPK_0559 4, 21 IrGS5 653552 6.5 5.3 3.3 ATGGCGCAGTTTATGCGT + 9.99 54,32 YPK_0589 YPK_0591, YPK_0592 42 IrGS6 818023 4.2 NA NA GCGGCATGGTTGTTGCAA 9.99 38,54,70,28,32 YPK_0744 NA 16, 35, 36, 39 IrGS7 821601 4.7 2.9 3.3 GCGGCATGGTTGTTGCAA 9.99 54,28,32 YPK_0746 YPK_0745 175, 132 IrGS8 940388...”
TM0279 sugar ABC transporter, permease protein from Thermotoga maritima MSB8
30% identity, 87% coverage
TM0598 sugar ABC transporter, permease protein from Thermotoga maritima MSB8
32% identity, 73% coverage
BKKJ1_0069 carbohydrate ABC transporter permease from Bifidobacterium catenulatum subsp. kashiwanohense
31% identity, 83% coverage
- Metabolism of the predominant human milk oligosaccharide fucosyllactose by an infant gut commensal
James, Scientific reports 2019 - “...vs Lactose BKKJ1_0067 BKKJ1_0067 ABC transporter substrate-binding protein 8.12 BKKJ1_0068 BKKJ1_0068 ABC transporter permease 5.91 BKKJ1_0069 BKKJ1_0069 ABC transporter permease 5.71 BKKJ1_0206 BKKJ1_0206 6-phosphogluconate dehydrogenase 13.31 BKKJ1_0207 BKKJ1_0207 hypothetical protein 17.67 BKKJ1_0208 BKKJ1_0208 putative gluconokinase 17.21 BKKJ1_0336 BKKJ1_0336 hypothetical protein 16.99 BKKJ1_0338 BKKJ1_0338 hypothetical protein 27.69...”
EF2232 ABC transporter, permease protein from Enterococcus faecalis V583
28% identity, 82% coverage
HVO_B0230 ABC-type transport system permease protein (probable substrate sugar) from Haloferax volcanii DS2
29% identity, 89% coverage
SM_b20327 ABC transporter for D-trehalose/D-maltose/sucrose, permease component 2 (ThuG) from Sinorhizobium meliloti 1021
TC 3.A.1.1.17 / Q9R9Q5 ThuG aka RB0313 aka SMB20327, component of Trehalose/maltose/sucrose porter (trehalose inducible) from Rhizobium meliloti (Sinorhizobium meliloti) (see 3 papers)
30% identity, 83% coverage
- mutant phenotype: Specific phenotype on trehalose, but also reported to transport maltose and sucrose (PMID:12003938; also PMC1635973)
- substrates: Maltose, Sucrose, Trehalose
BL0260 sugar transport system permease protein from Bifidobacterium longum NCC2705
30% identity, 90% coverage
FXV78_RS11800 carbohydrate ABC transporter permease from Mediterraneibacter gnavus ATCC 29149
29% identity, 85% coverage
MID13_22490 carbohydrate ABC transporter permease from Vibrio gigantis
25% identity, 94% coverage
- Contact-mediated algicidal mechanism of <i>Vibrio coralliirubri</i> ACE001 against the harmful alga Karenia mikimotoi
Yu, iScience 2024 - “...thecell part. Among the 483 upregulated genes, the gene with the most significant change was MID13_22490 (log 2 FC= 11.76), predicted to be a permease component of the bacterial ABC transporter system. The permease component refers to substances such as peptides, proteins, and other macromolecules that...”
- “...bind to ABC transporter proteins and are then transported into or out of the cell. MID13_22490 showed a significant upregulation during the algicidal process, suggesting it may play an important role in the bacterium-algae interaction. MID13_03740, annotated as a protein containing the DUF3149 domain, showed a...”
Atu0593 ABC transporter, membrane spanning protein from Agrobacterium tumefaciens str. C58 (Cereon)
31% identity, 59% coverage
OEOE_0812 ABC-type maltose transport system, permease component from Oenococcus oeni PSU-1
31% identity, 68% coverage
- Identification of pOENI-1 and related plasmids in Oenococcus oeni strains performing the malolactic fermentation in wine
Favier, PloS one 2012 - “...assays to detect the plasmid genes repA , oye and tauE , the chromosomal gene OEOE_0812 (locus tag of the O. oeni PSU-1 genome, NC_008528), and to confirm the integrity of plasmids using a combination of three overlapping PCRs that extend over the whole plasmid sequences....”
- “...AACAGGATCATAGTACATCAC ORF20 821 Detection of chromosomal genes OO1/OO2 GTGCCGCTTTTTTGGATATTA AGCAATTTTATCTTTATAGCT mleA 431 0812a/0812b GATTATTACCAATTCGGCTG ACGCCGGAAATAATGTAG OEOE_0812 540 rpoB1/rpoB2 a ATGGAACGTGTTGTCCGCGA GGATTGGTTTGATCCATGAA rpoB 148 a Primers used in qPCR assays. b Product sizes obtained for pOENI-1 and pOENI-1v2. Determination of plasmid/ oye gene copy number per cell...”
pRL90234 putative permease component of ABC transporter from Rhizobium leguminosarum bv. viciae 3841
29% identity, 86% coverage
- Arabinose and protocatechuate catabolism genes are important for growth of Rhizobium leguminosarum biovar viciae in the pea rhizosphere
Garcia-Fraile, Plant and soil 2015 - “...study X376 (H2K2B08-1C04) 3841 carrying mTn5 in RL0634 This study X377(H2K2C06-1B06) 3841 carrying mTn5 in pRL90234 This study X378H5K5F04-1A10) 3841 carrying mTn5 in RL1109 This study X379 (H2K2B02-1B05) 3841 carrying mTn5 in RL0811A This study X380 (H2K2C07-1C07) 3841 carrying mTn5 in RL4123 This study X382 (H3K3G11-1E05)...”
- “...This study A1398 300 carrying mTn5 in RL0634 This study A1399 300 carrying mTn5 in pRL90234 This study A1401 300 carrying mTn5 in RL0811A This study A1402 300 carrying mTn5 in RL4123 This study A1404 300 carrying mTn5 in RL3613 This study A1405 300 carrying mTn5...”
Rv2317 PROBABLE SUGAR-TRANSPORT INTEGRAL MEMBRANE PROTEIN ABC TRANSPORTER USPB from Mycobacterium tuberculosis H37Rv
27% identity, 88% coverage
- ATP-binding cassette (ABC) import systems of Mycobacterium tuberculosis: target for drug and vaccine development
Soni, Emerging microbes & infections 2020 - “...formation [ 43 ] Amino-sugar importer (UspABC/Rv2316-Rv2318) SBP: UspC (Rv2318) TMD: UspA (Rv2316) and UspB (Rv2317) NBD: Remains to be identify Essential for in vitro growth [ 50 ] UspC have a substrate preference for sugars containing an amino group at the C2 or C3 position...”
- A multiple genome analysis of Mycobacterium tuberculosis reveals specific novel genes and mutations associated with pyrazinamide resistance
Sheen, BMC genomics 2017 - “...strains with critical mutations in pncA , were Rv2505c, Rv2777c, Rv0735, Rv0787A, Rv0994, Rv1327c, Rv1742, Rv2317, Rv2557, Rv2857c, Rv3362c, Rv3393, Rv3410c, Rv3767c, Rv2646, Rv0668 , and Rv0667 . Analysis of mutations in the special set of genes For each of the mutations identified as significantly associated...”
TM1122 glycerol-3-phosphate ABC transporter, permease protein from Thermotoga maritima MSB8
26% identity, 91% coverage
BUE60_02790 carbohydrate ABC transporter permease from Pseudomonas syringae pv. actinidiae
29% identity, 88% coverage
TC 3.A.1.1.50 / Q5SLB5 Sugar ABC transporter, permease protein, component of Probable glycerophosphocholine (GPC) uptake porter (Chandravanshi et al. 2016). The system may include a receptor and three membrane proteins (of 378 aas and 6 TMSs, 299 aas and 7 TMSs, and 113 aas and 3 TMSs (?). The ATPase has not been identified from Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)
33% identity, 59% coverage
- substrates: glycerophosphocholine
LLKF_2260 sugar ABC transporter permease from Lactococcus lactis subsp. lactis KF147
31% identity, 86% coverage
PfGW456L13_1896 ABC transporter for D-Galactose and D-Glucose, permease component 2 from Pseudomonas fluorescens GW456-L13
30% identity, 86% coverage
- mutant phenotype: Specific phenotypes on D-Galactose; N L-Lysine. glucose is the C source for the N source experiments with a phenotype (i.e. lysine); may also transport fructose.
BKKJ1_2077 carbohydrate ABC transporter permease from Bifidobacterium catenulatum subsp. kashiwanohense
27% identity, 89% coverage
BDP_0656 Permease protein of ABC transporter system for sugars from Bifidobacterium dentium Bd1
34% identity, 64% coverage
PSPTO_1294 glucose ABC transporter, permease protein, putative from Pseudomonas syringae pv. tomato str. DC3000
29% identity, 88% coverage
- Data-Independent Acquisition Proteomics Unravels the Effects of Iron Ions on Coronatine Synthesis in Pseudomonas syringae pv. tomato DC3000
He, Frontiers in microbiology 2020 - “...responsible for amino acid uptake (PSPTO_4887, PSPTO_4173, PSPTO_4919, PSPTO_1258, PSPTO_1256, and PSPTO_1255), glucose ABC transporter (PSPTO_1294, PSPTO_1293, and gltK), ribose ABC transporters (rbsA-1), iron ABC transporters (PSPTO_5562 and PSPTO_5561), peptide transporters (PSPTO_4562, PSPTO_4559, dppC, PSPTO_4558, and PSPTO_4564), a mannitol ABC transporter (PSPTO_2705), dipeptide ABC transporters (PSPTO_4562,...”
BBMN68_1168, BLLJ_0210 carbohydrate ABC transporter permease from Bifidobacterium longum subsp. longum BBMN68
28% identity, 85% coverage
- Crystal structure of β-L-arabinobiosidase belonging to glycoside hydrolase family 121
Saito, PloS one 2020 - “...that consists of a substrate-binding protein (SBP, BLLJ_0208) and two transmembrane domain proteins (BLLJ_0209 and BLLJ_0210). Hydroxyproline (Hyp) residues in HRGPs, such as extensin and solanaceous lectins, are usually O -glycosylated with 3 or 4 L-Ara f residues that are linked with three -bonds and one...”
- Characterization of a novel β-L-arabinofuranosidase in Bifidobacterium longum: functional elucidation of a DUF1680 protein family member
Fujita, The Journal of biological chemistry 2014 - “...(BLLJ_0208) and two transmembrane subunits (BLLJ_0209 and BLLJ_0210). BLLJ_0208 exhibits 28% identity with the GNB/LNB-binding protein, and BLLJ_0209 and...”
- Mechanism analysis of acid tolerance response of bifidobacterium longum subsp. longum BBMN 68 by gene expression profile using RNA-sequencing
Jin, PloS one 2012 - “...the components of sugar ABC-transporter. Gene ID RPKM-control RPKM-acid-adapted Fold change COG Code Gene description BBMN68_1168 145.91 61.94 2.36 * G COG0395 K02026, multiple sugar transport system permease protein BBMN68_1169 98.62 30.32 3.25 * G COG1175 K02025, multiple sugar transport system permease protein BBMN68_1170 2153.69 298.91...”
- Characterization of a novel β-L-Arabinofuranosidase in Bifidobacterium longum: functional elucidation of A DUF1680 family member
Fujita, The Journal of biological chemistry 2011 - “...(BLLJ_0208) and 2 transmembrane subunits (BLLJ_0209 and BLLJ_0210). BLLJ_0208 exhibits 28% identity with the GNB/LNB-binding protein, and BLLJ_0209 and...”
Ccel_2110 carbohydrate ABC transporter permease from Ruminiclostridium cellulolyticum H10
Ccel_2110 binding-protein-dependent transport systems inner membrane component from Clostridium cellulolyticum H10
26% identity, 90% coverage
- Internal Transcription Terminators Control Stoichiometry of ABC Transporters in Cellulolytic Clostridia
Wu, Microbiology spectrum 2022 - “...an SBP gene (Ccel_2112) at the 5 end, followed by two TMD genes (Ccel_2111 and Ccel_2110), and has a 106-bp long intergenic region between Ccel_2112 and Ccel_2111. Ccel_2112, encoding SBPs, was transcribed at significantly higher levels than its downstream genes ( Fig.3A ). Northern blotting with...”
- “...and the transcripts of Ccel_2112-2110 were terminated at the 3 ends of Ccel_2112, Ccel_2111, and Ccel_2110. Subsequently, three stem-loop structures were predicted at the 3 ends of Ccel_2112, Ccel_2111, and Ccel_2110 ( Fig.3D ), suggesting that they potentially terminate the transcription of the cluster of Ccel_2112-2110...”
BCAL3039 ABC transporter, membrane permease from Burkholderia cenocepacia J2315
30% identity, 89% coverage
- The Small RNA ncS35 Regulates Growth in Burkholderia cenocepacia J2315
Kiekens, mSphere 2018 - “...system BCAL1550 2.3 Sugar ABC transport system BCAL1661 2.0 Ribokinase BCAL3038 2.0 ABC-type glycerol-3-phosphate transport BCAL3039 2.0 ABC-type glycerol-3-phosphate transport Ornibactin biosynthesis BCAL1696 2.3 Ornibactin biosynthesis protein BCAL1697 2.8 Ornibactin biosynthesis protein BCAL1698 2.5 Ornibactin biosynthesis protein Respiration BCAL2141 13.4 3.5 Cytochrome o ubiquinol oxidase protein...”
- Burkholderia cenocepacia differential gene expression during host-pathogen interactions and adaptation to the host environment
O'Grady, Frontiers in cellular and infection microbiology 2011 - “...BCAL2040 Polysaccharide deacetylase, carbohydrate transport 1.5 BCAL3038 ABC transporter ATP-binding component, carbohydrate ABC transporter 1.6 BCAL3039 ABC transporter, membrane permease 1.5 BCAL3040 ABC transporter, membrane permease 1.7 BCAL3041 MalE, maltose-binding protein 2.1 BCAL3364 Putative gluconokinase 1.7 BCAM0094 Xylulose kinase 1.7 BCAM1330 Cellulose polysaccharide export protein 1.7...”
- “...protein 1.57 BCAL3033 Probable outer membrane lipoproteins carrier 1.53 BCAL3038 ABC transporter ATP-binding component 1.61 BCAL3039 ABC transporter, membrane permease 1.54 BCAL3040 ABC transporter, membrane permease 1.71 BCAL3041 Maltose-binding protein 2.09 BCAL3163 Putative nucleotidyltransferase 1.68 BCAL3203 Putative periplasmic TolB protein 1.64 BCAL3204 Putative OmpA family lipoprotein...”
TC 3.A.1.1.20 / Q7WWQ8 Transmembrane permease MsmG, component of The fructooligosaccharide porter, MsmEFGK from Lactobacillus acidophilus (see 2 papers)
msmG / GI|33149340 transmembrane permease MsmG from Lactobacillus acidophilus (see paper)
30% identity, 84% coverage
- substrates: Fructooligosaccharides
SAK_1477 cyclodextrin ABC transporter, permease protein from Streptococcus agalactiae A909
SAG1443 maltose ABC transporter, permease protein from Streptococcus agalactiae 2603V/R
gbs1512 Unknown from Streptococcus agalactiae NEM316
29% identity, 91% coverage
- The Role of Regulator Catabolite Control Protein A (CcpA) in Streptococcus agalactiae Physiology and Stress Response
Roux, Microbiology spectrum 2022 - “...carbon metabolism were downregulated by CcpA: SAK_0532-0539 , SAK_0166 - SAK_0171 , and SAK_1475 - SAK_1477 coding the transporters of N -acetylglucosamine, ribose, and cyclodextrin, respectively, for which a cre site was present. Several genes involved in glycolysis and gluconeogenesis were regulated by CcpA, as already...”
- A Vaginal Tract Signal Detected by the Group B Streptococcus SaeRS System Elicits Transcriptomic Changes and Enhances Murine Colonization
Cook, Infection and immunity 2018 - “...sak_1074 sak_1103 sak_1104 sak_1105 sak_1426 sak_1427 sak_1476 sak_1477 sak_1538 sak_1539 sak_1540 sak_1541 sak_1542 sak_1554 sak_1555 sak_1556 Gene name rbsB...”
- Adaptive response of Group B streptococcus to high glucose conditions: new insights on the CovRS regulation network
Di, PloS one 2013 - “...in the transport of complex carbohydrates were down-regulated, including: the region spanning from sag1441 to sag1443 ORFs, encoding for the maltose-maltodextrin transport system ( malE-F-G) ; sag0955 and sag1925 ( msmK ) genes, encoding a sugar-ABC transporter and a sugar transport ATP-binding protein, respectively; the ribose...”
- Transcriptome adaptation of group B Streptococcus to growth in human amniotic fluid
Sitkiewicz, PloS one 2009 - “...gbs1510 malE 3.8 Maltose maltodextrin-binding protein gbs1511 malF 4.6 Maltodextrin transport system permease protein malC gbs1512 malG 3.5 Maltose transport system permease protein malG gbs1692 2.7 Dihydroxyacetone kinase gbs1694 2.5 5.1 5.9 Dihydroxyacetone kinase gbs1695 3.9 8.4 Dihydroxyacetone kinase gbs1696 2.6 14.5 Dihydroxyacetone kinase phosphotransfer protein...”
- Relevance of peptide uptake systems to the physiology and virulence of Streptococcus agalactiae
Samen, Journal of bacteriology 2004 - “...obtained by RT-PCR with primers specific to the regions gbs1512 to dpsA and dpsA to gbs1514, indicating a monocistronic organization of the dpsA gene in S....”
ACPL_6400 sugar ABC transporter permease from Actinoplanes sp. SE50/110
31% identity, 75% coverage
- Reconstruction and in silico analysis of an Actinoplanes sp. SE50/110 genome-scale metabolic model for acarbose production
Wang, Frontiers in microbiology 2015 - “...mal EFG in the pathway were ACPL_6402, ACPL_3200, ACPL_4618, ACPL_5585, ACPL_6401, ACPL_6726, ACPL_3782, ACPL_5386, and ACPL_6400. Figure 6 Chemical structure for acarbose . The essential genes for acarbose production were studied in acarbose synthesis medium. One hundred and thirty three genes were essential for acarbose synthesis,...”
Blon_0342 binding-protein-dependent transport systems inner membrane component from Bifidobacterium longum subsp. infantis ATCC 15697
Blon_2203 binding-protein-dependent transport systems inner membrane component from Bifidobacterium longum subsp. infantis ATCC 15697
29% identity, 87% coverage
- Analysis of predicted carbohydrate transport systems encoded by Bifidobacterium bifidum PRL2010
Turroni, Applied and environmental microbiology 2012 - “...Bbr_1111 Bbr_1880 Bbr_0101 Bbr_1892 Blon_2183 Blon_2331 Blon_0342 Blon_2015 Blon_2177 Blon_2176 Blon_2175 Blon_1050 Blon_2471 Blon_0129 B. longum subsp....”
- 2'-Fucosyllactose Increases the Abundance of Blautia in the Presence of Extracellular Fucosidase-Possessing Bacteria
Horigome, Frontiers in microbiology 2022 - “...). The gene cluster encoding MAGB_040/MAGF_1420 contained fucosyllactose transporter genes, which were homologs of Blon_2202, Blon_2203, and Blon_2204. The copy numbers of MAGB_040/MAGF_1420 and the cell numbers of B. pseudocatenulatum in the culture medium were comparable after the fermentation of feces from non-responders in YCFA_2FL (...”
- Fucosylated Human Milk Oligosaccharide Foraging within the Species Bifidobacterium pseudocatenulatum Is Driven by Glycosyl Hydrolase Content and Specificity
Shani, Applied and environmental microbiology 2022 (secret) - Strain-specific strategies of 2'-fucosyllactose, 3-fucosyllactose, and difucosyllactose assimilation by Bifidobacterium longum subsp. infantis Bi-26 and ATCC 15697
Zabel, Scientific reports 2020 - “...(Fig. 7 ). However, the average increase in the transcript abundance for the genes Blon_2202, Blon_2203, Blon_2204 was approximately 25% less on DFL than on 2FL or 3FL (74-fold average increase versus 100-fold respectively), especially pronounced for the SBP encoding gene Blon_2202. The locus encoding fucose...”
P73854 Lactose transport system permease protein LacG from Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
slr1723 lactose transport system permease protein; LacG from Synechocystis sp. PCC 6803
29% identity, 87% coverage
- Characterization of the binding protein-dependent cellobiose and cellotriose transport system of the cellulose degrader Streptomyces reticuli
Schlösser, Applied and environmental microbiology 1999 (secret) - A global transcriptional activator involved in the iron homeostasis in cyanobacteria
Liu, Science advances 2024 - “...MntC Others Sugar transport slr1202 , Slr1202, permease protein of sugar ABC transporter Motif-2, -3 slr1723 , Slr1723, permease protein of sugar ABC transporter Motif-1, -2 slr0044 , CmpD, bicarbonate transport system ATP-binding protein Motif-1, -2 slr0043 , CmpC, bicarbonate transport system ATP-binding protein Others slr0531...”
- Design and characterization of molecular tools for a Synthetic Biology approach towards developing cyanobacterial biotechnology
Huang, Nucleic acids research 2010 - “...transport lactose, and hence IPTG, into the cells, but there are candidate genes such as slr1723 and slr1202 (permeases) ( 68 ) and sll1374 (putative sugar transporter) ( 69 ). The low induction problem caused by limited diffusion of IPTG has been previously recognized ( 70...”
SYNPCC7002_A2036 ABC transporter, ATPase subunit from Synechococcus sp. PCC 7002
30% identity, 86% coverage
BAD_RS07405 carbohydrate ABC transporter permease from Bifidobacterium adolescentis ATCC 15703
28% identity, 91% coverage
- Combining of transcriptome and metabolome analyses for understanding the utilization and metabolic pathways of Xylo-oligosaccharide in Bifidobacterium adolescentis ATCC 15703
Yang, Food science & nutrition 2019 - “...4,6dehydratase F:GTTCACGGAGCATACCCCATA 59.9 147 R:TGCTGGAAGGGACCGTAGTT 59.5 BAD_RS08125 Molecular chaperone DnaK F:ACCGACTGGACCGTTGAGAT 59.0 156 R:CTGGGCGTCGTTGAAGTATG 59.0 BAD_RS07405 Multiple sugarbinding transport system permease F:CAACGCCTTCAAGAACACC 56.1 200 R:GACCCACCTGTGCCTCCAT 59.9 BAD_RS01610 Xylanase F:ATGACGGAAAGCCGCATGT 57.6 163 R:CGGTCGTGGGTCAGGAAGA 59.6 BAD_RS03215 ABC transporter permease F:CTCATCTCGCTCGTCTCCG 58.8 200 R:GGTACTTTGACCGCTCTGC 55.4 BAD_RS06375 MFS transporter F:GAACATGATGATCGCACCG...”
- “...Gene no. a Log 2 (Fc) b Annotation c Linear FMPK value d XOS Xylose BAD_RS07405 3.63 Multiple sugarbinding transport system permease 160.73 12.98 BAD_RS05940 3.51 MFS transporter 6.71 0.59 BAD_RS01050 3.47 Shikimate kinase 173.6 15.68 BAD_RS07410 3.27 ABC transporter permease 159.79 16.53 BAD_RS07415 3.23 ABC...”
TC 3.A.1.1.23 / Q9X9R5 CBP protein aka CebG, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] from Streptomyces reticuli (see paper)
29% identity, 86% coverage
- substrates: Cellobiose, Celltriose
BBMN68_931 ABC transporter permease subunit from Bifidobacterium longum subsp. longum BBMN68
30% identity, 82% coverage
YcjP / b1312 putative ABC transporter membrane subunit YcjP from Escherichia coli K-12 substr. MG1655 (see 2 papers)
TC 3.A.1.1.46 / P77716 Inner membrane ABC transporter permease protein YcjP, component of Probable glucoside uptake porter, YcjNOPV from Escherichia coli (strain K12)
b1312 predicted sugar transporter subunit: membrane component of ABC superfamily from Escherichia coli str. K-12 substr. MG1655
31% identity, 85% coverage
- substrates: Glucosides
tcdb comment: Encoded in an operon or gene cluster with a glucosyl hydrolase and two oxidoreductases (Moussatova et al. 2008) - 18th Congress of the European Hematology Association, Stockholm, Sweden, June 13–16, 2013
, Haematologica 2013 - Differential gene expression for investigation of Escherichia coli biofilm inhibition by plant extract ursolic acid
Ren, Applied and environmental microbiology 2005 - “...b4208 b4138 1.5 0.0005 1.6 0.0074 1.4 0.0170 1.5 0.0004 b1312 bglF fhuD b1312 b3722 b0152 1.0 1.0000 1.4 0.0546 1.1 0.8560 1.6 0.0319 1.6 0.0053 1.6 0.0032 nikE...”
- Biochemistry and regulation of a novel Escherichia coli K-12 porin protein, OmpG, which produces unusually large channels
Fajardo, Journal of bacteriology 1998 - “...blot analysis using three different probes, specific to pspA, b1312 to 1313, and ompG (Fig. 6). The data revealed that in the cog-192 strain, regions...”
BL1523 sugar permease of ABC transporter system from Bifidobacterium longum NCC2705
30% identity, 95% coverage
SSA_1300 Maltose ABC transporter, permease protein, putative from Streptococcus sanguinis SK36
28% identity, 91% coverage
BBMN68_1424 carbohydrate ABC transporter permease from Bifidobacterium longum subsp. longum BBMN68
29% identity, 95% coverage
VC1551 glycerol-3-phosphate ABC transporter, permease protein from Vibrio cholerae O1 biovar eltor str. N16961
Q9KRT5 sn-glycerol-3-phosphate transport system permease protein UgpE from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
29% identity, 86% coverage
MSMEG_5572 sugar ABC transporter permease protein from Mycobacterium smegmatis str. MC2 155
30% identity, 82% coverage
BAD_RS08275 carbohydrate ABC transporter permease from Bifidobacterium adolescentis ATCC 15703
31% identity, 92% coverage
Bbr_0528 ABC transporter permease subunit from Bifidobacterium breve UCC2003
30% identity, 79% coverage
Bbr_0419 carbohydrate ABC transporter permease from Bifidobacterium breve
30% identity, 79% coverage
TT_P0041 No description from Thermus thermophilus HB27
30% identity, 83% coverage
- Engineering the genome of Thermus thermophilus using a counterselectable marker
Carr, Journal of bacteriology 2015 - “...of p-Cl- A Counterselectable Marker for T. thermophilus TT_P0041, without deleting any chromosomal sequence, to produce strain MD132 (Fig. 2A; see also Fig. S4...”
- “...Number 6 surrounding open reading frames, walking outward from TT_P0041 to map the limits of each deletion. From these analyses, we determined that the MD156...”
GM298_18015 sn-glycerol-3-phosphate ABC transporter permease UgpE from Enterobacter sp. HSTU-ASh6
27% identity, 88% coverage
SP_1797 carbohydrate ABC transporter permease from Streptococcus pneumoniae TIGR4
31% identity, 86% coverage
- Streptococcus pneumoniae TIGR4 Phase-Locked Opacity Variants Differ in Virulence Phenotypes
Oliver, mSphere 2017 - “...TIGR4 (genes SP_0148 and SP_2176 ), E ( SP_0148 and SP_2176 ), and F ( SP_1797 ). TABLE2 Gene expression differences between strains HsdS allele Gene ORF a Gene log 2 fold change for allele b : Product A B C D E F TIGR4 B...”
- “...transporter permease SP_1796 SP_1796 0.5 0.1 0.36 2.2 0.8 0.2 0.7 ABC transporter substrate-binding protein SP_1797 SP_1797 0.1 0.2 0.49 2.3 0.7 0.5 0.8 Sugar ABC transporter permease SP_1798 SP_1798 0.5 0.3 0.22 2.2 0.9 0.2 0.2 ABC transporter permease a ORF, open reading frame. b...”
LMRG_01861 ABC transporter, permease protein from Listeria monocytogenes 10403S
29% identity, 86% coverage
BL105A_1894 carbohydrate ABC transporter permease from Bifidobacterium longum
30% identity, 95% coverage
- Application of Recombinase-Based In Vivo Expression Technology to Bifidobacterium longum subsp. longum for Identification of Genes Induced in the Gastrointestinal Tract of Mice
Koguchi, Microorganisms 2020 - “...inhibitor), BL105A_1293 (galactoside transport protein), BL105A_1294 (glycoside hydrolase family 32 -fructofuranosidase), BL105A_1798 (putative glycosyltransferase), and BL105A_1894 (raffinose transport system permease protein). Among them, BL105A_1294 was not identified in the R-IVET analysis, but this gene was used as an expected positive control gene for in vivo-specific expression...”
- “...showed significantly increased expression in the cecum, but the other three genes (BL105A_0547, BL105A_1798, and BL105A_1894) did not ( Figure 4 ). Although this inconsistency might be attributed to that different mice were used between these two assays, there are some other possible reasons. The first...”
SeseC_01625 sugar ABC transporter permease from Streptococcus equi subsp. zooepidemicus ATCC 35246
30% identity, 86% coverage
Rv2039c Probable sugar-transport integral membrane protein ABC transporter from Mycobacterium tuberculosis H37Rv
26% identity, 84% coverage
- Comparison of carbohydrate ABC importers from Mycobacterium tuberculosis
De, BMC genomics 2021 - “...the building of a rooted tree (Fig. 3 A). Group 1 was formed by SugB, Rv2039c, UspB, and UgpE and group 2 by SugA, Rv2040c, UspA, and UgpA. Putative orthologs of SugAB permeases formed a separated group from the three other systems, as shown in SugC...”
- “...TMDs in two groups, each one with one member of each transporter. Group 1: SugB, Rv2039c, UspB, and UgpE, and Group 2: SugA, Rv2040c, UspA, and UgpA. Dark gray: M. tuberculosis complex group (MTBC), light gray: other pathogenic mycobacteria, and white: environmental species, represented by M....”
- ATP-binding cassette (ABC) import systems of Mycobacterium tuberculosis: target for drug and vaccine development
Soni, Emerging microbes & infections 2020 - “...amino group at the C2 or C3 position [ 36 ] Rv2038c-Rv2041c SBP: Rv2041c TMD: Rv2039c and Rv2040c NBD: Rv2038c (two copies) Rv2041c treatment with macrophages and lymphocytes shows elevated expression of pro-inflammatory cytokines and raised up secretion of IFN- and TNF-, respectively [ 52 ]...”
- Draft Genome Sequences of Two Extensively Drug-Resistant Strains of Mycobacterium tuberculosis Belonging to the Euro-American S Lineage
Malinga, Genome announcements 2016 - “...overexpress EPs ( 16 ). In RSA114, we identified mutations within the EP-encoding genes Rv0987, Rv2039c, and Rv0402c that are predicted by PROVEAN ( http://provean.jcvi.org/index.php ), to impact efflux activity. ESX export enzymes are involved in the synthesis of PDIM proteins, which have a role in...”
- Anti-mycobacterial activity of marine fungus-derived 4-deoxybostrycin and nigrosporin
Wang, Molecules (Basel, Switzerland) 2013 - “...processing: Translation, ribosomal structure and biogenesis gnd2 Rv1122 0.44 0.03 Metabolism: Carbohydrate transport and metabolism Rv2039c - 0.46 0.02 Metabolism: Carbohydrate transport and metabolism Rv1200 - 1.63 0.04 Metabolism: Carbohydrate transport and metabolism pgk Rv1437 1.65 0.07 Metabolism: Carbohydrate transport and metabolism Rv2471 - 1.83 0.12...”
TC 3.A.1.1.30 / Q88P36 GtsC (GLcG), component of Glucose porter, GtsABCD from Pseudomonas putida (strain KT2440) (see paper)
PP1017, PP_1017 sugar ABC transporter, permease protein from Pseudomonas putida KT2440
30% identity, 80% coverage
- substrates: glucose
tcdb comment: The orthologue of GtsA (receptor) in P. aeruginosa (64% identical to the P. putida GtsA has been biochemically characterized (Stinson et al. 1977) and corresponds to the sequence with UniProt acc# Q9HZ48 (Friedhelm Pfeiffer, personal communication) - UEG Week 2024 Poster Presentations
, United European gastroenterology journal 2024 - UEG Week 2023 Poster Presentations
, United European gastroenterology journal 2023 - Comparative Transcriptome Analysis of Pseudomonas putida KT2440 Revealed Its Response Mechanisms to Elevated Levels of Zinc Stress
Peng, Frontiers in microbiology 2018 - “...0.77 Class II fumarate hydratase PP_1016 gtsB 0.11 0.07 0.08 0.00 Mannose/glucose ABC transporter permease PP_1017 gtsC 0.12 0.00 0.11 0.01 Mannose/glucose ABC transporter permease PP_1018 gtsD 0.17 0.01 0.13 0.01 Mannose/glucose ABC transporter ATP binding protein PP_2379 7.51 0.07 4.88 0.13 Cytochrome oxidase biogenesis protein...”
- A two-component regulatory system integrates redox state and population density sensing in Pseudomonas putida
Fernández-Piñar, Journal of bacteriology 2008 - “...PP_4756 PP_0112 PP_0113 PP_0114 PP_0793 (fruB) PP_1015 PP_1017 PP_1018 PP_1019 (oprB) Amino acid permease ABC transporter, periplasmic binding protein ABC...”
- Convergent peripheral pathways catalyze initial glucose catabolism in Pseudomonas putida: genomic and flux analysis
del, Journal of bacteriology 2007 - “...we found that the operon containing ORFs PP1015, PP1016, PP1017, PP1018, and PP1019, which encode a putative ABC glucose uptake system, was also induced at a...”
- “...PP3382 PP3383 PP3384 PP3416 PP3417 PP3418 PP1015 PP1016 PP1017 PP1018 PP1019 Regulatory genes PP1012 PP1013 PP3380 PP3415 Other functions PP1014 PP2968 PP3384...”
TC 3.A.1.1.33 / Q8KN17 Putative sugar transporter integral membrane protein, component of The N,N'-diacetylchitobiose uptake transporter, DasABC/MsiK (MsiK energizes several ABC transporters (see 3.A.1.1.23)) from Streptomyces sp. 139 (see 2 papers)
28% identity, 83% coverage
- substrates: N,N'-diacetylchitobiose
Balac_1597 MalG-type ABC sugar transport system permease component from Bifidobacterium animalis subsp. lactis Bl-04
31% identity, 93% coverage
- An ATP Binding Cassette Transporter Mediates the Uptake of α-(1,6)-Linked Dietary Oligosaccharides in Bifidobacterium and Correlates with Competitive Growth on These Substrates
Ejby, The Journal of biological chemistry 2016 - “...cytoplasm by the ABC transport system (Balac_1598, Balac_1597, and Balac_1610). The -galactosidase (Balac_1601) and the -(1,6)-glucosidase are responsible for...”
- Genetic and physiological responses of Bifidobacterium animalis subsp. lactis to hydrogen peroxide stress
Oberg, Journal of bacteriology 2013 - “...Balac_1501 Balac_1502 Balac_1503 Balat_0464 Balac_1081 Balac_1597 Balac_1598 Balac_1599 Balac_1601 Balac_1567 Balac_1568 Balac_1569 Balac_1570 Balac_1572...”
- “...different (P 0.05). included those involved in raffinose (Balac_1597 to Balac_1601) and maltose transport and metabolism (Balac_1567 to Balac_ 1573) (see Table...”
- Transcriptional analysis of oligosaccharide utilization by Bifidobacterium lactis Bl-04
Andersen, BMC genomics 2013 - “...B,D Cellobiose E 3.2 12.1 Balac_1593 oligo-1,6--glucosidase, GH13 Galactoside, Glucoside B,D,E Isomaltose F 4.5 14.0 Balac_1597 ABC transporter, permease component Galactoside, Glucoside B,D,E Raffinose F 14.1 13.9 Balac_1598 ABC transporter, permease component Galactoside, Glucoside B,D,E Isomaltose F 20.1 18.6 Balac_1599 ABC transporter, oligosaccharide-binding protein Galactoside, Glucoside...”
PS417_22135 glucose/xylose ABC transporter, permease component 1 from Pseudomonas simiae WCS417
30% identity, 80% coverage
- mutant phenotype: Specifically important for utilization of D-glucose 6-phosphate and D-xylose. Glucokinase (PS417_22685) is important for glucose-6-phosphate utilization, which implies that it is hydrolyzed to glucose before uptake.
GANQ_BACSU / O07011 Galactooligosaccharides transport system permease protein GanQ from Bacillus subtilis (strain 168) (see 2 papers)
TC 3.A.1.1.2 / O07011 Putative arabinogalactan oligomer transport system permease protein ganQ, component of The galactooligosaccharide (transports the di, tri and tetrasaccharides) uptake porter GanOPQ (GanSPQ; MalEFG) functioning with the energizing ATPase MsmX (see 3.A.1.1.26) from Bacillus subtilis (see 2 papers)
BSU34140 arabinogalactan oligomer permease from Bacillus subtilis subsp. subtilis str. 168
30% identity, 87% coverage
- function: Involved in galactan degradation (PubMed:27501980). Part of the ABC transporter complex GanPQS involved in the uptake of galactooligosaccharides (PubMed:27501980, PubMed:29240795). Responsible for the translocation of the substrate across the membrane (Probable).
subunit: The complex is composed of two ATP-binding proteins (MsmX), two transmembrane proteins (GanP and GanQ) and a solute-binding protein (GanS). - substrates: Galactooligosaccharides
tcdb comment: These oligosaccharides are derived from galactans and arabinogalactans, compenents of pectins in plant cell walls (Watzlawick et al. 2016) - Regulon of the N-acetylglucosamine utilization regulator NagR in Bacillus subtilis
Bertram, Journal of bacteriology 2011 - “...3528 J. BACTERIOL. yvfM, ganQ amyD dhaS yjdB BSU34140 BSU30280 BSU19310 BSU11990 a --, cis-acting element, trans-acting regulator, pathway, or regulon unknown....”
- The MsmX ATPase plays a crucial role in pectin mobilization by Bacillus subtilis
Ferreira, PloS one 2017 - “...are boxed. Accession numbers: AraP (P94529), AraQ (P94530), MdxF (O06990), MdxG (O06991), GanP (O32261), GanQ (O07011), OpuAB (P46921), MalF (P02916), and MalG (P68183). 10.1371/journal.pone.0189483.t008 Table 8 Effect of mutations in AraP and AraQ in the uptake of -1,5-arabinotriose. Doubling time (min) of different strains in liquid...”
R8G07_08360 carbohydrate ABC transporter permease from Bifidobacterium longum subsp. longum
29% identity, 97% coverage
- Bifidobacterium longum subsp. longum BG-L47 boosts growth and activity of Limosilactobacillus reuteri DSM 17938 and its extracellular membrane vesicles
Ermann, Applied and environmental microbiology 2024 - “...involved in LNT, lacto-N-biose (LNB), and galacto-N-biose degradation. In BG-L47, the transporter is encoded by R8G07_08360, R8G07_08365, and R8G07_08370, and by an ortholog of the operon in BB536 (HCBKAFLH_01753, HCBKAFLH_01754, HCBKAFLH_01755). However, the inability of BB536 to grow on LNT indicates that the ortholog is not...”
AT5A_09945 carbohydrate ABC transporter permease from Agrobacterium tumefaciens 5A
31% identity, 83% coverage
- Introducing the ArsR-Regulated Arsenic Stimulon
Rawle, Frontiers in microbiology 2021 - “...2.6 AT5A_09935 Sugar ABC transporter substrate-binding protein 2.6 AT5A_09940 Sugar ABC transporter transmembrane protein 2.3 AT5A_09945 Sugar ABC transporter transmembrane protein 2.1 AT5A_09950 Sugar ABC transporter nucleotide-binding ATPase 2.2 AT5A_18906 Maltose ABC transporter transmembrane protein 2.4 AT5A_18911 Maltose ABC transporter transmembrane protein 2.4 AT5A_18916 Maltose ABC...”
Blon_2175 binding-protein-dependent transport systems inner membrane component from Bifidobacterium longum subsp. infantis ATCC 15697
28% identity, 97% coverage
- Phylogenetic, Functional and Safety Features of 1950s B. infantis Strains
Duboux, Microorganisms 2022 - “...the fact that LMG 11588 displays a non-functional ABC transporter system predicted to import LNT (Blon_2175 to Blon_2177 in ATCC 15697) [ 12 ], it is still able to partly metabolize LNT, suggesting the existence of a potential secondary LNT transport mechanism in that strain, which...”
- Human Milk Oligosaccharide Utilization in Intestinal Bifidobacteria Is Governed by Global Transcriptional Regulator NagR
Arzamasov, mSystems 2022 - “...N -Acetylhexosamine 1-kinase EC 2.7.1.162 59 Blon_2174 lnpA 1,3--Galactosyl- N -acetylhexosamine phosphorylase EC 2.4.1.211 63 Blon_2175 gltC LNT/LNB/GNB ABC transporter permease protein 2 TC 3.A.1.1.48 Blon_2176 gltB LNT/LNB/GNB ABC transporter permease protein 1 TC 3.A.1.1.48 Blon_2177 gltA LNT/LNB/GNB ABC transporter substrate-binding protein TC 3.A.1.1.48 39 Blon_2331...”
- Comparative Genome Analysis of Bifidobacterium longum subsp. infantis Strains Reveals Variation in Human Milk Oligosaccharide Utilization Genes among Commercial Probiotics
Duar, Nutrients 2020 - “...in Group 1 and Group 2 occurred in the H5 cluster. Specifically, in the genes Blon_2175, Blon_2176 to Blon_2177 encoding an ABC-type transporter predicted to uptake lacto- N -biose ( Figure 1 b). Further examination, by aligning this genomic region in representative strains from Group 1...”
- “...and Group 2 (NLS and BB-02(DSM 33361)) ( Figure 2 a), revealed that the genes Blon_2175, Blon_2176 and Blon_2177 are in fact absent from the Group 2 strains ( Figure 2 a). This same region in the EVC001 and ATCC 15697 strains presented a high degree...”
- Inefficient Metabolism of the Human Milk Oligosaccharides Lacto-N-tetraose and Lacto-N-neotetraose Shifts Bifidobacterium longum subsp. infantis Physiology
Özcan, Frontiers in nutrition 2018 - “...HMO moieties ( 16 ). Three F1SBPs (Blon_0883, Blon_2344 and Blon_2347) and four ABC permeases (Blon_2175, Blon_2176, Blon_2345 and Blon_2346) were induced more than 2-fold during the growth on LNT or LNnT as the sole carbon source relative to lactose ( p < 0.05). Only Blon_2347...”
- “...S2 . Genes involved in galactose metabolism (Blon_2171, Blon_2172, and Blon_2174) and adjacent ABC transporters (Blon_2175, Blon_2176, and Blon_2177) are strongly upregulated by both LNT and LNnT compared to lactose ( p < 0.05) (Figure 5 ). Moreover, LNnT prompted stronger induction of these genes relative...”
- Exposure of Bifidobacterium longum subsp. infantis to Milk Oligosaccharides Increases Adhesion to Epithelial Cells and Induces a Substantial Transcriptional Response
Kavanaugh, PloS one 2013 - “...1.25 0.0200 1.40 0.0020 1.50 0.0000 Blon_2174 Hypothetical protein 1.40 0.0200 1.55 0.0060 1.75 0.0020 Blon_2175 Solute transport 1.35 0.0300 1.56 0.0030 1.43 0.0100 Blon_2176 Solute transport 1.46 0.0060 1.63 0.0010 1.51 0.0020 Blon_2341 Hypothetical protein 1.29 0.0190 1.33 0.0100 1.73 0.0020 Blon_2379 Transport system inner...”
- Analysis of predicted carbohydrate transport systems encoded by Bifidobacterium bifidum PRL2010
Turroni, Applied and environmental microbiology 2012 - “...Blon_2183 Blon_2331 Blon_0342 Blon_2015 Blon_2177 Blon_2176 Blon_2175 Blon_1050 Blon_2471 Blon_0129 B. longum subsp. infantis ATCC 15697 BLD_1757 BLD_0728...”
- Broad conservation of milk utilization genes in Bifidobacterium longum subsp. infantis as revealed by comparative genomic hybridization
LoCascio, Applied and environmental microbiology 2010 - “...divergence occurred specifically in three family 1 SBPs (Blon_2175, Blon_2176, and Blon_2177), while the rest of the cluster, including the LNB phosphorylase...”
Blon_2456 binding-protein-dependent transport systems inner membrane component from Bifidobacterium longum subsp. infantis ATCC 15697
29% identity, 95% coverage
RPPS3_01230 carbohydrate ABC transporter permease from Rhodopseudomonas palustris
28% identity, 91% coverage
- Whole-genome sequencing and comparative analysis of two plant-associated strains of Rhodopseudomonas palustris (PS3 and YSC3)
Lo, Scientific reports 2018 - “...fructose and glucose. In addition, there are genes encoding multiple sugar ABC transport systems (RPPS3_01220, RPPS3_01230, RPPS3_033890, RPPS3_35020, RPPS3_35050, RPPS3_35450, RPPS3_43670, RPPS3_45360, RPYSC3_01220, RPYSC3_01230, RPYSC3_35200, RPYSC3_35230, RPYSC3_35650, RPYSC3_44090 and RPYSC3_45830) and TonB-dependent transporters in the R. palustris genomes (Supplementary Tables S5 and S6 ). TonB-dependent transporters...”
BL1332 probable sugar permease of ABC transporter system from Bifidobacterium longum NCC2705
30% identity, 81% coverage
Ac3H11_2065 glucose ABC transporter, permease component 2 from Acidovorax sp. GW101-3H11
29% identity, 86% coverage
- mutant phenotype: Specifically important for utilizing glucose. Also mildly important for mannose utilization and likely transports it as well.
lmo2123 similar to maltodextrin ABC-transport system (permease) from Listeria monocytogenes EGD-e
LMOf2365_2157 maltose/maltodextrin ABC transporter, permease protein from Listeria monocytogenes str. 4b F2365
26% identity, 91% coverage
- Synergistic Antibacterial Mechanism of Mannosylerythritol Lipid-A and Lactic Acid on Listeria monocytogenes Based on Transcriptomic Analysis
Liu, Foods (Basel, Switzerland) 2022 - “..., we analyzed the transcription level of lmo0248 , lmo0249 , lmo2623 , lmo2628 , lmo2123 , lmo2124 , lmo2347, and lmo2348 by real-time quantitative PCR to verify the accuracy of the transcriptome data. It was highly consistent between the RNA-Seq and qPCR results (R 2...”
- Genomic characteristics of listeria that caused invasive listeriosis during the COVID-19 pandemic
Voronina, 2022 - Antibacterial Efficacy and Mechanism of Mannosylerythritol Lipids-A on Listeria monocytogenes
Liu, Molecules (Basel, Switzerland) 2020 - “...[ 31 ]. The expression of genes involved in localization (lmo2124, lmo1740, etc.), transport (lmo2124, lmo2123, lmo2347, etc.) and the establishment of localization were downregulated ( Figure 6 B). These genes are mainly predicted to be related to the transport of sugar and amino acids, indicating...”
- “...S2 ) were differentially regulated during cultivation in MEL-A, in which the ABC transporters-associated genes (lmo2123, lmo2123, opuCD, etc.) were significantly regulated. ABC transporters belong to a large and diverse protein family that are mainly responsible for transporting various substrates (including ions and macromolecules) and are...”
- Survival of Listeria monocytogenes in Soil Requires AgrA-Mediated Regulation
Vivant, Applied and environmental microbiology 2015 - “...of proteins, such as the ABC transporter (lmo2123 to lmo2125, lmo1739) and the phosphotransferase (PTS) system (lmo2782, lmo2665, lmo2666, lmo2780). Fourteen...”
- Maltose and maltodextrin utilization by Listeria monocytogenes depend on an inducible ABC transporter which is repressed by glucose
Gopal, PloS one 2010 - “...L. monoyctogenes cluster symbolize the position of insertion mutations and of the deletion generated in lmo2123 . T = putative transcriptional terminator. The GenBank accession nos. for the respective genome sequences are AL591824 ( L.m .) and AL009126 ( B.s .). A homology search for orthologues...”
- “...as similar to a maltodextrin ABC transporter. ListiList also showed that in L. monocytogenes EGD-e, lmo2123 lmo2125 are part of a cluster of eight genes which, according to annotated gene product function and protein length, is almost identical to the major part of the maltodextrin utilization...”
- Transcriptome analysis of alkali shock and alkali adaptation in Listeria monocytogenes 10403S
Giotis, Foodborne pathogens and disease 2010 - “...induction of genes such as maltodextrin transporter (lmo2122, lmo2123, lmo2124, and lmo2126) suggests that initial uptake and processing of certain sugars, such...”
- Glycerol metabolism and PrfA activity in Listeria monocytogenes
Joseph, Journal of bacteriology 2008 - “...lmo2085b lmo2098 lmo2108 lmo2109 lmo2115 lmo2121a,b lmo2122 lmo2123 lmo2124 lmo2125b lmo2134 lmo2135 lmo2136 lmo2143 lmo2159b lmo2175 fruA lmo2341 lmo2389...”
- Catabolite control protein C contributes to virulence and hydrogen peroxide-induced oxidative stress responses in <i>Listeria monocytogenes</i>
Ogunleye, Frontiers in microbiology 2024 - “...L-arabinose transport system permease protein 1.6 1.3E-02 LMOf2365_2032 Probable ABC transporter permease protein 2.7 3.7E-03 LMOf2365_2157 Maltodextrin transport system permease protein 2.2 2.3E-03 LMOf2365_2318 L-cystine transport system permease protein 2.7 1.1E-05 LMOf2365_2553 Putative hemin transport system permease protein: FtsX-like permease family 1.7 4.3E-03 LMOf2365_2828 Inner membrane...”
AT5A_18911 carbohydrate ABC transporter permease from Agrobacterium tumefaciens 5A
31% identity, 86% coverage
- Introducing the ArsR-Regulated Arsenic Stimulon
Rawle, Frontiers in microbiology 2021 - “...2.1 AT5A_09950 Sugar ABC transporter nucleotide-binding ATPase 2.2 AT5A_18906 Maltose ABC transporter transmembrane protein 2.4 AT5A_18911 Maltose ABC transporter transmembrane protein 2.4 AT5A_18916 Maltose ABC transporter substrate-binding protein 2.7 AT5A_18921 Maltose/maltodextrin ABC transporter 2.7 AT5A_19366 Sugar ABC transporter periplasmic sugar-binding protein 7.2 7.8 5.5 5.7 26.5...”
A7MGF9 sn-glycerol-3-phosphate transport system permease protein UgpE from Cronobacter sakazakii (strain ATCC BAA-894)
26% identity, 88% coverage
LMOf2365_2828 ABC transporter, permease protein from Listeria monocytogenes str. 4b F2365
29% identity, 85% coverage
Z4819 sn-glycerol 3-phosphate transport system, integral membrane protein from Escherichia coli O157:H7 EDL933
ECs4297 integral membrane protein of sn-glycerol 3-phosphate transport system from Escherichia coli O157:H7 str. Sakai
Z_RS22635 sn-glycerol-3-phosphate ABC transporter permease UgpE from Escherichia coli O157:H7 str. EDL933
25% identity, 86% coverage
- RcsB contributes to the distinct stress fitness among Escherichia coli O157:H7 curli variants of the 1993 hamburger-associated outbreak strains
Carter, Applied and environmental microbiology 2012 - “...ugpE ugpA ugpB Z0826 Z2192 Z2463 Z4819 Z4820 Z4822 Phosphotransferase system N-acetylglucosamine-specific transporter subunit IIABC ABC transporter ATP-binding...”
- Global transcriptional response of Escherichia coli O157:H7 to growth transitions in glucose minimal medium
Bergholz, BMC microbiology 2007 - “...yfhO 2.04 2 ECs4046 rpsO -2.20 1 ECs4295 ugpQ 2.20 2 ECs4296 ugpC 2.60 2 ECs4297 ugpE 2.12 2 ECs4305 livK -2.23 1 ECs4395 gadW 2.10 2 ECs4396 gadX 2.76 2 ECs4534 intL 2.50 2 ECs4673 atpC -2.24 1 ECs5108 yjdI 2.20 2 ECs5269 yjhT 3.09...”
- Transcriptomic Analysis of Viable but Non-Culturable Escherichia coli O157:H7 Formation Induced by Low Temperature
Zhong, Microorganisms 2019 - “...ITTA 4 mgt A IT, OAT, SSTTA, ITTA 3 Z_RS26985, Z_RS26485, Z_RS25225, Z_RS24665, Z_RS22875, Z_RS22705, Z_RS22635, Z_RS22415, Z_RS21515, Z_RS17370, Z_RS17145, Z_RS13740, Z_RS09350, Z_RS09310, Z_RS06530, Z_RS05705, Z_RS02760, Z_RS02175, Z_RS24940, nik E, msb B, kdp C IT, CP, CW, EES, SSTTA, ITTA 2 Z_RS22695, Z_RS16125, Z_RS13335, Z_RS12460, Z_RS10735,...”
RL4216 putative mannitol transmembrane permease component of ABC transporter from Rhizobium leguminosarum bv. viciae 3841
30% identity, 83% coverage
Hlac_2864 binding-protein-dependent transport systems inner membrane component from Halorubrum lacusprofundi ATCC 49239
25% identity, 91% coverage
- Cloning, overexpression, purification, and characterization of a polyextremophilic β-galactosidase from the Antarctic haloarchaeon Halorubrum lacusprofundi
Karan, BMC biotechnology 2013 - “...IclR family transcriptional regulator; Hlac_2862, sugar-binding periplasmid protein; Hlac_2863, ABC-type sugar transport system permease component; Hlac_2864, sugar permease; Hlac_2865, ABC-type sugar transport system; ATPase component; Hlac_2866, L-alanine-DL-glutamate epimerase and related enzymes of enolase; Hlac_2867, short-chain dehydrogenase/reductase SDR; Hlac_2868, -galactosidase; Hlac_2869, -galactosidase; Hlac_2870, sugar kinase, and Hlac_2871...”
BLGT_09095 carbohydrate ABC transporter permease from Bifidobacterium longum subsp. longum GT15
29% identity, 93% coverage
RSP_2871 ABC alpha-glucoside transporter, inner membrane subunit AglG from Rhodobacter sphaeroides 2.4.1
34% identity, 60% coverage
WP_008726773 carbohydrate ABC transporter permease from Brachyspira hampsonii
27% identity, 91% coverage
D805_1601 carbohydrate ABC transporter permease from Bifidobacterium thermophilum RBL67
28% identity, 84% coverage
TC 3.A.1.1.48 / D6ZW62 Permease of ABC transporter for sugars, component of The lacto-N-biose I (LNB; Gal β-1,3-GlcNAc)/galacto-N-biose (GNB; Gal β-1,3-GalNAc) transporter from Bifidobacterium longum subsp. longum (strain JDM301)
30% identity, 80% coverage
- substrates: Lacto-N-biose
tcdb comment: The solute-binding protein crystallizes only in the presence of LNB or GNB, and it was therefore named GNB/LNB-binding protein (GL-BP) (Wada et al. 2007; Suzuki et al. 2008; Asakuma et al. 2011). Isothermal titration calorimetry measurements revealed that GL-BP specifically binds LNB and GNB with K(d) values of 0.087 and 0.010 μM, respectively, and the binding process is enthalpy-driven. The crystal structures of GL-BP complexed with LNB, GNB, and lacto-N-tetraose (Galbeta1-3GlcNAcbeta1Suzuki et al. 2008; Asakuma et al. 2011). Isothermal titration calorimetry measurements revealed that GL-BP specifically binds LNB and GNB with K(d) values of 0.087 and 0.010 μM, respectively, and the binding process is enthalpy-driven. The crystal structures of GL-BP complexed with LNB, GNB, and lacto-N-tetraose (Galbeta1-3GlcNAcbeta1-3Galbeta1-4Glc) were determined. The MalF and MalG membrahe proteinAsakuma et al. 2011). Isothermal titration calorimetry measurements revealed that GL-BP specifically binds LNB and GNB with K(d) values of 0.087 and 0.010 μM, respectively, and the binding process is enthalpy-driven. The crystal structures of GL-BP complexed with LNB, GNB, and lacto-N-tetraose (Galbeta1-3GlcNAcbeta1-3Galbeta1-4Glc) were determined. The MalF and MalG membrahe proteins are encoded adjacent to the gene for GL-BP, but the ATPase was not identified
EF1343 sugar ABC transporter, permease protein from Enterococcus faecalis V583
IUJ47_RS09695 sugar ABC transporter permease from Enterococcus faecalis
28% identity, 90% coverage
RPYSC3_01230 carbohydrate ABC transporter permease from Rhodopseudomonas palustris
29% identity, 86% coverage
- Whole-genome sequencing and comparative analysis of two plant-associated strains of Rhodopseudomonas palustris (PS3 and YSC3)
Lo, Scientific reports 2018 - “...encoding multiple sugar ABC transport systems (RPPS3_01220, RPPS3_01230, RPPS3_033890, RPPS3_35020, RPPS3_35050, RPPS3_35450, RPPS3_43670, RPPS3_45360, RPYSC3_01220, RPYSC3_01230, RPYSC3_35200, RPYSC3_35230, RPYSC3_35650, RPYSC3_44090 and RPYSC3_45830) and TonB-dependent transporters in the R. palustris genomes (Supplementary Tables S5 and S6 ). TonB-dependent transporters have been considered to be involved in dietary...”
UgpE / b3451 sn-glycerol 3-phosphate ABC transporter membrane subunit UgpE (EC 7.6.2.10) from Escherichia coli K-12 substr. MG1655 (see paper)
UgpE / P10906 sn-glycerol 3-phosphate ABC transporter membrane subunit UgpE (EC 7.6.2.10) from Escherichia coli (strain K12) (see 20 papers)
UGPE_ECOLI / P10906 sn-glycerol-3-phosphate transport system permease protein UgpE from Escherichia coli (strain K12) (see 5 papers)
P10906 ABC-type glycerol 3-phosphate transporter (EC 7.6.2.10) from Escherichia coli (see paper)
TC 3.A.1.1.3 / P10906 UgpE aka B3451, component of Glycerol-phosphate porter. Transports both glycerol-3-P and glycerol-3-P diesters including glycerophosphocholine but not glycerol-2-P from Escherichia coli (see 5 papers)
ECK3435, NP_417908 sn-glycerol 3-phosphate ABC transporter membrane subunit UgpE from Escherichia coli str. K-12 substr. MG1655
b3451 glycerol-3-phosphate transporter subunit from Escherichia coli str. K-12 substr. MG1655
25% identity, 86% coverage
- function: Part of the ABC transporter complex UgpBAEC involved in sn- glycerol-3-phosphate (G3P) import (PubMed:23013274, PubMed:2842304). Probably responsible for the translocation of the substrate across the membrane (Probable). Can also transport glycerophosphoryl diesters, which are hydrolyzed to G3P and alcohol during transport (PubMed:2842304). The G3P moiety can be detected in the cytoplasm whereas the corresponding alcohol is usually found in the culture medium (PubMed:2842304). It was proposed by Yang et al that the complex could also transport glycerol-2-phosphate (G2P) in vivo, but it was shown later by Wuttge et al that UgpB does not bind G2P, questioning this transport activity (PubMed:19429609, PubMed:23013274). G2P might be converted in the periplasm to G3P before its transport (PubMed:23013274).
subunit: The complex is composed of two ATP-binding proteins (UgpC), two transmembrane proteins (UgpA and UgpE) and a solute-binding protein (UgpB).
disruption phenotype: Mutant lacking this gene fails to grow on both glycerol-3-phosphate and glycerol-2-phosphate. - substrates: Glycerol-phosphate
tcdb comment: UgpB (the receptor) binds glycerol 3-P with high affinity, but not glycerol 2-P (Wuttge et al. 2012). UgpB (the receptor) binds glycerol 3-P with high affinity, but not glycerol 2-P (Wuttge et al. 2012) - Global regulation by the seven-component Pi signaling system
Hsieh, Current opinion in microbiology 2010 - “...component [ 1 ] ugpC ECK3434 glycerol-3-phosphate transporter subunit, ATP-binding component [ 1 ] ugpE ECK3435 glycerol-3-phosphate transporter subunit, membrane component [ 1 ] ugpQ ECK3433 glycerol-3-phosphate transporter subunit, membrane component [ 1 ] yibD ECK3605 predicted glycosyl transferase [ 7 ] ytfK ECK4213 conserved protein...”
- Uptake of glycerol-2-phosphate via the ugp-encoded transporter in Escherichia coli K-12.
Yang, Journal of bacteriology 2009 - GeneRIF: Mutations in the ugpBAECQ operon (Ugp)eliminated the ability of phoA-deleted E. coli to utilize glycerol-2-phosphate (G2P)suggesting that G2P is a previously unrecognized substrate for the binding protein-dependent Ugp transporter.
- Co-translational protein aggregation and ribosome stalling as a broad-spectrum antibacterial mechanism
Khodaparast, Nature communications 2025 (no snippet) - RpoS-regulated genes of Escherichia coli identified by random lacZ fusion mutagenesis
Vijayakumar, Journal of bacteriology 2004 - “...predicted functionsd Blattner no. ybaY gabP ugpE b0453 b2663 b3451 ugpC ydcS yehX b3450 b1440 b2129 narY appB IdcC aidB b1467 b0979 b0186 b4187 katE uspB b1732...”
HMPREF0421_20240 sugar ABC transporter permease from Gardnerella vaginalis ATCC 14019
29% identity, 84% coverage
- Phase variable colony variants are conserved across Gardnerella spp. and exhibit different virulence-associated phenotypes
Garcia, mSphere 2024 - “...(HMPREF0421_20394), DNA recombination and segregation (RecA, FtsK, HMPREF0421_20072), ABC (ATP-binding cassette) transport (HMPREF0421_20105, HMPREF0421_20232, HMPREF0421_20436, HMPREF0421_20240), and RNA posttranscriptional modification (HMPREF0421_20849). In addition to the similarly expressed proteins presented in Tables S2 and S3 , each strain displayed unique differences in protein expression between Lg and...”
TC 3.A.1.1.11 / Q93KB9 TogN, component of Saturated and unsaturated oligogalacturonide transporter, TogMNAB (transports di- to tetrasaccharide pectin degradation products which consist of D-galacuronate, sometimes with 4-deoxy-L-threo-5-hexosulose uronate at the reducing end of the oligosaccharide) (Hugouvieux-Cotte-Pattat et al. 2001). Regulated by pectin utilization regulator KdgR from Erwinia chrysanthemi (see paper)
28% identity, 87% coverage
- substrates: Oligogalacturonides
BL1640 permease of ABC transporter for sugars from Bifidobacterium longum NCC2705
30% identity, 80% coverage
EfmE1162_0367 sugar ABC transporter permease from Enterococcus faecium E1162
27% identity, 88% coverage
- A LacI-family regulator activates maltodextrin metabolism of Enterococcus faecium
Zhang, PloS one 2013 - “...Expression ratio mdxR /WT M1+maltose BHI EfmE1162_0366 ZP_06676211 mdxA conserved hypothetical protein 0.16 - b EfmE1162_0367 ZP_06676212 mdxB maltose/maltodextrin ABC transporter, permease protein 0.12 - EfmE1162_0368 ZP_06676213 mdxC maltose/maltodextrin ABC transporter, permease protein 0.27 - EfmE1162_0369 ZP_06676214 mdxD maltose/maltodextrin ABC transporter, binding protein 0.27 - EfmE1162_0370...”
ML1769 sugar transport integral membrane protein from Mycobacterium leprae TN
26% identity, 88% coverage
- Mycobacterium leprae Transcriptome During In Vivo Growth and Ex Vivo Stationary Phases
Ojo, Frontiers in cellular and infection microbiology 2021 - “...sugA (ML1087), sugB (ML1088) and sugC (ML1089) were down regulated in ML96 along with uspE (ML1769), uspC (ML1770) and mmpL10 (ML1231). ML0283, a possible cation-efflux transporter was significantly upregulated at 96 hr in axenic medium along with multiple ATP-binding cassette (ABC) transporters like rfbE (ML0114c), ML0595,...”
BBMN68_1672 carbohydrate ABC transporter permease from Bifidobacterium longum subsp. longum BBMN68
30% identity, 82% coverage
Bbr_1588 carbohydrate ABC transporter permease from Bifidobacterium breve UCC2003
30% identity, 80% coverage
- Selective human milk oligosaccharide utilization by members of the <i>Bifidobacterium pseudocatenulatum</i> taxon
Sanchez-Gallardo, Applied and environmental microbiology 2024 - “...phorylase lnbP Bbr_1587 MM0196_0465 27.12 Permease protein of the ABC transporter system for sugars galP1 Bbr_1588 MM0196_1728 87.37 Permease protein of the ABC transporter system for sugars galP2 Bbr_1589 MM0196_1729 87.46 Solute-binding protein of the ABC transporter system for sugars galS Bbr_1590 MM0196_1730 70.18 Heterologous expression,...”
- Bifidobacterium breve UCC2003 Employs Multiple Transcriptional Regulators To Control Metabolism of Particular Human Milk Oligosaccharides
James, Applied and environmental microbiology 2018 - “...Bbr_1558 Bbr_1559 Bbr_1560 Bbr_1585 Bbr_1586 Bbr_1587 Bbr_1588 Bbr_1589 Bbr_1590 James et al. Applied and Environmental Microbiology regulators responsible...”
- Bifidobacterium breve UCC2003 metabolises the human milk oligosaccharides lacto-N-tetraose and lacto-N-neo-tetraose through overlapping, yet distinct pathways
James, Scientific reports 2016 - “...UDP-glucose 4-epimerase (Bbr_1585; galE ), a phosphotransferase family protein (Bbr_1586; nahK ), two permease proteins (Bbr_1588 and Bbr_1589; galP1 and galP2 , respectively), and a solute-binding protein (Bbr_1590; galS ) ( Fig. 2 ), which are all predicted to function in the metabolism of GNB/LNB. Heterologous...”
- “...Bbr_1586 nahK Phosphotransferase family protein 4.55 10.69 3.19 Bbr_1587 lnbP GH112 lacto-N-biose phorylase 3.86 6.52 Bbr_1588 galP1 Permease protein of ABC transporter system for sugars 3.38 4.20 6.38 Bbr_1589 galP2 Permease protein of ABC transporter system for sugars 2.78 5.47 4.05 Bbr_1590 galS Solute-binding protein of...”
- Glycosulfatase-Encoding Gene Cluster in Bifidobacterium breve UCC2003
Egan, Applied and environmental microbiology 2016 - “...79). The other three genes of this cluster, Bbr_1588 -1590, encode a predicted ABC transport system, including two predicted permease proteins and a...”
- “...(nagB3) Bbr_1249 Bbr_1585 (galE) Bbr_1586 (nahK) Bbr_1587 (lnbP) Bbr_1588 Bbr_1589 Bbr_1590 a 12.63 6.17 9.85 8.58 96.75 35.36 31.25 4.175 10.84 11.88 3.07 3.09...”
- Cross-feeding by Bifidobacterium breve UCC2003 during co-cultivation with Bifidobacterium bifidum PRL2010 in a mucin-based medium
Egan, BMC microbiology 2014 - “...cluster, Bbr_1588-1590 encode a predicted ABC transport system, including two predicted permease proteins (represented by Bbr_1588 and Bbr_1589), and a solute binding protein (Bbr_1590), which shares 98% identity with the GNB/LNB-specific binding protein of B. longum JCM1217 [ 60 ]. Bbr_1884 (designated galT2 ), encoding a...”
- “...UDP-Glc-4-epimerase 3.96 Bbr_1586_ nahK N -acetylhexosamine kinase 3.67 Bbr_1587_ lnbP Lacto- N -biose phosphorylase 3.19 Bbr_1588 ABC transport system, permease protein 3.34 Bbr_1589 ABC transport system, permease protein 2.88 Bbr_1590 ABC transport system, solute binding protein 8.95 Bbr_1740_ dapA4 Dihydrodipicolinate synthase 9.91 Bbr_1741 Conserved hypothetical protein...”
- Analysis of predicted carbohydrate transport systems encoded by Bifidobacterium bifidum PRL2010
Turroni, Applied and environmental microbiology 2012 - “...Bbr_1594 Bbr_1551 Bbr_0528 Bbr_0531 Bbr_1590 Bbr_1589 Bbr_1588 Bbr_1111 Bbr_1880 Bbr_0101 Bbr_1892 Blon_2183 Blon_2331 Blon_0342 Blon_2015 Blon_2177 Blon_2176...”
HMPREF0424_1297 ABC transporter, permease protein from Gardnerella vaginalis 409-05
26% identity, 94% coverage
- Lactobacillus helveticus HY7801 ameliorates bacterial vaginosis by inhibiting biofilm formation and epithelial cell adhesion of Gardnerella vaginalis
Kim, Food science and biotechnology 2023 - “...(HMPREF0424_0821) F: CAACGAAGGCATAGGTTTCC R: GCGCTTGGAACTGCTTTAAC Biofilm formation atm (HMPREF0424_1253) F: ACTTGGCCGTTCACTTTCCA R: AGCCACATACCAACCTGCTC Metabolism stp (HMPREF0424_1297) F: TGGCTGTTATTGCTATCTACTTCA R: CTTCCAGAATACTTGCCACTTTGT Metabolism Statistical analyses Statistical results for in vitro and in vivo animal experiments are presented as meanstandard deviation at the 95% confidence. Data were statistically compared...”
- Probiotic Lactobacillus sp. Strains Inhibit Growth, Adhesion, Biofilm Formation, and Gene Expression of Bacterial Vaginosis-Inducing Gardnerella vaginalis
Qian, Microorganisms 2021 - “...adhesion ( HMPREF0424_0125 ( pat )), biofilm formation ( HMPREF0424_0821 ( gtf )), metabolism ( HMPREF0424_1297 ( stp ), HMPREF0424_1253 ( atm ), and HMPREF0424_1189 ( itm )), and antimicrobial resistance ( HMPREF0424_0156 ( bcrA ) and HMPREF0424_1122 ( mds )), by reverse transcription PCR, according...”
- “...0.36* 0.0001* Biofilm formation HMPREF0424_0821 ( gtf ) 2.08* 0.29* 0.07* 0.27* 0.25* 0.17* Metabolism HMPREF0424_1297 ( stp ) 2.21* 1.57 0.17* 0.38* 0.11* 0.04* HMPREF0424_1253 ( atm ) 1.51 0.87 0.19* 2.08* 0.89 0.17* HMPREF0424_1189 ( itm ) 1.87 0.97 0.08* 0.72 0.72 0.07* Antimicrobial...”
TC 3.A.1.1.5 / O30833 SmoG, component of Hexitol (glucitol; mannitol) porter from Rhodobacter sphaeroides (Rhodopseudomonas sphaeroides) (see paper)
30% identity, 84% coverage
ACPL_5386 carbohydrate ABC transporter permease from Actinoplanes sp. SE50/110
28% identity, 86% coverage
PH1216 hypothetical protein from Pyrococcus horikoshii OT3
28% identity, 86% coverage
SpyM3_0985 putative maltose/maltodextrin ABC transport system (permease) from Streptococcus pyogenes MGAS315
SPy1296 putative maltose/maltodextrin ABC transport system (permease) from Streptococcus pyogenes M1 GAS
M5005_Spy_1060 maltose transport system permease protein from Streptococcus pyogenes MGAS5005
M28_Spy1041 maltose transport system permease protein from Streptococcus pyogenes MGAS6180
SPy_1296 sugar ABC transporter permease from Streptococcus pyogenes M1 GAS
26% identity, 86% coverage
- A Single Amino Acid Replacement in the Sensor Kinase LiaS Contributes to a Carrier Phenotype in Group A Streptococcus
Flores, Infection and immunity 2015 - “...2.5 1.0E23 1.0E23 5.8E09 1.0E11 5.6E11 Downregulated SpyM3_1799 SpyM3_0985 SpyM3_0014 SpyM3_0984 SpyM3_0375 spxA2 malG malF rnc 3.8 2.4 2.4 2.3 2.3 1.0E38...”
- Adaptation of group A Streptococcus to human amniotic fluid
Sitkiewicz, PloS one 2010 - “...Maltodextrin phosphorylase M28_Spy1037 SPy1292 malM 14.96 4-alpha-glucanotransferase M28_Spy1039 SPy1294 malE 4.94 Maltose maltodextrin-binding protein M28_Spy1041 SPy1296 malG 2.19 Maltose transport system permease protein M28_Spy1044 SPy1299 malD 34.73 Maltodextrin transport system permease protein M28_Spy1045 SPy1301 malC 38.81 Maltodextrin transport system permease protein M28_Spy1046 SPy1302 amyA 82.63 Cyclodextrin...”
- Regulation of polysaccharide utilization contributes to the persistence of group a streptococcus in the oropharynx
Shelburne, Infection and immunity 2007 - “...located in the gene region from M5005_Spy_1055 to M5005_Spy_1060 (Fig. 1). This region includes M5005_Spy_ 1058 (malE), a gene encoding a maltodextrin binding...”
- “...to the region comprising the genes M5005_Spy_1055 to M5005_Spy_1060 as the maltodextrin gene region and the region comprising the genes M5005_Spy_1680 to...”
- Adaptation of group A Streptococcus to human amniotic fluid
Sitkiewicz, PloS one 2010 - “...2.16 Maltodextrin phosphorylase M28_Spy1037 SPy1292 malM 14.96 4-alpha-glucanotransferase M28_Spy1039 SPy1294 malE 4.94 Maltose maltodextrin-binding protein M28_Spy1041 SPy1296 malG 2.19 Maltose transport system permease protein M28_Spy1044 SPy1299 malD 34.73 Maltodextrin transport system permease protein M28_Spy1045 SPy1301 malC 38.81 Maltodextrin transport system permease protein M28_Spy1046 SPy1302 amyA 82.63...”
- The role of CopA in Streptococcus pyogenes copper homeostasis and virulence
Dao, Journal of inorganic biochemistry 2023 - “...3-fold), belonged to the PTS family of transporters, while the maltose import pathway genes, SPy_1294, SPy_1296, and SPy_1297, were also upregulated (11.3-fold) ( Table S5 ). The putative PTS genes are predicted to encode a carbohydrate-uptake system with specificity for mannose, maltose, fructose, or N -acetylgalactosamine....”
GGTD_SYNY3 / Q55473 Osmoprotective compounds uptake permease protein GgtD from Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa) (see paper)
TC 3.A.1.1.32 / Q55473 Membrane bound sugar transport protein, component of The glucosylglycerol uptake transporter (functions in osmoprotection and also transports sucrose and trehalose (Mikkat and Hagemann, 2000) (most similar to 3.A.1.1.8) from Synechocystis sp. (strain PCC 6803) (see paper)
slr0531 membrane bound sugar transport protein from Synechocystis sp. PCC 6803
29% identity, 84% coverage
- function: Part of the ABC transporter complex GgtABCD involved in the uptake of the osmoprotective compounds glucosylglycerol (GG), sucrose and trehalose (PubMed:11081796). Responsible for the translocation of the substrate across the membrane (Probable).
subunit: The complex is composed of two ATP-binding proteins (GgtA), two transmembrane proteins (GgtC and GgtD) and a solute-binding protein (GgtB).
disruption phenotype: Inactivation of the gene results in loss of the ability to take up glucosylglycerol and sucrose, as well as to accumulate exogenous trehalose. Insertion causes leakage of glucosylglycerol from the cells into the medium. - substrates: Glucosylglycerol
- A global transcriptional activator involved in the iron homeostasis in cyanobacteria
Liu, Science advances 2024 - “...transport system ATP-binding protein Motif-1, -2 slr0043 , CmpC, bicarbonate transport system ATP-binding protein Others slr0531 , GgtD, glucosylglycerol transport system per mease protein Motif-2 slr0977 , RfbA, ABC transporter, permease component Others slr2108 , RfbB, polysaccharide ABC transporter ATP binding Others Amino acid transportrelated slr0467...”
- Integrative analysis of the salt stress response in cyanobacteria
Klähn, Biology direct 2021 - “...a list of 1803 proteins, to which two membrane proteins were appended that are known (Slr0531) or suspected (Sll1037) to be important for salt acclimation, but were identified by individual peptides only. As a final result, 190 proteins were up-regulated and 189 protein down-regulated 7days after...”
- “...transporter (GgtA) 1.83 2.43 2 slr0529 Substrate-binding subunit of GG transporter (GgtB) 1.33 1.48 2 slr0531 Integral membrane protein of GG transporter (GgtD) 2.02 2.13 2 slr1670 Glucosylglycerol degrading enzyme (GghA) 1.89 2.95 2 sll0045 Sucrose-phosphate synthase (Sps) 1.22 0.46 2 slr0953 Sucrose-phosphate phosphatase (Spp) 1.04...”
- Computational prediction of the osmoregulation network in Synechococcus sp. WH8102
Mao, BMC genomics 2010 - “...synthetase slr1312 SpeA Arginine synthetase slr0662 SpeA slr0747 GgtA Glucosylglycerol/trehalose/sucrose slr0529 GgtB transporter slr0530 GgtC slr0531 GgtD sll1546 GgpS Glucosylglycerol synthetases slr0746 GgpP sll0306 RpoD RNA polymerase, Sigma 70 (sigma D) factor A. halo has three genes encoding a Na + /H + antiporter to export...”
- “...GgpP SYNW0860 PCC6803 slr0747 GgtA SYNW1285 SYNW1279-1286 0.99 PCC6803 slr0530 GgtC SYNW1283 SYNW1279-1286 0.99 PCC6803 slr0531 GgtD SYNW1284 SYNW1279-1286 0.99 PCC6803 ABX75857 GpgS SYNW2436 P.marina ABX75858 GpgP SYNW2434 P.marina slr0662 SpeA SYNW2359 0.99 PCC6803 sll0045 Sps SYNW2520 0.69 PCC6803 b0855 PotG SYNW1544 0.99 E. coli YP_225044...”
- A novel Sinorhizobium meliloti operon encodes an alpha-glucosidase and a periplasmic-binding-protein-dependent transport system for alpha-glucosides
Willis, Journal of bacteriology 1999 - “...LacK (66) Bacillus coagulans oligo-1,6-glucosidase (65) Synechocystis Slr0531 (35, 37) Synechocystis Slr0530 (35, 37) Synechocystis Slr0529 (35, 37) Escherichia...”
- “...that the uncharacterized Synechocystis proteins Slr0529, Slr0530, and Slr0531 are involved in sugar transport. Sucrose and trehalose are known to be transported...”
SCO3482 sugar-permease from Streptomyces coelicolor A3(2)
27% identity, 94% coverage
- LacI-Family Transcriptional Regulator DagR Acts as a Repressor of the Agarolytic Pathway Genes in Streptomyces coelicolor A3(2)
Tsevelkhoroloo, Frontiers in microbiology 2021 - “...the genes assumed to be related to AHG metabolism, and the sugar transporter-associated gene ( sco3482 - 3484 ), which exists in the central region of the agarolytic pathway gene cluster, were all significantly increased. Thus, same expression pattern for all of genes in this cluster...”
- Transcriptomic analysis of a classical model of carbon catabolite regulation in Streptomyces coelicolor
Romero-Rodríguez, BMC microbiology 2016 - “...maltose transporter malG and malF genes ( SCO2229 - SCO2230 ) and the putative operon SCO3482 - SCO3484 (coding for a sugar permease, an integral membrane transport protein and a sugar-binding protein) were repressed (Fig. 4b ). It is noteworthy mentioning that only a limited number...”
- “...are described. Interestingly, in this study, a possible transporter associated with neoagarobiose incorporation (encoded by SCO3482 - 84 ), was found (Fig. 6c ). Since this chromosomal region is implicated in agar metabolism, genes SCO3482 - 84 showed the same expression pattern observed for agarases and...”
- Genome-wide transcriptomic analysis of the response to nitrogen limitation in Streptomyces coelicolor A3(2)
Lewis, BMC research notes 2011 - “...with the co-expressed SCO3472 (a transposase remnant). A glycosyltransferase homologue SCO3481 and a sugar permease (SCO3482) are also presumably expressed as an operon. The down regulation of these carbohydrate metabolism genes in the carbon limited culture may be a response to lack of substrate, however, we...”
B1745_06745 sugar ABC transporter permease from Lactobacillus amylolyticus
30% identity, 87% coverage
- Adaptive mechanism of Lactobacillus amylolyticus L6 in soymilk environment based on metabolism of nutrients and related gene-expression profiles
Fei, Food science & nutrition 2022 - “...(Table 2 ). However, several genes involved in sucrose transportation, especially sugar ABC transporters (B1745_06760, B1745_06745 and B1745_06745), and galactose metabolism (B1745_05485 and B1745_05490) were significantly downregulated in logarithmic phase. Microbes intend to utilize easily metabolizable carbohydrate and inhibit the metabolism of the other carbohydrate by...”
- “...protein 1.36 B1745_02355 acyP acylphosphatase 1.50 B1745_06765 pgmB betaphosphoglucomutase 1.61 B1745_06730 gpmB hypothetical protein 2.38 B1745_06745 ganQ sugar ABC transporter permease 2.58 B1745_06750 ganP sugar ABC transporter permease 2.79 Amino acids transport and metabolism B1745_01435 rpoA DNAdirected RNA polymerase subunit alpha 1.02 B1745_02350 yidC insertase 1.07...”
LBA1864 maltose ABC transporter permease protein from Lactobacillus acidophilus NCFM
29% identity, 87% coverage
OEOE_RS07040 carbohydrate ABC transporter permease from Oenococcus oeni PSU-1
29% identity, 74% coverage
- Transcriptomic and Proteomic Analysis of Oenococcus oeni Adaptation to Wine Stress Conditions
Margalef-Català, Frontiers in microbiology 2016 - “...II: OEOE_RS03595 (amino acid ABC transporter substrate-binding protein); Profile III: OEOE_RS05245 (oligoendopeptidase F); Profile IV: OEOE_RS07040 (glycerol-3-phosphate ABC transporter permease); Profile V: OEOE_RS03155 (F0F1 ATP synthase subunit A); Profile VI: OEOE_RS01045 (PTS sugar transporter subunit IIA). Proteomic analysis of O. oeni PSU-1 adaptation to WLM conditions...”
- “...Glycerol-3-phosphate ABC transporter permease OEOE_RS07035 0.90 1.36 1.53 1.65 1.72 1.76 Glycerol-3-phosphate ABC transporter permease OEOE_RS07040 1.03 1.54 1.64 1.81 2.01 1.93 Glycerol-3-phosphate ABC transporter substrate-binding protein OEOE_RS07045 1.16 1.47 1.86 2.13 2.20 2.22 UDP-phosphate galactose phosphotransferase OEOE_RS07255 1.98 1.96 1.96 2.01 1.94 1.96 Ribokinase OEOE_RS07775...”
LMH90_004135 sn-glycerol-3-phosphate ABC transporter permease UgpE from Enterobacter hormaechei
26% identity, 88% coverage
SGO_0102 Maltodextrin transport system permease protein malD from Streptococcus gordonii str. Challis substr. CH1
28% identity, 85% coverage
PGA1_c13190 ABC transporter for D-Sorbitol, permease component 1 from Phaeobacter inhibens DSM 17395
30% identity, 84% coverage
- mutant phenotype: Specific phenotypes on D-Sorbitol; D-Sorbitol.
BBPR_1056 carbohydrate ABC transporter permease from Bifidobacterium bifidum PRL2010
29% identity, 83% coverage
- Variation in the Conservation of Species-Specific Gene Sets for HMO Degradation and Its Effects on HMO Utilization in Bifidobacteria
, Nutrients 2024 - “...genes encoded by the lnp cluster. However, one permease subunit of the ABC transporter (gltB, BBPR_1056) has been shown to be frequently absent (6 out of 10 strains) [ 48 , 86 ], and this genotype was assumed to be associated with reduced growth on mucin...”
- “...14 strains tested here, including JCM1255 T , encoded BBPR_1056. Moreover, in these 2 studies, BBPR_1056 was shown to be both absent [ 48 ] and present [ 86 ] in JCM1255 T . We currently do not have an explanation for the significant discrepancies in...”
- Analysis of predicted carbohydrate transport systems encoded by Bifidobacterium bifidum PRL2010
Turroni, Applied and environmental microbiology 2012 - “...IIC BBPR_0145 BBPR_0366 BBPR_0561 BBPR_1074 BBPR_1056 BBPR_1057 BBPR_1058 BBPR_1353 BBPR_1399 BBPR_1459 BBPR_1508 4.A.3: the PTS...”
- “...putative carbohydrate uptake ABC-type systems (represented by BBPR_1056 to BBPR_1058, BBPR_1353BBPR_1354, and BBPR_1356), made up of genes encoding three SBPs...”
- Physiology of consumption of human milk oligosaccharides by infant gut-associated bifidobacteria
Asakuma, The Journal of biological chemistry 2011 - “...10, 2017 genomic analysis that the absence of BBPR_1056 (an integral membrane protein of the GNB/LNB transporter) correlates with a reduced growth on mucin...”
- Genome analysis of Bifidobacterium bifidum PRL2010 reveals metabolic pathways for host-derived glycan foraging
Turroni, Proceedings of the National Academy of Sciences of the United States of America 2010 - “...absence of two genes encoding a putative carbohydrate transporter (BBPR_1056) and a predicted fucosidase of mucin as the sole carbon source, and a portion of...”
Ac3H11_794 ABC transporter for Glycerol, permease component 2 from Acidovorax sp. GW101-3H11
25% identity, 84% coverage
- mutant phenotype: Specific phenotype on Glycerol.
DR0563 maltose ABC transporter, permease protein from Deinococcus radiodurans R1
32% identity, 45% coverage
LMOf2365_0269 sugar ABC transporter, permease protein from Listeria monocytogenes str. 4b F2365
27% identity, 83% coverage
N186_RS07245 carbohydrate ABC transporter permease from Thermofilum adornatum
24% identity, 91% coverage
TP0076 sugar ABC transporter, permease protein (y4oR) from Treponema pallidum subsp. pallidum str. Nichols
32% identity, 83% coverage
- Characterizing the Syphilis-Causing Treponema pallidum ssp. pallidum Proteome Using Complementary Mass Spectrometry
Osbak, PLoS neglected tropical diseases 2016 - “...filament outer layer protein FlaA; Tromp-2 27 7.5 13.9 Bacterial-type flagellum-dependent cell motility Flagellum none TP0076 R9UUX9 Sugar ABC superfamily ATP binding cassette transporter, membrane protein 30 7.4 0.4 Transport Inner membrane G TP1029 R9UY97 Uncharacterized protein 25 7.4 0.9 Unknown none TP0249 R9UVD9 Flagellar filament...”
- Footprint of positive selection in Treponema pallidum subsp. pallidum genome sequences suggests adaptive microevolution of the syphilis pathogen
Giacani, PLoS neglected tropical diseases 2012 - “...chain release factor 1, PrfA F S (104)P (104) T (59887)C (59897) 351 351 TPChic0076 TP0076 Sugar ABC transporter, permease protein F L (198)V (198) C (83983)G (83994) 276 273 TPChic0265 TP0265 Branched-chain amino acid transport system II carrier protein, BrnQ R P (230)L (230) G...”
- “...release factor 1 (PrfA)/Transcriptional regulator- DNA binding protein S (104)P (104) C C N TPChic0076 TP0076 Sugar ABC transporter, permease protein/Membrane-Transport L (198)V (198) C C N TPChic0265 TP0265 Amino acid ABC transporter, permease protein (BfnQ)/Membrane-Transport P (230)L (230) C C N TPChic0299 TP0300 Ribose, galactose...”
- Complete genome sequence of Treponema pallidum ssp. pallidum strain SS14 determined with oligonucleotide arrays
Matejková, BMC microbiology 2008 - “...this region b 1 TP0012 37 390 12322 12711 3 nt deletion - - 2 TP0076 29 529 83788 84316 - 1 solitary SNP - 3 TP0117 86 699 134808 135506 7 clustered SNPs - - 4 TP0117 86 3 clustered SNPs - - 5 TP0126...”
TC 3.A.1.1.26 / O06991 MalG aka yvdI, component of The maltose porter, MdxEFG and MsmX from Bacillus subtilis (see 2 papers)
26% identity, 88% coverage
- substrates: Maltose
- The MsmX ATPase plays a crucial role in pectin mobilization by Bacillus subtilis
Ferreira, PloS one 2017 - “...C-terminal end of AraQ are boxed. Accession numbers: AraP (P94529), AraQ (P94530), MdxF (O06990), MdxG (O06991), GanP (O32261), GanQ (O07011), OpuAB (P46921), MalF (P02916), and MalG (P68183). 10.1371/journal.pone.0189483.t008 Table 8 Effect of mutations in AraP and AraQ in the uptake of -1,5-arabinotriose. Doubling time (min) of...”
LACR_1855 ABC-type maltose transport system, permease component from Lactococcus lactis subsp. cremoris SK11
29% identity, 83% coverage
G9MB86 ABC-type glycerol 3-phosphate transporter (subunit 1/3) (EC 7.6.2.10) from Thermus thermophilus (see paper)
28% identity, 79% coverage
blr3568 ABC transporter permease protein from Bradyrhizobium japonicum USDA 110
23% identity, 81% coverage
- Growth Rate of and Gene Expression in Bradyrhizobium diazoefficiens USDA110 due to a Mutation in blr7984, a TetR Family Transcriptional Regulator Gene
Ohkama-Ohtsu, Microbes and environments 2016 - “...blr7984 mutant cells ( Table 2 ). Five genes induced in the cluster, blr3566, blr3567, blr3568, blr3570, and blr3571, encoded proteins for ABC transport systems, which uptake substances in cells using energy from ATP hydrolysis. Three genes, blr3573, blr3574, and blr3575, induced in the cluster encode...”
- “...transporter substrate-binding protein 24.3 B blr3567 ABC transporter permease 22.2 B bll7982 hypothetical protein 20.3 blr3568 ABC transporter permease 19.5 B bll7981 dehydrogenase 18.2 blr3571 ABC transporter ATP-binding protein 17.4 B bsr3569 hypothetical protein 16.7 B blr3575 phosphoenolpyruvate-protein phosphotransferase 12.6 B blr3570 ABC transporter ATP-binding protein...”
RPPS3_35020 carbohydrate ABC transporter permease from Rhodopseudomonas palustris
28% identity, 99% coverage
- Whole-genome sequencing and comparative analysis of two plant-associated strains of Rhodopseudomonas palustris (PS3 and YSC3)
Lo, Scientific reports 2018 - “...glucose. In addition, there are genes encoding multiple sugar ABC transport systems (RPPS3_01220, RPPS3_01230, RPPS3_033890, RPPS3_35020, RPPS3_35050, RPPS3_35450, RPPS3_43670, RPPS3_45360, RPYSC3_01220, RPYSC3_01230, RPYSC3_35200, RPYSC3_35230, RPYSC3_35650, RPYSC3_44090 and RPYSC3_45830) and TonB-dependent transporters in the R. palustris genomes (Supplementary Tables S5 and S6 ). TonB-dependent transporters have been...”
SSU1171 binding-protein-dependent transport system membrane protein from Streptococcus suis P1/7
27% identity, 85% coverage
- Capsular polysaccharide switching in Streptococcus suis modulates host cell interactions and virulence
Okura, Scientific reports 2021 - “...within genes were found in the genes corresponding to the SS2 locus tags SSU0496, SSU1127, SSU1171, and SSU1172. Detailed data on mutated genes can be found in Supplementary Table S2 . Below the bottom panel are displayed the descriptions for each color of the different drawings....”
- FlpS, the FNR-Like Protein of Streptococcus suis Is an Essential, Oxygen-Sensing Activator of the Arginine Deiminase System
Willenborg, Pathogens (Basel, Switzerland) 2016 - “...to carbohydrate transport ( SSU0165-0167 , SSU1234 ), carbohydrate conversions ( SSU0676 , glgABP , SSU1171 , SSU1230 , SSU1214 ) and metabolism ( ldh , eno ). The majority of genes were regulated in only one growth phase for each mutant strain, indicating that each...”
B9H01_RS10265 sugar ABC transporter permease from Streptococcus suis
26% identity, 90% coverage
NP_463092 maltose transport protein from Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
27% identity, 90% coverage
For advice on how to use these tools together, see
Interactive tools for functional annotation of bacterial genomes.
The PaperBLAST database links 793,807 different protein sequences to 1,259,118 scientific articles. Searches against EuropePMC were last performed on March 13 2025.
PaperBLAST builds a database of protein sequences that are linked
to scientific articles. These links come from automated text searches
against the articles in EuropePMC
and from manually-curated information from GeneRIF, UniProtKB/Swiss-Prot,
BRENDA,
CAZy (as made available by dbCAN),
BioLiP,
CharProtDB,
MetaCyc,
EcoCyc,
TCDB,
REBASE,
the Fitness Browser,
and a subset of the European Nucleotide Archive with the /experiment tag.
Given this database and a protein sequence query,
PaperBLAST uses protein-protein BLAST
to find similar sequences with E < 0.001.
To build the database, we query EuropePMC with locus tags, with RefSeq protein
identifiers, and with UniProt
accessions. We obtain the locus tags from RefSeq or from MicrobesOnline. We use
queries of the form "locus_tag AND genus_name" to try to ensure that
the paper is actually discussing that gene. Because EuropePMC indexes
most recent biomedical papers, even if they are not open access, some
of the links may be to papers that you cannot read or that our
computers cannot read. We query each of these identifiers that
appears in the open access part of EuropePMC, as well as every locus
tag that appears in the 500 most-referenced genomes, so that a gene
may appear in the PaperBLAST results even though none of the papers
that mention it are open access. We also incorporate text-mined links
from EuropePMC that link open access articles to UniProt or RefSeq
identifiers. (This yields some additional links because EuropePMC
uses different heuristics for their text mining than we do.)
For every article that mentions a locus tag, a RefSeq protein
identifier, or a UniProt accession, we try to select one or two
snippets of text that refer to the protein. If we cannot get access to
the full text, we try to select a snippet from the abstract, but
unfortunately, unique identifiers such as locus tags are rarely
provided in abstracts.
PaperBLAST also incorporates manually-curated protein functions:
- Proteins from NCBI's RefSeq are included if a
GeneRIF
entry links the gene to an article in
PubMed®.
GeneRIF also provides a short summary of the article's claim about the
protein, which is shown instead of a snippet.
- Proteins from Swiss-Prot (the curated part of UniProt)
are included if the curators
identified experimental evidence for the protein's function (evidence
code ECO:0000269). For these proteins, the fields of the Swiss-Prot entry that
describe the protein's function are shown (with bold headings).
- Proteins from BRENDA,
a curated database of enzymes, are included if they are linked to a paper in PubMed
and their full sequence is known.
- Every protein from the non-redundant subset of
BioLiP,
a database
of ligand-binding sites and catalytic residues in protein structures, is included. Since BioLiP itself
does not include descriptions of the proteins, those are taken from the
Protein Data Bank.
Descriptions from PDB rely on the original submitter of the
structure and cannot be updated by others, so they may be less reliable.
(For SitesBLAST and Sites on a Tree, we use a larger subset of BioLiP so that every
ligand is represented among a group of structures with similar sequences, but for
PaperBLAST, we use the non-redundant set provided by BioLiP.)
- Every protein from EcoCyc, a curated
database of the proteins in Escherichia coli K-12, is included, regardless
of whether they are characterized or not.
- Proteins from the MetaCyc metabolic pathway database
are included if they are linked to a paper in PubMed and their full sequence is known.
- Proteins from the Transport Classification Database (TCDB)
are included if they have known substrate(s), have reference(s),
and are not described as uncharacterized or putative.
(Some of the references are not visible on the PaperBLAST web site.)
- Every protein from CharProtDB,
a database of experimentally characterized protein annotations, is included.
- Proteins from the CAZy database of carbohydrate-active enzymes
are included if they are associated with an Enzyme Classification number.
Even though CAZy does not provide links from individual protein sequences to papers,
these should all be experimentally-characterized proteins.
- Proteins from the REBASE database
of restriction enzymes are included if they have known specificity.
- Every protein with an evidence-based reannotation (based on mutant phenotypes)
in the Fitness Browser is included.
- Sequence-specific transcription factors (including sigma factors and DNA-binding response regulators)
with experimentally-determined DNA binding sites from the
PRODORIC database of gene regulation in prokaryotes.
- Putative transcription factors from RegPrecise
that have manually-curated predictions for their binding sites. These predictions are based on
conserved putative regulatory sites across genomes that contain similar transcription factors,
so PaperBLAST clusters the TFs at 70% identity and retains just one member of each cluster.
- Coding sequence (CDS) features from the
European Nucleotide Archive (ENA)
are included if the /experiment tag is set (implying that there is experimental evidence for the annotation),
the nucleotide entry links to paper(s) in PubMed,
and the nucleotide entry is from the STD data class
(implying that these are targeted annotated sequences, not from shotgun sequencing).
Also, to filter out genes whose transcription or translation was detected, but whose function
was not studied, nucleotide entries or papers with more than 25 such proteins are excluded.
Descriptions from ENA rely on the original submitter of the
sequence and cannot be updated by others, so they may be less reliable.
Except for GeneRIF and ENA,
the curated entries include a short curated
description of the protein's function.
For entries from BioLiP, the protein's function may not be known beyond binding to the ligand.
Many of these entries also link to articles in PubMed.
For more information see the
PaperBLAST paper (mSystems 2017)
or the code.
You can download PaperBLAST's database here.
Changes to PaperBLAST since the paper was written:
- November 2023: incorporated PRODORIC and RegPrecise. Many PRODORIC entries were not linked to a protein sequence (no UniProt identifier), so we added this information.
- February 2023: BioLiP changed their download format. PaperBLAST now includes their non-redundant subset. SitesBLAST and Sites on a Tree use a larger non-redundant subset that ensures that every ligand is represented within each cluster. This should ensure that every binding site is represented.
- June 2022: incorporated some coding sequences from ENA with the /experiment tag.
- March 2022: incorporated BioLiP.
- April 2020: incorporated TCDB.
- April 2019: EuropePMC now returns table entries in their search results. This has expanded PaperBLAST's database, but most of the new entries are of low relevance, and the resulting snippets are often just lists of locus tags with annotations.
- February 2018: the alignment page reports the conservation of the hit's functional sites (if available from from Swiss-Prot or UniProt)
- January 2018: incorporated BRENDA.
- December 2017: incorporated MetaCyc, CharProtDB, CAZy, REBASE, and the reannotations from the Fitness Browser.
- September 2017: EuropePMC no longer returns some table entries in their search results. This has shrunk PaperBLAST's database, but has also reduced the number of low-relevance hits.
Many of these changes are described in Interactive tools for functional annotation of bacterial genomes.
PaperBLAST cannot provide snippets for many of the papers that are
published in non-open-access journals. This limitation applies even if
the paper is marked as "free" on the publisher's web site and is
available in PubmedCentral or EuropePMC. If a journal that you publish
in is marked as "secret," please consider publishing elsewhere.
Many important articles are missing from PaperBLAST, either because
the article's full text is not in EuropePMC (as for many older
articles), or because the paper does not mention a protein identifier such as a locus tag, or because of PaperBLAST's heuristics. If you notice an
article that characterizes a protein's function but is missing from
PaperBLAST, please notify the curators at UniProt
or add an entry to GeneRIF.
Entries in either of these databases will eventually be incorporated
into PaperBLAST. Note that to add an entry to UniProt, you will need
to find the UniProt identifier for the protein. If the protein is not
already in UniProt, you can ask them to create an entry. To add an
entry to GeneRIF, you will need an NCBI Gene identifier, but
unfortunately many prokaryotic proteins in RefSeq do not have
corresponding Gene identifers.
References
PaperBLAST: Text-mining papers for information about homologs.
M. N. Price and A. P. Arkin (2017). mSystems, 10.1128/mSystems.00039-17.
Europe PMC in 2017.
M. Levchenko et al (2017). Nucleic Acids Research, 10.1093/nar/gkx1005.
Gene indexing: characterization and analysis of NLM's GeneRIFs.
J. A. Mitchell et al (2003). AMIA Annu Symp Proc 2003:460-464.
UniProt: the universal protein knowledgebase.
The UniProt Consortium (2016). Nucleic Acids Research, 10.1093/nar/gkw1099.
BRENDA in 2017: new perspectives and new tools in BRENDA.
S. Placzek et al (2017). Nucleic Acids Research, 10.1093/nar/gkw952.
The EcoCyc database: reflecting new knowledge about Escherichia coli K-12.
I. M. Keeseler et al (2016). Nucleic Acids Research, 10.1093/nar/gkw1003.
The MetaCyc database of metabolic pathways and enzymes.
R. Caspi et al (2018). Nucleic Acids Research, 10.1093/nar/gkx935.
CharProtDB: a database of experimentally characterized protein annotations.
R. Madupu et al (2012). Nucleic Acids Research, 10.1093/nar/gkr1133.
The carbohydrate-active enzymes database (CAZy) in 2013.
V. Lombard et al (2014). Nucleic Acids Research, 10.1093/nar/gkt1178.
The Transporter Classification Database (TCDB): recent advances
M. H. Saier, Jr. et al (2016). Nucleic Acids Research, 10.1093/nar/gkv1103.
REBASE - a database for DNA restriction and modification: enzymes, genes and genomes.
R. J. Roberts et al (2015). Nucleic Acids Research, 10.1093/nar/gku1046.
Deep annotation of protein function across diverse bacteria from mutant phenotypes.
M. N. Price et al (2016). bioRxiv, 10.1101/072470.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory