PaperBLAST

PaperBLAST Hits for TCDB::Q9VSV1 Scratch, orthologue 1, SCRT; SLC45A2; transports sucrose into pigment-containing vesicles or granules (Drosophila melanogaster) (599 a.a., MVGVTADASQ...)

Show query sequence

>TCDB::Q9VSV1 Scratch, orthologue 1, SCRT; SLC45A2; transports sucrose into pigment-containing vesicles or granules (Drosophila melanogaster)
MVGVTADASQANQLSSVRNPMIKYMLKTRENHAREQDRDYSHVFRRKTRFEMFRLSAIAM
AIEFAYAAETSFVSPILLQIGVDHKHMSMTWGLSPLIGFFMSPLLGSISDRCKLRWGRRR
PIISILSFGIMCGLILVPYGKDLGLLLGDAGYTYAESALNFTSSSGGSVAALVSGEATTG
PSASDYKFAVILTILGMVLLDFDADTCQTPARTYLLDMCVPEEQPKAMTMFALFAGFGGT
IGYAIGGVDWETTHIGSFMGGNIPTVFTLVTIIFAVCYLITVTTFREIPLPLIEQDELLR
PLSEQAIKKELKKKNNTIYYIQETTQLELQMASDDPKRLEALQGSYQNGYSPAVEKQGKS
QDLETQSDYDAPVSLKAYLKSIFIMPYSMRMLALTNLFCWMGHVTYCLYFTDFVGEAVFH
GDPTAAPNSEAALNYEAGVRFGCWGMAIYAFSCSIYSLSVTKLMKWFGTKAVYISGMIYY
GIGMLVLGLWPTKWGVLVFSTSAGILYGTIFTVPFILVARYHAKNCFSIKNGEIVPLKQA
RGLGTDVAIISSMVFIAQLIVSLSVGPLVSWMDTTCAVLYASTFLSFLAAIAAMFVLYV

Running BLASTp...

Found 105 similar proteins in the literature:

TC 2.A.2.4.13 / Q9VSV1 Scratch, orthologue 1, SCRT; SLC45A2; transports sucrose into pigment-containing vesicles or granules from Drosophila melanogaster
100% identity, 100% coverage

• substrates: Sucrose
  tcdb comment: Mutations give rise to oculocutaneous albinism (Meyer et al. 2011)

NP_001303415 loss of visual transmission from Drosophila melanogaster
45% identity, 93% coverage

• LOVIT Is a Putative Vesicular Histamine Transporter Required in Drosophila for Vision.
  Xu, Cell reports 2019 (PubMed)
  • GeneRIF: LOVIT is a photoreceptor synaptic-vesicle histamine transporter. Loss of LOVIT in Drosophila photoreceptors impairs visual transmission.

S45A2_MOUSE / P58355 Membrane-associated transporter protein; Melanoma antigen AIM1; Protein AIM-1; Protein underwhite; Solute carrier family 45 member 2 from Mus musculus (Mouse) (see 4 papers)
TC 2.A.2.4.14 / P58355 Melanocyte-specific antigen or melanoma antigen, MatP, Slc45a2, Aim-1, AIM1, at the mouse underwhite locus from Mus musculus
NP_444307 membrane-associated transporter protein from Mus musculus
30% identity, 96% coverage

• function: Proton-associated glucose and sucrose transporter (PubMed:25164149, PubMed:35469906). May be able to transport also fructose (PubMed:25164149). Expressed at a late melanosome maturation stage where functions as a proton/glucose exporter which increase lumenal pH by decreasing glycolysis (PubMed:32966160, PubMed:35469906). Regulates melanogenesis by maintaining melanosome neutralization that is initially initiated by transient OCA2 and required for a proper function of the tyrosinase TYR (PubMed:32966160, PubMed:35469906).
  catalytic activity: sucrose(out) + H(+)(out) = sucrose(in) + H(+)(in) (RHEA:72187)
  catalytic activity: D-glucose(out) + H(+)(out) = D-glucose(in) + H(+)(in) (RHEA:69556)
  subunit: Interacts with TYRP1.
  disruption phenotype: Mutant mice have clear white fur with red and transparent eyes without melanin in the retinal pigment epithelium chorioid.
• substrates: Sucrose
  tcdb comment: Regulated by a melanocyte-specific transcription factor essential for pigmentation, MITF (Du and Fisher 2002). Mutations in MatP in humans cause oculocutaneous albinism type IV (OCA4), an autosomal recessive inherited disorder which is characterized by reduced biosynthesis of melanin pigmentation in skin, hair and eyes. The MATP protein consists of 530 amino acids which contains 12 TMSs (Kamaraj and Purohit 2016). The D93N mutation causes oculocutaneous albinism 4 (OCA4), and the L374F mutatioin correlates with light pigmentation in European populations. Corresponding mutations were produced in the related and well-characterized sucrose transporter from rice, OsSUT1, and transport activity was measured by heterologous expression in Xenopus laevis oocytes and 14C-sucrose uptake in yeast. The D93N mutant had completly lost transport activity while the L374F mutant showed a 90% decrease in transport activity, although the substrate affinity was unaffected (Kamaraj and Purohit 2016). Mutations in MATP protein showed loss of stability and became more flexible, which alter its structural conformation and function (Kamaraj and Purohit 2016)
• Proton-associated sucrose transport of mammalian solute carrier family 45: an analysis in Saccharomyces cerevisiae.
  Bartölke, The Biochemical journal 2014 (PubMed)
  • GeneRIF: mRNA expression of SLC45A2 in eyes and skin and of SLC45A3 primarily in the prostate, but also in other tissues, whereas SLC45A4 showed a predominantly ubiquitous expression

Q566F3 MGC114950 protein from Xenopus laevis
32% identity, 88% coverage

• Engineered Tug-of-War Between Kinesin and Dynein Controls Direction of Microtubule Based Transport In Vivo
  Rezaul, Traffic (Copenhagen, Denmark) 2016
  • “...0.0014179 Q5VKN7 tyr Tyrosinase 28,881 5.2 7 0.0012346 Q7SY95 cd63 CD63 25,758 7.37 6 0.0010582 Q566F3 slc45a2 Solute carrier family 45, member 2 60,310 6.32 4 0.0007055 Q640Z0 bloc1s1 Biogenesis of lysosomal organelles complex-1, subunit 1 14,270 8.89 3 0.0005291 Q0IHH8 gpr143 G protein-coupled receptor 143...”

S45A2_HUMAN / Q9UMX9 Membrane-associated transporter protein; Melanoma antigen AIM1; Protein AIM-1; Solute carrier family 45 member 2 from Homo sapiens (Human) (see 13 papers)
TC 2.A.2.4.9 / Q9UMX9 Solute carrier family 45, member 2, Slc45A2, also called melanocyte-restricted antigen or melanoma antigen, PatP, Aim-1 or Aim1 from Homo sapiens (see 13 papers)
NP_057264 membrane-associated transporter protein isoform a from Homo sapiens
31% identity, 91% coverage

• function: Proton-associated glucose and sucrose transporter (By similarity). May be able to transport also fructose (By similarity). Expressed at a late melanosome maturation stage where functions as proton/glucose exporter which increase lumenal pH by decreasing glycolysis (PubMed:32966160, PubMed:35469906). Regulates melanogenesis by maintaining melanosome neutralization that is initially initiated by transient OCA2 and required for a proper function of the tyrosinase TYR (PubMed:32966160, PubMed:35469906).
  catalytic activity: sucrose(out) + H(+)(out) = sucrose(in) + H(+)(in) (RHEA:72187)
  catalytic activity: D-glucose(out) + H(+)(out) = D-glucose(in) + H(+)(in) (RHEA:69556)
  subunit: Interacts with TYRP1.
• substrates: Sucrose
  tcdb comment: Transports sucrose, glucose and fructose with protons, possibly into vesicular structures that contain melanin (Vitavska et al. 2018). Found in skin and hair; involved in pigmentation (Bartölke et al. 2014). Defects give rise to oculocutaneous albinism (Meyer et al. 2011). One such mutation in dogs, G493D in TMS 11, gives rise to albinisms (Wijesena and Schmutz 2015). OCA type IV (OCA4, OMIM) develops due to homozygous or compound heterozygous mutations in the solute carrier family 45, member 2 (SLC45A2) gene, and many mutations in this human gene have been identified (Inagaki et al. 2006; Tóth et al. 2017). It interacts with 14-3-3 proteins (see TC# 8.A.98). Multiple pathogenic variants in SLC45A2 give rise to oculocutaneous albinism (Lewis and Girisha 2019)
• Computational Investigation of the pH Dependence of Stability of Melanosome Proteins: Implication for Melanosome formation and Disease.
  Koirala, International journal of molecular sciences 2021
  • “...SLC45A2 was modeled using Phyre2 [ 39 ]. Its sequence was taken from UniProt (ID: Q9UMX9) [ 37 ] with a sequence length of 530 amino acids. The chosen template (PDB ID: 4YBQ) [ 42 ] covered 94% of the sequence with an identity of 14%...”
• Delineating the genetic heterogeneity of OCA in Hungarian patients
  Fábos, European journal of medical research 2017
  • “...[ 31 ]. Both mutations are situated in transmembrane domains of the MATP protein (Uniprot: Q9UMX9). The locations of the mutations suggest that they impair the transport function of the MATP protein. MATP dysfunction might cause an acidic melanosomal lumen, leading to incorrect incorporation of copper...”
• The Concise Guide to PHARMACOLOGY 2013/14: transporters
  Alexander, British journal of pharmacology 2013
  • “...e.g . 428 ). Systematic nomenclature SLC45A1 SLC45A2 SLC45A3 SLC45A4 HGNC, UniProt SLC45A1, Q9Y2W3 SLC45A2, Q9UMX9 SLC45A3, Q96JT2 SLC45A4, Q5BKX6 Substrates L-glucose (Rat) 430 , Galactose (Rat) 430 Stoichiometry Unknown; increased at acid pH 430 . Further reading Vitavska O Wieczorek H The SLC45 gene family...”
• Anterior segment alterations and comparative aqueous humor proteomics in the buphthalmic rabbit (an American Ophthalmological Society thesis).
  Edward, Transactions of the American Ophthalmological Society 2011
• Challenges and solutions in proteomics.
  Hongzhan, Current genomics 2007
• Native American genetic ancestry and pigmentation allele contributions to skin color in a Caribbean population.
  Ang, eLife 2023
  • GeneRIF: Native American genetic ancestry and pigmentation allele contributions to skin color in a Caribbean population.
• Oncogenic Activity of Solute Carrier Family 45 Member 2 and Alpha-Methylacyl-Coenzyme A Racemase Gene Fusion Is Mediated by Mitogen-Activated Protein Kinase.
  Zuo, Hepatology communications 2022
  • GeneRIF: Oncogenic Activity of Solute Carrier Family 45 Member 2 and Alpha-Methylacyl-Coenzyme A Racemase Gene Fusion Is Mediated by Mitogen-Activated Protein Kinase.
• Whole exome sequencing identifies a novel pathogenic variation [p.(Gly194valfs*7)] in SLC45A2 in the homozygous state in multiple members of a family with oculocutaneous albinism in southern India.
  Lewis, Clinical and experimental dermatology 2020 (PubMed)
  • GeneRIF: A novel deletion mutation c.579delG [p.(Gly194Valfs*7)] in the SLC45A2 gene, predicted to be pathogenic and to result in both frameshift and premature termination of the MATP chain, was identified in a family.
• Homozygous promoter variant of SLC45A2 causes diverse hair color and patterns.
  Hida, The Journal of dermatology 2020 (PubMed)
  • GeneRIF: Homozygous promoter variant of SLC45A2 causes diverse hair color and patterns.
• SLC45A2 protein stability and regulation of melanosome pH determine melanocyte pigmentation.
  Le, Molecular biology of the cell 2020
  • GeneRIF: SLC45A2 protein stability and regulation of melanosome pH determine melanocyte pigmentation.
• Impact of a 4-bp deletion variant (rs984225803) in the promoter region of SLC45A2 on color variation among a Japanese population.
  Okamura, The Journal of dermatology 2019 (PubMed)
  • GeneRIF: Study in two unrelated oculocutaneous albinism (OCA)-suspected Japanese female patients concluded that the homozygous 4-bp deletion variant (rs984225803) in the promoter region of SLC45A2 caused the OCA-like phenotype.
• Purification and Functional Characterization of the C-Terminal Domain of the β-Actin-Binding Protein AIM1 In Vitro.
  Wu, Molecules (Basel, Switzerland) 2018
  • GeneRIF: AIM1 first Greek motif g1 is required for the main physiological functions of AIM1.AIM1 interaction with beta-actin.
• IRF4 Polymorphism Is Associated with Cutaneous Squamous Cell Carcinoma in Organ Transplant Recipients: A Pigment-Independent Phenomenon.
  Asgari, The Journal of investigative dermatology 2017
  • GeneRIF: Study confirmed a significant role for IRF4 rs12203592 and SLC45A2 rs16891982 in the risk of cutaneous squamous cell carcinoma development in organ transplant recipients.
• More

NP_001098228 membrane-associated transporter protein from Oryzias latipes
30% identity, 92% coverage

• Rescue from oculocutaneous albinism type 4 using medaka slc45a2 cDNA driven by its own promoter.
  Fukamachi, Genetics 2008
  • GeneRIF: Further studies of the 0.9-kb promoter identified in this study should provide insights into the cis/trans-regulatory mechanisms underlying the ocular and cutaneous expression of slc45a2 in medaka.

NP_001076833 membrane-associated transporter protein from Gallus gallus
31% identity, 95% coverage

• Mutations in SLC45A2 cause plumage color variation in chicken and Japanese quail.
  Gunnarsson, Genetics 2007
  • GeneRIF: The most interesting feature concerning the SLC45A2 variants documented in this study is the specific inhibition of expression of red pheomelanin in Silver chickens.

XP_001498160 membrane-associated transporter protein isoform X1 from Equus caballus
31% identity, 86% coverage

• Variation in the MC1R, ASIP, and MATP genes responsible for coat color in Kiso horse as determined by SNaPshot™ genotyping.
  Nakamura, The Journal of veterinary medical science 2019
  • GeneRIF: variation in MC1R, ASIP, and MATP genes in horse coat color
• Explicit evidence for a missense mutation in exon 4 of SLC45A2 gene causing the pearl coat dilution in horses.
  Sevane, Animal genetics 2019 (PubMed)
  • GeneRIF: The interaction between compound heterozygous for the pearl C(prl) and cream C(Cr) alleles makes SLC45A2 the most plausible candidate gene for the pearl phenotype in horses.
• A candidate gene approach identifies variants in SLC45A2 that explain dilute phenotypes, pearl and sunshine, in compound heterozygote horses.
  Holl, Animal genetics 2019 (PubMed)
  • GeneRIF: Sequenced SLC45A2 in 2 'false double dilute' horses that appeared phenotypically homozygous cream but tested as having only a single C(C) (r) allele; sequenced one known pearl carrier to screen for putative causal variants; missense variant ECA21:SLC45A2:c.985G>A; p.Ala329Thr (C(prl) ) was present in 1 false double dilute and the pearl carrier and was also genotyped in an additional 126 horses to evaluate.

NP_001103847 membrane-associated transporter protein from Danio rerio
28% identity, 91% coverage

• Slc45a2 and V-ATPase are regulators of melanosomal pH homeostasis in zebrafish, providing a mechanism for human pigment evolution and disease.
  Dooley, Pigment cell & melanoma research 2013 (PubMed)
  • GeneRIF: To gain understanding of the role of Slc45a2 and its possible interactions with other proteins involved in melanization, the role of the V-ATPase as a melanosomal acidifier, was analyzed.
• Functional assessment of human coding mutations affecting skin pigmentation using zebrafish.
  Tsetskhladze, PloS one 2012
  • GeneRIF: Zebrafish albino fish are mutant in slc45a2; wild-type slc45a2 mRNA rescued the albino mutant phenotype.

XP_003483856 membrane-associated transporter protein from Sus scrofa
31% identity, 84% coverage

• Red and blond Mangalitza pigs display a signature of divergent directional selection in the SLC45A2 gene.
  Bâlteanu, Animal genetics 2021 (PubMed)
  • GeneRIF: Red and blond Mangalitza pigs display a signature of divergent directional selection in the SLC45A2 gene.

XP_004017113 membrane-associated transporter protein from Ovis aries
29% identity, 90% coverage

• Distribution and expression of SLC45A2 in the skin of sheep with different coat colors.
  Wang, Folia histochemica et cytobiologica 2016 (PubMed)
  • GeneRIF: SLC45A2 is detectably expressed in sheep skin of all coat colors, though at significantly different levels. SLC45A2 may participate in the establishment of coat color by regulating the synthesis and trafficking of melanin.

F1SP14 Solute carrier family 45 member 2 from Sus scrofa
30% identity, 58% coverage

• Epitope recognition in the human-pig comparison model on fixed and embedded material
  Scalia, The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society 2015
  • “...& C-terminus Q9UM73 K7GQT6 91% NEG Receptor signaling AMACR 5 Rb mAb 13H4 unknown Q9UHK6 F1SP14 78% NEG Cytoplasmic; misc BCL-2 5 IgG1 Bcl-2-100 aa 4154 P10415 A5A790 100% POS Apoptosis-related BCL6 5 IgG1 PG-B6p aa 3484 P41182 F1FSH8 93% NEG TF BCL6 6 IgG2b LN22...”

NP_001234321 sucrose transporter-like protein isoform 2 from Solanum lycopersicum
23% identity, 86% coverage

• Interaction of brassinosteroid functions and sucrose transporter SlSUT2 regulate the formation of arbuscular mycorrhiza.
  Bitterlich, Plant signaling & behavior 2014
  • GeneRIF: Protein-protein interaction studies suggested a link between SISUT2 function and components of brassinosteroid biosynthesis and signaling.

H3A0G1 Solute carrier family 45 member 4 from Latimeria chalumnae
36% identity, 38% coverage

• Gene activation precedes DNA demethylation in response to infection in human dendritic cells.
  Pacis, Proceedings of the National Academy of Sciences of the United States of America 2019
  • “...address: Canadian Centre for Computational Genomics, McGill University and Genome Quebec Innovation Center, Montreal, QC H3A0G1, Canada. 2 4 2019 18 3 2019 18 3 2019 116 14 6938 6943 Copyright 2019 the Author(s). Published by PNAS. 2019 This open access article is distributed under Creative...”

S45A4_MOUSE / Q0P5V9 Solute carrier family 45 member 4 from Mus musculus (Mouse) (see paper)
XP_011243703 solute carrier family 45 member 4 isoform X1 from Mus musculus
37% identity, 33% coverage

• function: Proton-associated sucrose transporter. May be able to transport also glucose and fructose.
  catalytic activity: sucrose(out) + H(+)(out) = sucrose(in) + H(+)(in) (RHEA:72187)
• Proton-associated sucrose transport of mammalian solute carrier family 45: an analysis in Saccharomyces cerevisiae.
  Bartölke, The Biochemical journal 2014 (PubMed)
  • GeneRIF: mRNA expression of SLC45A2 in eyes and skin and of SLC45A3 primarily in the prostate, but also in other tissues, whereas SLC45A4 showed a predominantly ubiquitous expression

S45A1_RAT / Q8K4S3 Proton-associated sugar transporter A; PAST-A; Solute carrier family 45 member 1 from Rattus norvegicus (Rat) (see paper)
TC 2.A.2.4.4 / Q8K4S3 The brain proton:associated sugar (glucose) transporter, PAST-A from Rattus norvegicus (Rat) (see paper)
33% identity, 36% coverage

• function: Proton-associated glucose transporter in the brain.
  catalytic activity: D-galactose(in) + H(+)(in) = D-galactose(out) + H(+)(out) (RHEA:29019)
  catalytic activity: D-glucose(out) + H(+)(out) = D-glucose(in) + H(+)(in) (RHEA:69556)
• substrates: glucose

SUC3_ARATH / O80605 Sucrose transport protein SUC3; AtSUC3; Sucrose permease 3; Sucrose transporter 2; Sucrose-proton symporter 3 from Arabidopsis thaliana (Mouse-ear cress) (see 4 papers)
TC 2.A.2.4.3 / O80605 Sucrose:H+ symporter, Suc3 or Sut3 of 464 aas. Expressed in cells adjacent to the vascular tissue and in a carpel cell layer). Km (sucrose)= 1.9 mM; maltose is a competitor from Arabidopsis thaliana (Mouse-ear cress) (see 5 papers)
SUC3 / RF|NP_178389.1 sucrose transport protein SUC3 from Arabidopsis thaliana (see paper)
AT2G02860 SUT2 (SUCROSE TRANSPORTER 2); carbohydrate transmembrane transporter/ sucrose transmembrane transporter/ sucrose:hydrogen symporter/ sugar:hydrogen symporter from Arabidopsis thaliana
24% identity, 90% coverage

• function: Responsible for the transport of sucrose into the cell, with the concomitant uptake of protons (symport system). Can also transport maltose at a lesser rate. May also transport biotin. Probably involved in carpel maturation that leads to pod shatter and seed dispersal.
  catalytic activity: sucrose(out) + H(+)(out) = sucrose(in) + H(+)(in) (RHEA:72187)
  subunit: Homodimer. Interacts with SUC2 and SUC4.
• substrates: H+, Sucrose
• Comparative Metabolic Analysis Reveals a Metabolic Switch in Mature, Hydrated, and Germinated Pollen in Arabidopsis thaliana
  Wang, Frontiers in plant science 2022
  • “...hydration and germination. In the published transcriptome data ( Wang et al., 2008 ), AtSUC3 (At2g02860) and AtSUC9 (At5g06170) , which encode plasma-membrane localized sucrose transporters, had increased expression in germinated pollen. AtSIP2 (At3g57520) , which encodes a raffinose synthase, had elevated expression in germinated pollen....”
• Sucrose triggers a novel signaling cascade promoting Bacillus subtilis rhizosphere colonization
  Tian, The ISME journal 2021
  • “...its derivatives impaired in sucrose transport [ AtSUC2 (At1g22710, SALK_0038124), AtSTP1 (At1g11260, SALK_048848c), and AtSUC3 (At2g02860, SALK_077723)]. Weakened developmental effects were observed in some of the mutants. Pictures are representative of at least 20 independent plants (Scale bars: 1.4cm). E LSCM pictures of 15-day-old roots of...”
• Glucose uptake to guard cells via STP transporters provides carbon sources for stomatal opening and plant growth
  Flütsch, EMBO reports 2020
  • “...AT4G17090; KAT1, AT5G46240; MYB60, AT1G08810; STP1, AT1G11260; STP4, AT3G19930; STP13, AT5G26340; SUC1, AT1G71880 and SUC3, AT2G02860. References Alonso M , Stepanova AN , Leisse TJ , Kim CJ , Chen H , Shinn P , Stevenson DK , Zimmerman J , Barajas P , Cheuk R...”
• Sugar and Hormone Dynamics and the Expression Profiles of SUT/SUC and SWEET Sweet Sugar Transporters during Flower Development in Petunia axillaris
  Iftikhar, Plants (Basel, Switzerland) 2020
  • “...are shown in blue. Arabidopsis thaliana orthologs are in green: AtSUC1, At1g71880; AtSUC2, At1g22710; AtSUC3, At2g02860; AtSUC4, At1g09960; AtSUC5, AT1G71890; AtSUC6, AT5G43610; AtSUC7, AT1G66570; AtSUC8, AT2G14670; AtSUC9, At5g06170. Solanum lycopersicum orthologs are in orange: SlSUT1, NP_001289830.1; SlSUT2, NP_001234321.2; SlSUT4, NP_001234344.2. Sequence alignment and analysis are conducted...”
• Transcriptome Analysis of Carbohydrate Metabolism Genes and Molecular Regulation of Sucrose Transport Gene LoSUT on the Flowering Process of Developing Oriental Hybrid Lily 'Sorbonne' Bulb
  Gu, International journal of molecular sciences 2020
  • “...2A (AF167415), Ag SUT 3 (DQ286433), Arabidopsis thaliana AtSUC1 (At1g71880), AtSUC2 (At1g22710), AtSUC3/ SUT 2 (At2g02860), AtSUC4/ SUT 4 (At1g09960), AtSUC5 (At1g71890), AtSUC6 (At5g43610), AtSUC7 (At1g66570), AtSUC8 (At2g14670), AtSUC9 (At5g06170), Asarina barclaiana Ab SUT 1 (AF191024), Beta vulgaris Bv SUT 1 (X83850), Brassica oleracea BoSUC1 (AY065839),...”
• Characterization of a vacuolar sucrose transporter, HbSUT5, from Hevea brasiliensis: involvement in latex production through regulation of intracellular sucrose transport in the bark and laticifers
  Long, BMC plant biology 2019
  • “...GenBank accession numbers for the peptide sequences of other SUTs are At1g71880 (AtSUC1), At1g22710 (AtSUC2), At2g02860 (AtSUC3), At1g09960 (AtSUC4), At1g71890 (AtSUC5), At5g43610 (AtSUC6), At1g66570 (AtSUC7), At2g14670 (AtSUC8), At5g06170 (AtSUC9), BAA24071 (OsSUT1), BAC67163 (OsSUT2), BAB68368 (OsSUT3), BAC67164 (OsSUT4), BAC67165 (OsSUT5), ADW94615 (PtaSUT1), ADW94616 (PtaSUT3), ADW94617 (PtaSUT4), ADW94618...”
• Lateral Transport of Organic and Inorganic Solutes
  Aubry, Plants (Basel, Switzerland) 2019
  • “...Sucrose transporter Leaf Phloem companion cells Promoter GUS/GFP fusion At/[ 115 , 116 ] SUC3 At2g02860 Sucrose transporter Leaf, stem Phloem companion cells Protein immunolocalization and promoter GFP fusion At/[ 117 , 118 ] SUT1 X82276 (Nt); X82275 (Sly); X69165 (St) Sucrose transporter Leaf Xylem parenchyma...”
• Dissecting the subcellular membrane proteome reveals enrichment of H+ (co-)transporters and vesicle trafficking proteins in acidic zones of Chara internodal cells
  Pertl-Obermeyer, PloS one 2018
  • “...glucose translocator (PGLCT) 85 38 47 at5g16150 P sucrose transporter 2 (SUT2) 12 8 4 at2g02860 Golgi, V, PM 34.3 transport.H + transporting pyrophosphatase 573 315 258 vacuolar H + - pyrophosphatase 1 (AVP1) 570 313 257 at1g15690 V vacuolar H + - pyrophosphatase 2 (AVP2)...”
  • “...3 plus H + ) AMT1;2 and AMT1;5 (at1g64780, at3g24290)3 = sucrose/H + symporter SUC3/SUT2 (at2g02860) 4 = sulphate/H + symporter SULTR1 (at1g78000) 5 = Na + /cation transporter HKT1 (at4g10310) 6 = cation/H + exchanger CHX18/19 (at5g41610, at3g17630) 7 = P-type H + ATPase, PM...”
• More
• Structure and sucrose binding mechanism of the plant SUC1 sucrose transporter
  Bavnhøj, Nature plants 2023
  • “...A. thaliana SUC1 (accession number Q39232 ), SUC2 (accession number Q39231 ), SUC3 (accession number O80605 ), SUC4 (accession number Q9FE59 ), SUC5 (accession number Q9C8X2 ), SUC6 (accession number Q6A329 ), SUC7 (accession number Q67YF8 ), SUC8 (accession number Q9ZVK6 ), SUC9 (accession number Q9FG00...”

S45A1_HUMAN / Q9Y2W3 Proton-associated sugar transporter A; PAST-A; Deleted in neuroblastoma 5 protein; DNb-5; Solute carrier family 45 member 1 from Homo sapiens (Human) (see 2 papers)
TC 2.A.2.4.10 / Q9Y2W3 Proton:glucose symporter A; proton-associated sugar transporter A from Homo sapiens (see 2 papers)
NP_001073866 proton-associated sugar transporter A isoform 2 from Homo sapiens
34% identity, 34% coverage

• function: Proton-associated glucose transporter in the brain.
  catalytic activity: D-galactose(in) + H(+)(in) = D-galactose(out) + H(+)(out) (RHEA:29019)
  catalytic activity: D-glucose(out) + H(+)(out) = D-glucose(in) + H(+)(in) (RHEA:69556)
• substrates: glucose
  tcdb comment: (PAST-A) (present in brain and deleted in neuroblastoma 5 (DNb-5). Solute carrier family 45 member 1, SLC45A1 (Bartölke et al. 2014)
• Dysfunction of the Cerebral Glucose Transporter SLC45A1 in Individuals with Intellectual Disability and Epilepsy.
  Srour, American journal of human genetics 2017
  • GeneRIF: Our data strongly suggest that recessive mutations in SLC45A1 cause intellectual disability and epilepsy. SLC45A1 thus represents the second cerebral glucose transporter, in addition to GLUT1, to be involved in neurodevelopmental disability.
• THE CONCISE GUIDE TO PHARMACOLOGY 2017/18: Transporters
  Alexander, British journal of pharmacology 2017
  • “...[ 219 ]). Nomenclature Protonassociated sugar transporter A Systematic nomenclature SLC45A1 HGNC, UniProt SLC45A1 , Q9Y2W3 Substrates Lglucose [ 491 ], Galactose [ 4 91] Stoichiometry Unknown; increased at acid pH [ 491 ]. Further reading on SLC45 family of putative sugar transporters Bartlke R et...”
• The Concise Guide to PHARMACOLOGY 2015/16: Transporters
  Alexander, British journal of pharmacology 2015
  • “...[ 202 ]). Nomenclature Protonassociated sugar transporter A Systematic nomenclature SLC45A1 HGNC, UniProt SLC45A1 , Q9Y2W3 Substrates Lglucose [ 447 ], Galactose [ 447 ] Stoichiometry Unknown; increased at acid pH [ 447 ]. Further Reading Bartlke R et al. (2014) Protonassociated sucrose transport of mammalian...”
• The Concise Guide to PHARMACOLOGY 2013/14: transporters
  Alexander, British journal of pharmacology 2013
  • “...color ( e.g . 428 ). Systematic nomenclature SLC45A1 SLC45A2 SLC45A3 SLC45A4 HGNC, UniProt SLC45A1, Q9Y2W3 SLC45A2, Q9UMX9 SLC45A3, Q96JT2 SLC45A4, Q5BKX6 Substrates L-glucose (Rat) 430 , Galactose (Rat) 430 Stoichiometry Unknown; increased at acid pH 430 . Further reading Vitavska O Wieczorek H The SLC45...”
• Protein phosphatase 1α interacting proteins in the human brain.
  Esteves, Omics : a journal of integrative biology 2012

TC 2.A.2.4.7 / Q5BKX6 Solute carrier family 45, member 4, SLC45A4 from Homo sapiens (see 5 papers)
39% identity, 30% coverage

• substrates: Sucrose
  tcdb comment: Transports sucrose by a proton symport mechanism. Found ubiquitously throughout the tissues of the body (Bartölke et al. 2014)
• Mechanisms Underlying Adaptation to Life in Hydrogen Sulfide-Rich Environments.
  Kelley, Molecular biology and evolution 2016
  • “...transport protein si:dkey-178e17.1 1 TCONS_00002887 n/a XLOC_002625 1 TCONS_00004013 Q9Y6N5 Sulfide:quinone oxidoreductase sqrdl 1 TCONS_00004833 Q5BKX6 Solute carrier family 45 member 4 SLC45A4 (2 of 2) 1 TCONS_00005215 Q9BRT3 Migration and invasion enhancer 1 XLOC_004459 1 TCONS_00006194 P02144 Myoglobin Mb 1 TCONS_00006595 Q8NHV1 GTPase IMAP family...”
• The Concise Guide to PHARMACOLOGY 2013/14: transporters
  Alexander, British journal of pharmacology 2013
  • “...Systematic nomenclature SLC45A1 SLC45A2 SLC45A3 SLC45A4 HGNC, UniProt SLC45A1, Q9Y2W3 SLC45A2, Q9UMX9 SLC45A3, Q96JT2 SLC45A4, Q5BKX6 Substrates L-glucose (Rat) 430 , Galactose (Rat) 430 Stoichiometry Unknown; increased at acid pH 430 . Further reading Vitavska O Wieczorek H The SLC45 gene family of putative sugar transporters...”

suc3 / CAD58887.1 sucrose transporter from Plantago major (see paper)
24% identity, 91% coverage

SUT4_ORYSJ / Q6YK44 Sucrose transport protein SUT4; Sucrose permease 4; Sucrose transporter 4; OsSUT4; Sucrose-proton symporter 4 from Oryza sativa subsp. japonica (Rice) (see paper)
24% identity, 89% coverage

• function: Responsible for the transport of sucrose into the cell, with the concomitant uptake of protons (symport system). May also transport other glucosides (By similarity).
  subunit: Homodimer.

XP_024192899 sucrose transport protein SUC3 isoform X1 from Rosa chinensis
23% identity, 85% coverage

• Proteome and Ubiquitome Changes during Rose Petal Senescence
  Lu, International journal of molecular sciences 2019
  • “...was increased ( Figure 4 , Table S6 ), including putative sucrose transport protein SUC3 (XP_024192899), receptor of strigolactone D14 (XP_024183944), and salicylic acid-responsive transcription factor TGA2.3-like (XP_024181993) ( Figure 4 , Table S6 ). Many ubiquitinated proteins could not be detected in our study as...”
  • “...family member 1 K(0.824)ESNDSGGGEK(0.176)PEAVPSIGFGEVFR Down XP_024186868.1 76 ABC transporter B family member 1 ESNDSGGGEK(1)PEAVPSIGFGEVFR Down XP_024192899.1 4 Sucrose transport protein SUC3 AGK(1)TDSVSIR Down XP_024193193.1 198 Putative potassium transporter 12 LKLPTPELK(1)R Down XP_024194123.1 486 Ammonium transporter 1 member 1 K(1)VEPNSSTPNSV Down XP_024198608.1 337 ABC transporter F family...”

XP_008643520 sucrose transporter 2 isoform X1 from Zea mays
23% identity, 67% coverage

• Sucrose transporter2 contributes to maize growth, development, and crop yield.
  Leach, Journal of integrative plant biology 2017 (PubMed)
  • GeneRIF: functions to remobilize sucrose out of the vacuole for subsequent use in growing tissues; provides an important contribution to maize development and agronomic yield

XP_011515481 solute carrier family 45 member 4 isoform X13 from Homo sapiens
30% identity, 35% coverage

• The Slc45a4 Gene Regulates Pigmentation in a Manner Distinct from that of the OCA4 Gene Slc45a2.
  Brito, The Journal of investigative dermatology 2024 (PubMed)
  • GeneRIF: The Slc45a4 Gene Regulates Pigmentation in a Manner Distinct from that of the OCA4 Gene Slc45a2.
• SLC45A4 promotes glycolysis and prevents AMPK/ULK1-induced autophagy in TP53 mutant pancreatic ductal adenocarcinoma.
  Chen, The journal of gene medicine 2021
  • GeneRIF: SLC45A4 promotes glycolysis and prevents AMPK/ULK1-induced autophagy in TP53 mutant pancreatic ductal adenocarcinoma.

D3ZPP5 Solute carrier family 45, member 3 from Rattus norvegicus
30% identity, 42% coverage

• A meta-analysis of epitopes in prostate-specific antigens identifies opportunities and knowledge gaps.
  Foos, Human immunology 2023 (no snippet)

S45A3_MOUSE / Q8K0H7 Solute carrier family 45 member 3; Prostate cancer-associated protein 6; Prostein from Mus musculus (Mouse) (see 2 papers)
NP_001171099 solute carrier family 45 member 3 from Mus musculus
29% identity, 42% coverage

• function: Proton-associated sucrose transporter. May be able to transport also glucose and fructose.
  catalytic activity: sucrose(out) + H(+)(out) = sucrose(in) + H(+)(in) (RHEA:72187)
• Proton-associated sucrose transport of mammalian solute carrier family 45: an analysis in Saccharomyces cerevisiae.
  Bartölke, The Biochemical journal 2014 (PubMed)
  • GeneRIF: Real-time PCR of mouse tissues confirmed mRNA expression of SLC45A2 in eyes and skin and of SLC45A3 primarily in the prostate, but also in other tissues, whereas SLC45A4 showed a predominantly ubiquitous expression.
• miR-32 and its target SLC45A3 regulate the lipid metabolism of oligodendrocytes and myelin.
  Shin, Neuroscience 2012
  • GeneRIF: our data suggest that miR-32 and its downstream target SLC45A3 play important roles in myelin maintenance
• A meta-analysis of epitopes in prostate-specific antigens identifies opportunities and knowledge gaps
  Foos, Human immunology 2023 (secret)

S45A3_HUMAN / Q96JT2 Solute carrier family 45 member 3; Prostate cancer-associated protein 6; Prostein from Homo sapiens (Human) (see 2 papers)
TC 2.A.2.4.8 / Q96JT2 solute carrier family 45, member 3, Slc45A3 from Homo sapiens (see 3 papers)
30% identity, 42% coverage

• function: Proton-associated sucrose transporter. May be able to transport also glucose and fructose.
  catalytic activity: sucrose(out) + H(+)(out) = sucrose(in) + H(+)(in) (RHEA:72187)
• substrates: Sucrose
  tcdb comment: Sucrose:proton symporter associated with prostate cancer and myelination (Bartölke et al. 2014)
• ECOD domain classification of 48 whole proteomes from AlphaFold Structure Database using DPAM2
  Schaeffer, PLoS computational biology 2024
  • “...(IPR036691). The structure of solute carrier family 45 member 3 ( Fig 5C , UNP: Q96JT2) has an MFS domain pair but only the N-terminal domain is annotated by InterPro, the C-terminal domain contains a large disordered low-confidence insertion which likely prevents its detection by sequence...”
  • “...and a known DNase I-like (cyan) domain C) solute carrier family 45 member 3 (UNP: Q96JT2) contains an MFS domain pair (red, blue) with a large insertion in the C-terminal domain. The annotation of this C-terminal domain is truncated in InterPro annotations. There were DPAM domains...”
• A meta-analysis of epitopes in prostate-specific antigens identifies opportunities and knowledge gaps
  Foos, Human immunology 2023 (secret)
• Properties of protein drug target classes.
  Bull, PloS one 2015
  • “...to cancer, there are others, such as solute carrier family 45 member 3 (UniProt accession Q96JT2) which are differentially expressed in cancer but not presently believed to be drivers of cancer [ 66 , 67 ]. While connections between the proteins and cancer provide some validation...”
• The Concise Guide to PHARMACOLOGY 2013/14: transporters
  Alexander, British journal of pharmacology 2013
  • “...428 ). Systematic nomenclature SLC45A1 SLC45A2 SLC45A3 SLC45A4 HGNC, UniProt SLC45A1, Q9Y2W3 SLC45A2, Q9UMX9 SLC45A3, Q96JT2 SLC45A4, Q5BKX6 Substrates L-glucose (Rat) 430 , Galactose (Rat) 430 Stoichiometry Unknown; increased at acid pH 430 . Further reading Vitavska O Wieczorek H The SLC45 gene family of putative...”

GRMZM2G087901 sucrose transport protein SUT1-like from Zea mays
23% identity, 85% coverage

• Identification of Photosynthesis-Associated C4 Candidate Genes through Comparative Leaf Gradient Transcriptome in Multiple Lineages of C3 and C4 Species
  Ding, PloS one 2015
  • “...identified several sugar transporters that may take part in C 4 photosynthesis. For example, SUT1/2 (GRMZM2G087901 and GRMZM2G034302) and STP1 (GRMZM5G801949), which are crucial for efficient phloem loading of sucrose in maize leaves [ 47 ]. 10.1371/journal.pone.0140629.g006 Fig 6 Functional distribution of 128 C 4 candidate...”
• Asymmetric transcriptomic signatures between the cob and florets in the maize ear under optimal- and low-nitrogen conditions at silking, and functional characterization of amino acid transporters ZmAAP4 and ZmVAAT3
  Pan, Journal of experimental botany 2015
  • “...in tomato ( Barker et al. , 2000 ), specific expression of sucrose transporter 2 (GRMZM2G087901) may promote carbon transport from the cob to florets at the silking stage ( Fig. 3 ). Peptide transport is a more efficient means of N allocation than amino acid...”

SUT1_ORYSJ / Q10R54 Sucrose transport protein SUT1; Sucrose permease 1; Sucrose transporter 1; OsSUT1; Sucrose-proton symporter 1 from Oryza sativa subsp. japonica (Rice) (see 5 papers)
NP_001388983 sucrose transport protein SUT1 from Oryza sativa Japonica Group
22% identity, 85% coverage

• function: Responsible for the transport of sucrose into the cell, with the concomitant uptake of protons (symport system). Can also transport other glucosides such as maltose, salicin, helicin, and alpha- phenylglucoside. Probably required for apoplastic phloem sucrose loading in source tissues (e.g. leaves) in order to transport it to sink tissues (e.g. roots, flowers). Probably not involved in transport of sugars across the symplastic discontinuity between the endosperm and the embryo. Essential for normal pollen germination, but not for pollen maturation or starch accumulation in pollen.
  subunit: Homodimer.
  disruption phenotype: Male sterility probably due to impaired pollen germination.
• Phloem loading in rice leaves depends strongly on the apoplastic pathway.
  Wang, Journal of experimental botany 2021 (PubMed)
  • GeneRIF: Phloem loading in rice leaves depends strongly on the apoplastic pathway.

XP_002465781 sucrose transport protein SUT1 from Sorghum bicolor
25% identity, 49% coverage

• Sucrose Transporter Localization and Function in Phloem Unloading in Developing Stems.
  Milne, Plant physiology 2017
  • GeneRIF: SUT1 role in phloem unloading in developing stems

NP_001104840 sucrose transporter 1 from Zea mays
28% identity, 43% coverage

• ENB1 encodes a cellulose synthase 5 that directs synthesis of cell wall ingrowths in maize basal endosperm transfer cells
  Wang, The Plant cell 2022
  • “...(NP_001152629, Zm00001d041822); TCRR1 (NP_001288384, Zm00001d050200); SWEET4b (NP_001360983, Zm00001d015914); SWEET6a (NP_001149011, Zm00001d044421); SWEET16 (ONL97913, Zm00001d029098); SUT1 (NP_001104840, Zm00001d027854). RNA-Seq data that support the findings of this study have been deposited in the NCBI SRA database under the accession number PRJNA681735. Supplemental data The following materials are available...”
• Janus-Faced Nature of Light in the Cold Acclimation Processes of Maize
  Szalai, Frontiers in plant science 2018
  • “...partial 0.99635535 2.49E-04 ONM00923 Alpha/beta-Hydrolases superfamily protein 2.6030025 3.91E-04 ONM59878 4-Alpha-glucanotransferase DPE1 chloroplastic/amyloplastic 0.80431604 4.06E-04 NP_001104840 Sucrose transporter 1 1.0542811 0.004237142 NP_001142302 Mannose-1-phosphate guanylyltransferase 1 1.0449951 5.68E-06 ONM06244 Phosphoglycerate kinase 1.1203326 6.00E-05 NP_001151106 Fructose-1,6-bisphosphatase, cytosolic 1.0704721 0.003318357 AQK69130 Sucrose-phosphate synthase 1 1.3283775 3.44E-05 ONM07834 Phosphoglycerate mutase-like...”
• Identification and characterization of the three homeologues of a new sucrose transporter in hexaploid wheat (Triticum aestivum L.)
  Deol, BMC plant biology 2013
  • “...sativa , OsSUT1, BAI83443.1; OsSUT2, BAC67163.1; OsSUT3, BAB68368.1; OsSUT4, BAC67164.1; OsSUT5, BAC67165.1; Zea mays, ZmSUT1, NP_001104840; ZmSUT2, AAT51689; ZmSUT3, ACF86653.1; ZmSUT4, AATS91375.1; ZmSUT5, ACF85284.1; ZmSUT6, ACF86653.1; Solanum tuberosum , StSUT1, CAA48915.1; StSUT2, AAP43631.1; StSUT4, AAG25923.2; Arabidopsis thaliana , AtSUC1, CAA53147.1; AtSUC2, CAA53150.1; AtSUT2, AAC32907.1; AtSUT4, AAG09191.1;...”

A2X6E6 Sucrose transport protein SUT5 from Oryza sativa subsp. indica
28% identity, 42% coverage

• Selected lactic acid bacteria synthesize antioxidant peptides during sourdough fermentation of cereal flours
  Coda, Applied and environmental microbiology 2012
  • “...inhibitor 3; Q2R185 SUT5_ORYSI; sucrose transport protein SUT5; A2X6E6 Continued on following page February 2012 Volume 78 Number 4 aem.asm.org 1093 Downloaded...”

SUT5_ORYSJ / Q69JW3 Sucrose transport protein SUT5; Sucrose permease 5; Sucrose transporter 5; OsSUT5; Sucrose-proton symporter 5 from Oryza sativa subsp. japonica (Rice) (see 3 papers)
TC 2.A.2.4.11 / Q69JW3 Sucrose transport protein SUT5 (Sucrose permease 5) (Sucrose transporter 5) (OsSUT5) (Sucrose-proton symporter 5) from Oryza sativa subsp. japonica (see 6 papers)
28% identity, 42% coverage

• function: Responsible for the transport of sucrose into the cell, with the concomitant uptake of protons (symport system). Can also transport other glucosides such as maltose, arbutin, salicin, helicin, alpha- phenylglucoside and beta-phenylglucoside.
  subunit: Homodimer.
• substrates: Sucrose

SUC4_ARATH / Q9FE59 Sucrose transport protein SUC4; AtSUC4; Sucrose permease 4; Sucrose transporter 4; Sucrose-proton symporter 4 from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
TC 2.A.2.4.6 / Q9FE59 Vacuolar sucrose;H+ from Arabidopsis thaliana (see 5 papers)
AT1G09960, NP_172467 sucrose transporter 4 from Arabidopsis thaliana
NP_172467 SUT4 (SUCROSE TRANSPORTER 4); carbohydrate transmembrane transporter/ sucrose transmembrane transporter/ sucrose:hydrogen symporter/ sugar:hydrogen symporter from Arabidopsis thaliana
22% identity, 78% coverage

• function: Responsible for the transport of sucrose into the cell, with the concomitant uptake of protons (symport system) (PubMed:10948254). Can also transport maltose at a lesser rate. May also transport biotin (PubMed:10948254).
  catalytic activity: sucrose(out) + H(+)(out) = sucrose(in) + H(+)(in) (RHEA:72187)
  subunit: Homodimer. Interacts with SUC2 and SUC3.
• substrates: H+, Sucrose
  tcdb comment: symporter Suc4, Catalyzes sucrose export from vacuoles (Schulz et al., 2011)
• A comprehensive analysis of transcriptomic data for comparison of plants with different photosynthetic pathways in response to drought stress
  Karami, PloS one 2023
  • “...transporters under drought stress, such as SWEET6 (AT1G66770) in both groups of plants and SUC4 (AT1G09960) only in C4 plants. The up-regulation of SWEET and SUC in soybean under drought stress can enhance the capacity of leaves to load sucrose and roots to discharge it [...”
• Genome-wide association studies provide genetic insights into natural variation of seed-size-related traits in mungbean
  Liu, Frontiers in plant science 2022
  • “...Seed development Li et al., 2019 4 7755858 19.6 1.03 3VmrMLM EVM0015332/SUC4 0.02 * 0.29 AT1G09960 Sucrose transport protein SUC4 Xu and Liesche, 2021 10 25206533 15.41 0.59 3VmrMLM EVM0015812/Emp24 0.02 * 0.67 AT1G26690 Emp24 family protein Ren et al., 2019 2018-SW 1 71543546 12.44 1.65...”
  • “...protein 1 Rampey et al., 2013 4 7755858 28.43 0.66 3VmrMLM EVM0015332/SUC4 0.02 * 0.30 AT1G09960 Sucrose transport protein SUC4 Xu and Liesche, 2021 4 36876485 71.71 0.95 3VmrMLM EVM0019602/flo2 0.02 * 1.09 AT4G36920 Seed development She et al., 2010 10 25222572 37.89 0.67 3VmrMLM EVM0015812/Emp24...”
• Responsiveness of Early Response to Dehydration Six-Like Transporter Genes to Water Deficit in Arabidopsis thaliana Leaves
  Slawinski, Frontiers in plant science 2021
  • “...AtESL3.14/SFP2 (At5g27360) of other vacuolar SUTs: AtSWEET16 (At3g16690), AtSWEET17 (At4g15920), AtTMT1 (At1g20840), AtTMT2 (At4g35300), AtSUC4 (At1g09960), and AtVGT2 (At5g17010), and of vacuolar invertases At Fruct3 (At1g62660) and Atfruct4 (At1g12240) were performed using the rosette leaves of Col-0 and mutant plants grown in WW, WD, and RW...”
• Sugar and Hormone Dynamics and the Expression Profiles of SUT/SUC and SWEET Sweet Sugar Transporters during Flower Development in Petunia axillaris
  Iftikhar, Plants (Basel, Switzerland) 2020
  • “...in blue. Arabidopsis thaliana orthologs are in green: AtSUC1, At1g71880; AtSUC2, At1g22710; AtSUC3, At2g02860; AtSUC4, At1g09960; AtSUC5, AT1G71890; AtSUC6, AT5G43610; AtSUC7, AT1G66570; AtSUC8, AT2G14670; AtSUC9, At5g06170. Solanum lycopersicum orthologs are in orange: SlSUT1, NP_001289830.1; SlSUT2, NP_001234321.2; SlSUT4, NP_001234344.2. Sequence alignment and analysis are conducted using MUSCLE...”
• Transcriptome Analysis of Carbohydrate Metabolism Genes and Molecular Regulation of Sucrose Transport Gene LoSUT on the Flowering Process of Developing Oriental Hybrid Lily 'Sorbonne' Bulb
  Gu, International journal of molecular sciences 2020
  • “...3 (DQ286433), Arabidopsis thaliana AtSUC1 (At1g71880), AtSUC2 (At1g22710), AtSUC3/ SUT 2 (At2g02860), AtSUC4/ SUT 4 (At1g09960), AtSUC5 (At1g71890), AtSUC6 (At5g43610), AtSUC7 (At1g66570), AtSUC8 (At2g14670), AtSUC9 (At5g06170), Asarina barclaiana Ab SUT 1 (AF191024), Beta vulgaris Bv SUT 1 (X83850), Brassica oleracea BoSUC1 (AY065839), Bo SUC2 (AY065840), Citrus...”
• Genome-Wide Identification and Analysis of the Cytochrome B5 Protein Family in Chinese Cabbage (Brassica rapa L. ssp. Pekinensis)
  Zheng, International journal of genomics 2019
  • “...partners BrCB5a BrCB5b BrCB5c BrCB5d BrCB5f BrCB5g BrCB5h BrCB5i BrCB5j BrCB5k BrCB5l BrCB5n BrCB5o Bra031692 AT1G09960, SUT4 (Sucrose Transporter 4) Bra019972 Bra035720 AT4G32360, NADP adrenodoxin-like ferredoxin reductase Bra026504 AT5G23300, PYRD (pyrimidine d); dihydroorotate dehydrogenase Bra009669 Bra022246 AT3G17810, dihydroorotate dehydrogenase family protein Bra021275 Bra001684 Bra035130 AT1G79610, NHX6|sodium...”
• Characterization of a vacuolar sucrose transporter, HbSUT5, from Hevea brasiliensis: involvement in latex production through regulation of intracellular sucrose transport in the bark and laticifers
  Long, BMC plant biology 2019
  • “...numbers for the peptide sequences of other SUTs are At1g71880 (AtSUC1), At1g22710 (AtSUC2), At2g02860 (AtSUC3), At1g09960 (AtSUC4), At1g71890 (AtSUC5), At5g43610 (AtSUC6), At1g66570 (AtSUC7), At2g14670 (AtSUC8), At5g06170 (AtSUC9), BAA24071 (OsSUT1), BAC67163 (OsSUT2), BAB68368 (OsSUT3), BAC67164 (OsSUT4), BAC67165 (OsSUT5), ADW94615 (PtaSUT1), ADW94616 (PtaSUT3), ADW94617 (PtaSUT4), ADW94618 (PtaSUT5), ADW94619...”
• Molecular cloning and expression analysis of turnip (Brassica rapa var. rapa) sucrose transporter gene family
  Liu, Plant diversity 2017
  • “...SUCs shown are as follows: Arabidopsis thaliana : AtSUC1, At1g71880; AtSUC2, At1g22710; AtSUT2, At2g02860; AtSUT4, At1g09960; AtSUC9, At5g06170. Oryza sativa : OsSUT1, D87819; OsSUT2, HQ540307; OsSUT3, AB071809; OsSUT4, AB091673; OsSUT5, AB091674; Triticum aestivum : TaSUT1A, AAM13408; TaSUT1B, AAM13409; TaSUT1D, AAM13410; Zea mays : ZmSUT1, BAA83501; ZmSUT2,...”
• More
• Structure and sucrose binding mechanism of the plant SUC1 sucrose transporter
  Bavnhøj, Nature plants 2023
  • “...Q39232 ), SUC2 (accession number Q39231 ), SUC3 (accession number O80605 ), SUC4 (accession number Q9FE59 ), SUC5 (accession number Q9C8X2 ), SUC6 (accession number Q6A329 ), SUC7 (accession number Q67YF8 ), SUC8 (accession number Q9ZVK6 ), SUC9 (accession number Q9FG00 ). Conserved residues are highlighted...”
• Characterization of Sucrose transporter alleles and their association with seed yield-related traits in Brassica napus L
  Li, BMC plant biology 2011
  • “...Alonsoa meridionalis : AmSUT1 (AAF04295); Arabidopsis thaliana : AtSUC1 (CAA53147), AtSUC2 (CAA53150), AtSUC3 (AAC32907), AtSUC4 (NP_172467), AtSUC5 (AAG52226), AtSUC6 (NP_199174), AtSUC7 (NP_176830), AtSUC8 (NP_179074), AtSUC9 (NP_196235), Brssica napus : BnSUTx (ACB47398); Brassica oleracea : BoSUC1 (AAL58071), BoSUC2 (AAL58072); Bambusa oldhamii : BoSUT1 (AAY43226); Citrus sinensis :...”

TC 2.A.2.4.2 / Q9SXM0 Phloem-localized sucrose:H+ symporter, Sut1 (mediates sucrose uptake or efflux dependent on the sucrose gradient and the pmf; Carpaneto et al., 2005). Sut1 is a sucrose protein symporter. Protons can move in the absence of sucrose (Carpaneto et al., 2010), but upon addition of sucrose, it becomes a symporter from Zea mays (Maize) (see paper)
27% identity, 43% coverage

• substrates: H+, Sucrose
  tcdb comment: Arg-188 in the rice orthologue and homologues are essential (Sun and Ward 2012)

XP_044362203 sucrose transport protein SUT1 from Triticum aestivum
27% identity, 43% coverage

• Pathway of sugar transport in germinating wheat seeds.
  Aoki, Plant physiology 2006
  • GeneRIF: SUT1A functions to transport Sucrose into the scutellum from the endosperm early in germination and later transports maltose.

SUT2_ORYSI / A2ZN77 Sucrose transport protein SUT2; SUC4-like protein; Sucrose permease 2; Sucrose transporter 2; OsSUT2; Sucrose-proton symporter 2 from Oryza sativa subsp. indica (Rice) (see paper)
23% identity, 87% coverage

• function: Responsible for the transport of sucrose into the cell, with the concomitant uptake of protons (symport system). May also transport other glucosides (By similarity).
  subunit: Homodimer.

Sb07g028120 No description from Sorghum bicolor
28% identity, 33% coverage

• Genome-wide identification and characterization of the C2 domain family in Sorghum bicolor (L.) and expression profiles in response to saline-alkali stress
  Niu, Physiology and molecular biology of plants : an international journal of functional plant biology 2022
  • “...mechanisms. While sucrose transport protein SUT5 (Sb07g028120) and glucose-6-phosphate 1-dehydrogenase (Sb06g020640) in pink module were about carbohydrate...”
• Molecular cloning and expression analysis of turnip (Brassica rapa var. rapa) sucrose transporter gene family
  Liu, Plant diversity 2017
  • “...ACF85673; Sorghum bicolor : SbSUT1, Sb01g045720; SbSUT2, Sb04g038030; SbSUT3, Sb01g022430; SbSUT4, Sb08g023310; SbSUT5, Sb04g023860; SbSUT6, Sb07g028120. Beta vulgaris : BvSUT1.1, NP_001290021.1; BvSUT1.2, XP_010673573.1; BvSUT1.3, XP_010675270.1; BvSUT3, XP_010683228.1; BvSUT4.1, XP_010695439.1; BvSUT4.2, XP_010695440.1. Brassica oleracea : BoSUC1.1, XP_013595174.1; BoSUC1.2, XP_013588232.1; BoSUC1.3, XP_013612789.1; BoSUC1.4, XP_013592286.1; BoSUC2.1, XP_013598534.1; BoSUC2.2, XP_013586960.1;...”
• The sorghum SWEET gene family: stem sucrose accumulation as revealed through transcriptome profiling
  Mizuno, Biotechnology for biofuels 2016
  • “...68,703,38368,709,450 SbSUT5 Sobic.004G190500 Sb04g023860 Chr 4: 53,509,42853,512,882 SbSUT4 Sobic.004G353600 Sb04g038030 Chr 4: 67,476,51267,481,811 SbSUT6 Sobic.007G214500 Sb07g028120 Chr 7: 63,062,89263,066,154 SbSUT2 Sobic.008G193300 Sb08g023310 Chr 8: 55,332,64655,338,922 Sugar degradation INV1 Sobic.001G099700 Sb01g008910 Chr 1: 7,615,3477,617,621 INV2 Sobic.003G440900 Sb03g047060 Chr 3: 73,993,61373,997,226 INV3 Sobic.004G004800 Sb04g000620 Chr 4: 439,003443,225 INV4...”
• Are sucrose transporter expression profiles linked with patterns of biomass partitioning in Sorghum phenotypes?
  Milne, Frontiers in plant science 2013
  • “...SiSUT4, SiSUT5), Sorghum bicolor* (SbSUT1 Sb01g045720, SbSUT2 Sb04g038030, SbSUT3 Sb01g022430, SbSUT4 Sb08g023310, SbSUT5 Sb04g023860, SbSUT6 Sb07g028120), Triticum aestivum (TaSUT1A, TaSUT1B, TaSUT1D), Zea mays* (ZmSUT1, ZmSUT2, ZmSUT3, ZmSUT4, ZmSUT5, ZmSUT6). Phylogenetic analysis was carried out using MUSCLE alignment, Gblocks curation followed by PhyML phylogeny ( Dereeper et...”

SUT1 / Q9M422 sucrose transporter from Hordeum vulgare (see 2 papers)
24% identity, 49% coverage

XP_021667933 sucrose transport protein SUC4 from Hevea brasiliensis
22% identity, 85% coverage

• Characterization of a vacuolar sucrose transporter, HbSUT5, from Hevea brasiliensis: involvement in latex production through regulation of intracellular sucrose transport in the bark and laticifers.
  Long, BMC plant biology 2019
  • GeneRIF: findings provide insights into the roles of a vacuolar sucrose transporter, HbSUT5, in Suc exchange between lutoids and cytosol in rubber-producing laticifers

SUT2 / Q9M423 sucrose transporter from Hordeum vulgare (see 2 papers)
28% identity, 45% coverage

GRMZM2G106741 uncharacterized protein LOC100273278 from Zea mays
28% identity, 33% coverage

• The genetic architecture of amylose biosynthesis in maize kernel
  Li, Plant biotechnology journal 2018
  • “...transcription factor GATA31 chr3.S_149274688 A/T 3.12E08 GRMZM2G127789 Glutathione Stransferase GST 29 GST29 chr4.S_125184357 A/G 1.43E09 GRMZM2G106741 Sucrose transporter 6 SUT6 chr4.S_125294997 G/T 7.84E12 GRMZM2G312806 Mitochondrial transcription termination factor mTERF chr4.S_159118307 A/G 1.57E09 GRMZM2G026024 Phosphoribulokinase PRK chr4.S_160268689 C/T 2.89E11 GRMZM2G110483 Pentatricopeptide repeatcontaining protein PPRlike chr4.S_160268689 C/T 2.89E11...”
  • “...enzymes. Then, sucrose is transported to the storage organ by sucrose transporter (SUT6 encoded by GRMZM2G106741), where it is imported into the cytosolic compartment of each cell. In the cytosol, the sucrose synthase (SUS) or invertase (INV encoded by GRMZM2G089836) cleaves sucrose into fructose and UDPglucose....”

Sb04g023860 No description from Sorghum bicolor
XP_002454058 sucrose transport protein SUT5 from Sorghum bicolor
28% identity, 33% coverage

• Contribution of sucrose transporters to phloem unloading within Sorghum bicolor stem internodes
  Milne, Plant signaling & behavior 2017
  • “...used to test the functional properties of the grain Sorghum cv. BTx623 SUT5 variant (SbSUT5G; Sb04g023860) which differed by 9 amino acids from the sweet Sorghum cv. Rio SUT5 8 (GenBank Accession KY287233). Expression of SbSUT5 was higher in the sweet versus grain Sorghum Internode 5...”
• Molecular cloning and expression analysis of turnip (Brassica rapa var. rapa) sucrose transporter gene family
  Liu, Plant diversity 2017
  • “...ACF85284; ZmSUT6, ACF85673; Sorghum bicolor : SbSUT1, Sb01g045720; SbSUT2, Sb04g038030; SbSUT3, Sb01g022430; SbSUT4, Sb08g023310; SbSUT5, Sb04g023860; SbSUT6, Sb07g028120. Beta vulgaris : BvSUT1.1, NP_001290021.1; BvSUT1.2, XP_010673573.1; BvSUT1.3, XP_010675270.1; BvSUT3, XP_010683228.1; BvSUT4.1, XP_010695439.1; BvSUT4.2, XP_010695440.1. Brassica oleracea : BoSUC1.1, XP_013595174.1; BoSUC1.2, XP_013588232.1; BoSUC1.3, XP_013612789.1; BoSUC1.4, XP_013592286.1; BoSUC2.1, XP_013598534.1;...”
• The sorghum SWEET gene family: stem sucrose accumulation as revealed through transcriptome profiling
  Mizuno, Biotechnology for biofuels 2016
  • “...transporter SbSUT3 Sobic.001G254000 Sb01g022430 Chr 1: 28,168,65228,172,476 SbSUT1 Sobic.001G488700 Sb01g045720 Chr 1: 68,703,38368,709,450 SbSUT5 Sobic.004G190500 Sb04g023860 Chr 4: 53,509,42853,512,882 SbSUT4 Sobic.004G353600 Sb04g038030 Chr 4: 67,476,51267,481,811 SbSUT6 Sobic.007G214500 Sb07g028120 Chr 7: 63,062,89263,066,154 SbSUT2 Sobic.008G193300 Sb08g023310 Chr 8: 55,332,64655,338,922 Sugar degradation INV1 Sobic.001G099700 Sb01g008910 Chr 1: 7,615,3477,617,621 INV2...”
• Are sucrose transporter expression profiles linked with patterns of biomass partitioning in Sorghum phenotypes?
  Milne, Frontiers in plant science 2013
  • “...SiSUT2, SiSUT3, SiSUT4, SiSUT5), Sorghum bicolor* (SbSUT1 Sb01g045720, SbSUT2 Sb04g038030, SbSUT3 Sb01g022430, SbSUT4 Sb08g023310, SbSUT5 Sb04g023860, SbSUT6 Sb07g028120), Triticum aestivum (TaSUT1A, TaSUT1B, TaSUT1D), Zea mays* (ZmSUT1, ZmSUT2, ZmSUT3, ZmSUT4, ZmSUT5, ZmSUT6). Phylogenetic analysis was carried out using MUSCLE alignment, Gblocks curation followed by PhyML phylogeny (...”
• Sucrose Transporter Localization and Function in Phloem Unloading in Developing Stems.
  Milne, Plant physiology 2017
  • GeneRIF: SUT5 role in phloem unloading in developing stems

LOC103964096 sucrose transport protein-like from Pyrus x bretschneideri
26% identity, 40% coverage

• QTL mapping and transcriptome analysis of sugar content during fruit ripening of Pyrus pyrifolia
  Jiang, Frontiers in plant science 2023
  • “...downregulated differentially expressed genes (DEGs) in sweet cultivars. Two sucrose transport genes ( PpSUT , LOC103964096, and LOC103940043) were negatively correlated with sugar content. A weighted gene co-expression network analysis showed that two genes, sorbitol dehydrogenase ( PpSDH , LOC103960512 and LOC103960513), around the locus of...”
  • “...closely related to sugar content and fruit ripening. Two sucrose transport genes ( PpSUT , LOC103964096, and LOC103940043) were isolated. These two genes were highly similar and identified as different members of the same gene. The expression of these two genes was negatively correlated with sugar...”

suc5 / CAC19851.1 sucrose trasporter from Arabidopsis thaliana (see paper)
21% identity, 90% coverage

SUC5_ARATH / Q9C8X2 Sucrose transport protein SUC5; AtSUC5; Sucrose permease 5; Sucrose-proton symporter 5 from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
AT1G71890 SUC5; carbohydrate transmembrane transporter/ sucrose:hydrogen symporter/ sugar:hydrogen symporter from Arabidopsis thaliana
NP_177334 Major facilitator superfamily protein from Arabidopsis thaliana
21% identity, 90% coverage

• function: Responsible in a heterologous system for the transport of sucrose into the cell, with the concomitant uptake of protons (symport system). Can also transport biotin, and probably maltose at a lesser rate. In planta, the role of SUC5 for the transport of sucrose seems to be negligible. Plays a role in the nutrition of the filial tissues during early seed development and is probably involved in the import of biotin into the endosperm and the embryo epidermis.
  catalytic activity: sucrose(out) + H(+)(out) = sucrose(in) + H(+)(in) (RHEA:72187)
  disruption phenotype: Significant but transient reduction in fatty acid concentration in developing seeds. Slight delay in embryo development.
• Sugar and Hormone Dynamics and the Expression Profiles of SUT/SUC and SWEET Sweet Sugar Transporters during Flower Development in Petunia axillaris
  Iftikhar, Plants (Basel, Switzerland) 2020
  • “...Arabidopsis thaliana orthologs are in green: AtSUC1, At1g71880; AtSUC2, At1g22710; AtSUC3, At2g02860; AtSUC4, At1g09960; AtSUC5, AT1G71890; AtSUC6, AT5G43610; AtSUC7, AT1G66570; AtSUC8, AT2G14670; AtSUC9, At5g06170. Solanum lycopersicum orthologs are in orange: SlSUT1, NP_001289830.1; SlSUT2, NP_001234321.2; SlSUT4, NP_001234344.2. Sequence alignment and analysis are conducted using MUSCLE with default...”
• Transcriptome Analysis of Carbohydrate Metabolism Genes and Molecular Regulation of Sucrose Transport Gene LoSUT on the Flowering Process of Developing Oriental Hybrid Lily 'Sorbonne' Bulb
  Gu, International journal of molecular sciences 2020
  • “...Arabidopsis thaliana AtSUC1 (At1g71880), AtSUC2 (At1g22710), AtSUC3/ SUT 2 (At2g02860), AtSUC4/ SUT 4 (At1g09960), AtSUC5 (At1g71890), AtSUC6 (At5g43610), AtSUC7 (At1g66570), AtSUC8 (At2g14670), AtSUC9 (At5g06170), Asarina barclaiana Ab SUT 1 (AF191024), Beta vulgaris Bv SUT 1 (X83850), Brassica oleracea BoSUC1 (AY065839), Bo SUC2 (AY065840), Citrus sinensis Cs...”
• Characterization of a vacuolar sucrose transporter, HbSUT5, from Hevea brasiliensis: involvement in latex production through regulation of intracellular sucrose transport in the bark and laticifers
  Long, BMC plant biology 2019
  • “...the peptide sequences of other SUTs are At1g71880 (AtSUC1), At1g22710 (AtSUC2), At2g02860 (AtSUC3), At1g09960 (AtSUC4), At1g71890 (AtSUC5), At5g43610 (AtSUC6), At1g66570 (AtSUC7), At2g14670 (AtSUC8), At5g06170 (AtSUC9), BAA24071 (OsSUT1), BAC67163 (OsSUT2), BAB68368 (OsSUT3), BAC67164 (OsSUT4), BAC67165 (OsSUT5), ADW94615 (PtaSUT1), ADW94616 (PtaSUT3), ADW94617 (PtaSUT4), ADW94618 (PtaSUT5), ADW94619 (PtaSUT6), CAD61275...”
• The Role of Programmed Cell Death Regulator LSD1 in Nematode-Induced Syncytium Formation
  Matuszkiewicz, Frontiers in plant science 2018
  • “...2.19E-13 LSD1 independent AT1G68460 IPT1 5.05 1.73E-46 AT1G08440 ALMT2 4.50 6.90E-39 AT1G06030 TPS7 4.19 6.27E-17 AT1G71890 SUC5 4.09 5.56E-21 AT4G15210 BAM5 3.59 1.66E-10 AT5G01740 NTF2 -4.32 8.68E-30 AT4G15370 BARS1 -4.17 4.76E-16 AT1G80340 YUC9 -3.84 2.93E-17 AT1G65570 RNA HELICASE -3.77 2.54E-15 AT3G29430 GGPS11 -3.06 1.03E-34 LSD1 compensation...”
• New Insights into Phloem Unloading and Expression of Sucrose Transporters in Vegetative Sinks of the Parasitic Plant Phelipanche ramosa L. (Pomel)
  Péron, Frontiers in plant science 2016
  • “...), AtSUC2 ( At1g22710 ), AtSUC3 ( At2g02860 ), AtSUC4 ( At1g09960 ), AtSUC5 ( At1g71890 ), AtSUC6 ( At5g43610 ), AtSUC7 ( At1g66570 ), AtSUC8 ( At2g14670 ), AtSUC9 ( At5g06170 ), BoSUC1 ( Brassica oleracea ; AAL58071 ), BoSUC2 ( B . oleracea ;...”
• Linking Expression of Fructan Active Enzymes, Cell Wall Invertases and Sucrose Transporters with Fructan Profiles in Growing Taproot of Chicory (Cichorium intybus): Impact of Hormonal and Environmental Cues
  Wei, Frontiers in plant science 2016
  • “...from Arabidopsis thaliana . Accession: AtSUC1 (At1g71880), AtSUC2 (At1g22710), AtSUC3 (At2g02860), AtSUT4 (At1g09960), At SUC5 (At1g71890), AtSUC6 (AT5g43610), AtSUC7 (AT1g66570), AtSUC8 (AT2g14670), AtSUC9 (AT5g06170). Click here for additional data file. Click here for additional data file. FIGURE S4 Impact of ABA treatment (72 h) on transcript...”
• Senescence-inducible LEC2 enhances triacylglycerol accumulation in leaves without negatively affecting plant growth
  Kim, Plant biotechnology journal 2015
  • “...biosynthesis or catabolism. The third group of overexpressed genes contained three encoding carbohydrate transporters, AtSUS5 (At1g71890), AtSUC9 (At5g06170), and AtGPT2 (At1g61800), and one ABC transporter (At5g52860). Mutation of AtSUS5 reduces fatty acid levels in seeds ( Baud et al., 2005 ). Together with AtSUS5, these four...”
• Bayesian phylogeny of sucrose transporters: ancient origins, differential expansion and convergent evolution in monocots and dicots
  Peng, Frontiers in plant science 2014
  • “...partitioned expression between duplicated genes. Complementary expression was also observed between B2 members, with AtSUC5 (At1g71890, tandem duplicate of AtSUC1 ) exhibiting an embryo-specific expression, and between B1/B2 and B3 clades, with AtSUC9 (At5g06170) transcripts detected at very high levels in germinating pollen tubes (Qin et...”
• More
• SUCROSE TRANSPORTER 5 supplies Arabidopsis embryos with biotin and affects triacylglycerol accumulation.
  Pommerrenig, The Plant journal : for cell and molecular biology 2013
  • GeneRIF: efficacy of biotin supplementation was significantly lower in double than in single mutants, showing that transport of biotin into the embryo is lower in the absence of SUC5
• The AtSUC5 sucrose transporter specifically expressed in the endosperm is involved in early seed development in Arabidopsis.
  Baud, The Plant journal : for cell and molecular biology 2005 (PubMed)
  • GeneRIF: The gene was specifically and highly induced during seed development between 4 and 9 days after flowering (DAF).
• Structure and sucrose binding mechanism of the plant SUC1 sucrose transporter
  Bavnhøj, Nature plants 2023
  • “...Q39231 ), SUC3 (accession number O80605 ), SUC4 (accession number Q9FE59 ), SUC5 (accession number Q9C8X2 ), SUC6 (accession number Q6A329 ), SUC7 (accession number Q67YF8 ), SUC8 (accession number Q9ZVK6 ), SUC9 (accession number Q9FG00 ). Conserved residues are highlighted with gray-scale, where black is...”

SUC2 / Q39231 sucrose transporter from Arabidopsis thaliana (see 2 papers)
SUC2_ARATH / Q39231 Sucrose transport protein SUC2; AtSUC2; Sucrose permease 2; Sucrose transporter 1; Sucrose-proton symporter 2 from Arabidopsis thaliana (Mouse-ear cress) (see 7 papers)
AT1G22710 SUC2 (SUCROSE-PROTON SYMPORTER 2); carbohydrate transmembrane transporter/ sucrose transmembrane transporter/ sucrose:hydrogen symporter/ sugar:hydrogen symporter from Arabidopsis thaliana
NP_173685 sucrose-proton symporter 2 from Arabidopsis thaliana
23% identity, 45% coverage

• function: Responsible for the transport of sucrose into the cell, with the concomitant uptake of protons (symport system). Can also transport other glucosides such as maltose, arbutin (hydroquinone-beta-D- glucoside), salicin (2-(hydroxymethyl)phenyl-beta-D-glucoside), alpha- phenylglucoside, beta-phenylglucoside, alpha-paranitrophenylglucoside, beta-paranitrophenylglucoside, and paranitrophenyl-beta-thioglucoside. May also transport biotin. Required for apoplastic phloem sucrose loading in source tissues (e.g. leaves) in order to transport it to sink tissues (e.g. roots, flowers).
  catalytic activity: sucrose(out) + H(+)(out) = sucrose(in) + H(+)(in) (RHEA:72187)
  subunit: Homodimer. Interacts with SUC3 and SUC4.
• ZmCCD8 regulates sugar and amino acid accumulation in maize kernels via strigolactone signalling
  Zhong, Plant biotechnology journal 2025
  • “...sequences of ZmSWEET10 , ZmSWEET13c , and sucrose transporter 2 in Arabidopsis ( SUC2 , AT1G22710) were cloned into the pDR195 vector and transformed into the sucrose uptake deficient Saccharomyces cerevisiae SUSY7/ura3 strain (Wieczorke etal ., 1999 ). The empty pDR195 vector was transformed into the...”
• The potato sugar transporter SWEET1g affects apoplasmic sugar ratio and phloem-mobile tuber- and flower-inducing signals
  Lauschke, Plant physiology 2024
  • “...AT2G46330 sucrose CHEBI: CHEBI:17992 ATP CHEBI: CHEBI:15422 MED16 Gramene: AT4G04920 MED16 Araport: AT4G04920 SUC2 Gramene: AT1G22710 SUC2 Araport: AT1G22710 SUT4 Gramene: XP_010695440.1 SUT4 Araport: XP_010695440.1 SWEET1 Gramene: At1g21460 SWEET1 Araport: At1g21460 References Abelenda JA , Bergonzi S , Oortwijn M , Sonnewald S , Du M...”
• PLASMODESMATA-LOCATED PROTEIN 6 regulates plasmodesmal function in Arabidopsis vasculature
  Li, The Plant cell 2024
  • “...AT5G20830 CLV1 Gramene: AT1G75820 CLV1 Araport: AT1G75820 SUS6 Gramene: AT1G73370 SUS6 Araport: AT1G73370 SUC2 Gramene: AT1G22710 SUC2 Araport: AT1G22710 UGP Gramene: AT3G03250 UGP Araport: AT3G03250 anthocyanin content Planteome: TO:0000071 PDLP5 Gramene: AT1G70690 PDLP5 Araport: AT1G70690 PDLP6 Gramene: AT2G01660 PDLP6 Araport: AT2G01660 SUS5 Gramene: AT5G37180 SUS5 Araport:...”
• Arabidopsis ABCG14 forms a homodimeric transporter for multiple cytokinins and mediates long-distance transport of isopentenyladenine-type cytokinins
  Zhao, Plant communications 2023
  • “...Genome Initiative database under the following accession numbers: AtABCG14 (AT1G31770), CYP735A1 (AT5G38450), CYP735A2 (AT1G67110), AtSUC2 (AT1G22710), At4CL1 (AT1G51680), and ACTIN2 (AT3G18780). Supplemental information Document S1. Supplemental Figures112 and Supplemental Table1 Document S2. Article plus supplemental information Acknowledgments We thank Prof. Pei Liu at China Agricultural University...”
• Comparison of plastid proteomes points towards a higher plastidial redox turnover in vascular tissues than in mesophyll cells
  Boussardon, Journal of experimental botany 2023 (no snippet)
• Sugar status in preexisting leaves determines systemic stomatal development within newly developing leaves
  Bao, Proceedings of the National Academy of Sciences of the United States of America 2023
  • “...the following accession numbers: AT3G20770 (EIN3) ( 46 ), AT4G29130 (HXK1) ( 47 ), and AT1G22710 (SUC2) ( 48 ).All study data are included in the article and/or SIAppendix . 1 J. Sheen , Sugars as signaling molecules . Curr. Opin. Plant Biol. 2 , 410...”
• Non-volatile signals and redox mechanisms are required for the responses of Arabidopsis roots to Pseudomonas oryzihabitans
  Cantabella, Journal of experimental botany 2022
  • “...boron transporter 1); AT5G22410 (RHS18, root hair specific 18); AT4G38390 (RHS17, root hair specific 17); AT1G22710 (SUC2, sucrose protein symporter 2); AT2G32270 (ZIP3, zinc transporter 3 precursor). Root responses to bacteria in lines with modified expression of ERF109 To analyse the role of ERF109 in root...”
• Transcription factor NTL9 negatively regulates Arabidopsis vascular cambium development during stem secondary growth
  Sugimoto, Plant physiology 2022
  • “...( http://www.arabidopsis.org/ ) is as follows: NTL9/PCT (At4G35580), RCI2a (At3G05880), AtPP2CF1 (At3G05640), PXY/TDR (At5G61480), SUC2 (At1G22710), SEOR1 (At3G01680), WOX4 (At1G46480), APL (At1G79430), RTM1 (At1G05760), AHA3 (At5g57350), ANT (At4G37750), EXPA9 (At5G02260), IRX1 (At4G18780), IRX3 (At5G17420), IRX5 (At5G44030), ARF3 (At2G33860), ARF4 (At5G60450), ARF5 (At1G19850), AtERF1 (At4G17500), ERF018 (At1G74930),...”
• More
• Probing binding specificity of the sucrose transporter AtSUC2 with fluorescent coumarin glucosides.
  De, Journal of experimental botany 2018
  • GeneRIF: The presence of a free hydroxyl group on the coumarin moiety is essential for binding by AtSUC2 and subsequent phloem mobility. Structural modeling of the AtSUC2 substrate-binding pocket explains some important structural requirements for the interaction of coumarin glucosides with the AtSUC2 transporter.
• The Coumarin Glucoside, Esculin, Reveals Rapid Changes in Phloem-Transport Velocity in Response to Environmental Cues.
  Knox, Plant physiology 2018
  • GeneRIF: This observation suggests that under certain environmental conditions, transcriptional regulation may affect the abundance of AtSUC2 and thus regulate the phloem transport velocity.
• Water Deficit Enhances C Export to the Roots in Arabidopsis thaliana Plants with Contribution of Sucrose Transporters in Both Shoot and Roots.
  Durand, Plant physiology 2016
  • GeneRIF: Data indicate that the transcript levels of sucrose transporters AtSUC2, AtSWEET11, AtSWEET12 and AtSWEET15 were significantly higher in stressed roots.
• Arabidopsis AtSUC2 and AtSUC4, encoding sucrose transporters, are required for abiotic stress tolerance in an ABA-dependent pathway.
  Gong, Physiologia plantarum 2015 (PubMed)
  • GeneRIF: AtSUC2 and AtSUC4 are important regulators in plant abiotic stress tolerance that use an abscisic acid (ABA) signaling pathway, which may be crossed with sucrose signaling.
• Enhanced Sucrose Loading Improves Rice Yield by Increasing Grain Size.
  Wang, Plant physiology 2015
  • GeneRIF: Data show that rice plants expressing the Arabidopsis phloem-specific Suc transporter (AtSUC2) showed an increase in grain yield of up to 16% relative to wild-type plants.
• Temporal changes in allocation and partitioning of new carbon as (11)C elicited by simulated herbivory suggest that roots shape aboveground responses in Arabidopsis.
  Ferrieri, Plant physiology 2013
  • GeneRIF: Data indicate that induction of phenolics was suppressed in sucrose transporter mutant plants (suc2-1), indicating that this phenomenon may be controlled, in part, by phloem loading at source leaves.
• Arabidopsis SUC1 loads the phloem in suc2 mutants when expressed from the SUC2 promoter.
  Wippel, Journal of experimental botany 2012
  • GeneRIF: Both SUC1 and Srt1-GFP proteins were found exclusively in phloem companion cells (CCs), only SUC1 complemented the developmental defects of suc2-4 and suc2-5 mutants. [Srt1]
• Routes to the tonoplast: the sorting of tonoplast transporters in Arabidopsis mesophyll protoplasts.
  Wolfenstetter, The Plant cell 2012
  • GeneRIF: C-terminal di-leucine motif in INT1 can reroute other proteins, such as INT4, SUCROSE TRANSPORTER2 (SUC2), or SWEET1, to the tonoplast.
• More
• Structure and sucrose binding mechanism of the plant SUC1 sucrose transporter
  Bavnhøj, Nature plants 2023
  • “...thaliana Sucrose Transporters. Alignment between A. thaliana SUC1 (accession number Q39232 ), SUC2 (accession number Q39231 ), SUC3 (accession number O80605 ), SUC4 (accession number Q9FE59 ), SUC5 (accession number Q9C8X2 ), SUC6 (accession number Q6A329 ), SUC7 (accession number Q67YF8 ), SUC8 (accession number Q9ZVK6...”

SUC9_ARATH / Q9FG00 Sucrose transport protein SUC9; AtSUC9; Sucrose permease 9; Sucrose-proton symporter 9 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
NP_196235 sucrose-proton symporter 9 from Arabidopsis thaliana
AT5G06170, NP_196235 ATSUC9 (Sucrose-proton symporter 9); carbohydrate transmembrane transporter/ sucrose transmembrane transporter/ sucrose:hydrogen symporter/ sugar transmembrane transporter/ sugar:hydrogen symporter from Arabidopsis thaliana
28% identity, 33% coverage

• function: High-affinity sucrose transporter. Responsible for the transport of sucrose into the cell, with the concomitant uptake of protons (symport system). Can also transport a wide range of glucosides, such as helicin, salicin, arbutin, maltose, fraxin, esculin, uranose, alpha-methylglucoside, alpha-phenylglucoside and beta-phenylglucoside. Plays a role in flowering time transition delay.
  catalytic activity: sucrose(out) + H(+)(out) = sucrose(in) + H(+)(in) (RHEA:72187)
  disruption phenotype: Early flowering phenotype under short-day conditions.
• Structure and sucrose binding mechanism of the plant SUC1 sucrose transporter
  Bavnhøj, Nature plants 2023
  • “...Q6A329 ), SUC7 (accession number Q67YF8 ), SUC8 (accession number Q9ZVK6 ), SUC9 (accession number Q9FG00 ). Conserved residues are highlighted with gray-scale, where black is perfectly conserved. Coloured tubes represent -helices found in the N domain (cyan), EHR and IHR (grey) and C domain (orange)....”
• Transcriptional analysis of oligosaccharide utilization by Bifidobacterium lactis Bl-04
  Andersen, BMC genomics 2013
  • “...with only 25% amino acid sequence identity to a sucrose permease from Arabidopsis thaliana (uniprot: Q9FG00), and an intracellular (as predicted by SignalP 4.0 [ 32 ]) putative -galactosidase of GH42 (Balac_0053), adjacent to a GH30 subfamily 1 (GH30_1) putative -glucosidase (Balac_0052) [ 33 ] not...”
• Sucrose Transporter AtSUC9 Mediated by a Low Sucrose Level is Involved in Arabidopsis Abiotic Stress Resistance by Regulating Sucrose Distribution and ABA Accumulation.
  Jia, Plant & cell physiology 2015 (PubMed)
  • GeneRIF: AtSUC9 is induced in particular by low Sucrose (Suc)levels then mediates the balance of Suc distribution and promotes Abscisic Acid (ABA) accumulation to enhance Arabidopsis abiotic stress resistance.
• Arabidopsis sucrose transporter AtSUC9. High-affinity transport activity, intragenic control of expression, and early flowering mutant phenotype.
  Sivitz, Plant physiology 2007
  • GeneRIF: AtSUC9 activity leads to a delay in floral transition.
• AtSUC8 and AtSUC9 encode functional sucrose transporters, but the closely related AtSUC6 and AtSUC7 genes encode aberrant proteins in different Arabidopsis ecotypes.
  Sauer, The Plant journal : for cell and molecular biology 2004 (PubMed)
  • GeneRIF: Sucrose transporter 9 encodes functional sucrose transporter and is expressed in floral tissue. [SUC9]
• Comparative Metabolic Analysis Reveals a Metabolic Switch in Mature, Hydrated, and Germinated Pollen in Arabidopsis thaliana
  Wang, Frontiers in plant science 2022
  • “...In the published transcriptome data ( Wang et al., 2008 ), AtSUC3 (At2g02860) and AtSUC9 (At5g06170) , which encode plasma-membrane localized sucrose transporters, had increased expression in germinated pollen. AtSIP2 (At3g57520) , which encodes a raffinose synthase, had elevated expression in germinated pollen. The gene expression...”
• Sugar and Hormone Dynamics and the Expression Profiles of SUT/SUC and SWEET Sweet Sugar Transporters during Flower Development in Petunia axillaris
  Iftikhar, Plants (Basel, Switzerland) 2020
  • “...AtSUC2, At1g22710; AtSUC3, At2g02860; AtSUC4, At1g09960; AtSUC5, AT1G71890; AtSUC6, AT5G43610; AtSUC7, AT1G66570; AtSUC8, AT2G14670; AtSUC9, At5g06170. Solanum lycopersicum orthologs are in orange: SlSUT1, NP_001289830.1; SlSUT2, NP_001234321.2; SlSUT4, NP_001234344.2. Sequence alignment and analysis are conducted using MUSCLE with default parameters, and the phylogenetic tree is constructed with...”
• Transcriptome Analysis of Carbohydrate Metabolism Genes and Molecular Regulation of Sucrose Transport Gene LoSUT on the Flowering Process of Developing Oriental Hybrid Lily 'Sorbonne' Bulb
  Gu, International journal of molecular sciences 2020
  • “...2 (At2g02860), AtSUC4/ SUT 4 (At1g09960), AtSUC5 (At1g71890), AtSUC6 (At5g43610), AtSUC7 (At1g66570), AtSUC8 (At2g14670), AtSUC9 (At5g06170), Asarina barclaiana Ab SUT 1 (AF191024), Beta vulgaris Bv SUT 1 (X83850), Brassica oleracea BoSUC1 (AY065839), Bo SUC2 (AY065840), Citrus sinensis Cs SUT 1 (AY098891), Cs SUT 2 (AY098894), Cucumis...”
• Characterization of a vacuolar sucrose transporter, HbSUT5, from Hevea brasiliensis: involvement in latex production through regulation of intracellular sucrose transport in the bark and laticifers
  Long, BMC plant biology 2019
  • “...(AtSUC1), At1g22710 (AtSUC2), At2g02860 (AtSUC3), At1g09960 (AtSUC4), At1g71890 (AtSUC5), At5g43610 (AtSUC6), At1g66570 (AtSUC7), At2g14670 (AtSUC8), At5g06170 (AtSUC9), BAA24071 (OsSUT1), BAC67163 (OsSUT2), BAB68368 (OsSUT3), BAC67164 (OsSUT4), BAC67165 (OsSUT5), ADW94615 (PtaSUT1), ADW94616 (PtaSUT3), ADW94617 (PtaSUT4), ADW94618 (PtaSUT5), ADW94619 (PtaSUT6), CAD61275 (LjSUT4), CAB75881 (HvSUT2), ABJ51933 (HbSUT1), ABJ51934 (HbSUT2A), ABJ51932...”
• Molecular cloning and expression analysis of turnip (Brassica rapa var. rapa) sucrose transporter gene family
  Liu, Plant diversity 2017
  • “...are as follows: Arabidopsis thaliana : AtSUC1, At1g71880; AtSUC2, At1g22710; AtSUT2, At2g02860; AtSUT4, At1g09960; AtSUC9, At5g06170. Oryza sativa : OsSUT1, D87819; OsSUT2, HQ540307; OsSUT3, AB071809; OsSUT4, AB091673; OsSUT5, AB091674; Triticum aestivum : TaSUT1A, AAM13408; TaSUT1B, AAM13409; TaSUT1D, AAM13410; Zea mays : ZmSUT1, BAA83501; ZmSUT2, AAS91375; ZmSUT3,...”
• Short-Chain Chitin Oligomers: Promoters of Plant Growth
  Winkler, Marine drugs 2017
  • “...-ACTIN (At3g18780): 5-GTGATGAAGCACAATCCAAG-3 (forward) and 5-GAACAAGACTTCTGGGCAT-3 (reverse); MAPK3 (At3g45640): 5-ATGAACACCGGCGGTGGCC-3 (forward) and 5-GGCATTCACGGGGCTGCTG-3 (reverse); ATSUC9 (At5g06170) 5-AGCCGTTGGTTTCTTCGT-3 (forward) and 5-CTAATCACTCCAATAACAAG-3 (reverse); ATJAZ7 (At2g34600) 5-CGGATCCTCCAACAATCC-3 (forward) and 5-GACAATTGGATTATTATG-3 (reverse); ATECP31 (At3g22500) 5-GTCGAAGCACCTGATGTAGC-3 (forward) and 5-GAGCAATGACGTTGGTACC-3 (reverse); ATEXPA22 (At5g39270) 5-GTCGAAGCACCTGATGTAGC-3 (forward) and 5-CCACAAGCTCCCTGTTGAG-3 (reverse). Data acquisition was performed...”
• New Insights into Phloem Unloading and Expression of Sucrose Transporters in Vegetative Sinks of the Parasitic Plant Phelipanche ramosa L. (Pomel)
  Péron, Frontiers in plant science 2016
  • “...), AtSUC6 ( At5g43610 ), AtSUC7 ( At1g66570 ), AtSUC8 ( At2g14670 ), AtSUC9 ( At5g06170 ), BoSUC1 ( Brassica oleracea ; AAL58071 ), BoSUC2 ( B . oleracea ; AAL58072 ), BoSUT1 ( Bambusa oldhamii ; AAY43226 ), CsSUT2 ( Citrus sinensis ; AAM29153 ),...”
• Linking Expression of Fructan Active Enzymes, Cell Wall Invertases and Sucrose Transporters with Fructan Profiles in Growing Taproot of Chicory (Cichorium intybus): Impact of Hormonal and Environmental Cues
  Wei, Frontiers in plant science 2016
  • “...(At1g22710), AtSUC3 (At2g02860), AtSUT4 (At1g09960), At SUC5 (At1g71890), AtSUC6 (AT5g43610), AtSUC7 (AT1g66570), AtSUC8 (AT2g14670), AtSUC9 (AT5g06170). Click here for additional data file. Click here for additional data file. FIGURE S4 Impact of ABA treatment (72 h) on transcript levels of 1-SST and 1-FFT in taproots. Transcript...”
• More

SUT2_ORYSJ / Q0ILJ3 Sucrose transport protein SUT2; SUC4-like protein; Sucrose permease 2; Sucrose transporter 2; OsSUT2; Sucrose-proton symporter 2 from Oryza sativa subsp. japonica (Rice) (see paper)
LOC9266530 sucrose transport protein SUT2 from Oryza sativa Japonica Group
27% identity, 44% coverage

• function: Responsible for the transport of sucrose into the cell, with the concomitant uptake of protons (symport system). May also transport other glucosides (By similarity).
  subunit: Homodimer.
• Storage Drives Alterations of Proteomic and Protein Structural Properties in Rice (Oryza sativa L.)
  Wang, Foods (Basel, Switzerland) 2022
  • “...0.954 0.387 / 32 Q8S7N6 Pyruvate kinase LOC_Os10g42100 1.332 0.017 up 0.925 0.717 / 33 Q0ILJ3 Sucrose transport protein SUT2 SUT2 1.300 0.009 up 1.032 0.402 / 34 Q8GTK0 Starch synthase GBSSII 1.297 0.021 up / / / 35 A0A0P0VKS3 Aldose 1-epimerase Os02g0575800 1.200 0.003 up...”
• Development of Designer Transcription Activator-Like Effector-Based Plant Growth Regulator for Higher Yield in Rice
  Tang, Frontiers in plant science 2022
  • “...Target Selection and Gene Sequence Analysis The dTALE targets in promoters of OsHYR (LOC4331412), OsSUT2 (LOC9266530), and OsNOG1 (LOC4324637) were selected by considering the number of repeat units ( Boch and Bonas, 2010 ; Zheng et al., 2014 ), distance to the start codon ( Grau...”
• Quantitative iTRAQ-based proteomic analysis of rice grains to assess high night temperature stress
  Zhang, Proteomics 2017
  • “...3.366 0.469 Transport Q2R237 LOC4350785 Secindependent protein translocase protein TATB, chloroplastic 5.125 1.199 4.275 C7JA46 LOC9266530 Sucrose transport protein SUT2 2.573 0.651 3.954 Q69XN2 P0012B02.41 Putative yip1 interacting factor 1.495 0.445 3.359 Q6ZCC9 LOC4344489 Uncharacterized acetyltransferase At3g50280 0.907 0.425 2.131 Q2R1N0 LOC9266321 UDPglycosyltransferase 72B3 0.402 1.064...”

SUC7_ARATH / Q67YF8 Sucrose transport protein SUC7; AtSUC7; Sucrose permease 7; Sucrose-proton symporter 7 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
AT1G66570, NP_176830 ATSUC7 (Sucrose-proton symporter 7); carbohydrate transmembrane transporter/ sucrose:hydrogen symporter/ sugar:hydrogen symporter from Arabidopsis thaliana
28% identity, 33% coverage

• function: May be responsible for the transport of glucosides into the cell, with the concomitant uptake of protons (symport system). Does not seem to transport sucrose
• Structure and sucrose binding mechanism of the plant SUC1 sucrose transporter
  Bavnhøj, Nature plants 2023
  • “...Q9FE59 ), SUC5 (accession number Q9C8X2 ), SUC6 (accession number Q6A329 ), SUC7 (accession number Q67YF8 ), SUC8 (accession number Q9ZVK6 ), SUC9 (accession number Q9FG00 ). Conserved residues are highlighted with gray-scale, where black is perfectly conserved. Coloured tubes represent -helices found in the N...”
• Sugar and Hormone Dynamics and the Expression Profiles of SUT/SUC and SWEET Sweet Sugar Transporters during Flower Development in Petunia axillaris
  Iftikhar, Plants (Basel, Switzerland) 2020
  • “...in green: AtSUC1, At1g71880; AtSUC2, At1g22710; AtSUC3, At2g02860; AtSUC4, At1g09960; AtSUC5, AT1G71890; AtSUC6, AT5G43610; AtSUC7, AT1G66570; AtSUC8, AT2G14670; AtSUC9, At5g06170. Solanum lycopersicum orthologs are in orange: SlSUT1, NP_001289830.1; SlSUT2, NP_001234321.2; SlSUT4, NP_001234344.2. Sequence alignment and analysis are conducted using MUSCLE with default parameters, and the phylogenetic...”
• Transcriptome Analysis of Carbohydrate Metabolism Genes and Molecular Regulation of Sucrose Transport Gene LoSUT on the Flowering Process of Developing Oriental Hybrid Lily 'Sorbonne' Bulb
  Gu, International journal of molecular sciences 2020
  • “...AtSUC2 (At1g22710), AtSUC3/ SUT 2 (At2g02860), AtSUC4/ SUT 4 (At1g09960), AtSUC5 (At1g71890), AtSUC6 (At5g43610), AtSUC7 (At1g66570), AtSUC8 (At2g14670), AtSUC9 (At5g06170), Asarina barclaiana Ab SUT 1 (AF191024), Beta vulgaris Bv SUT 1 (X83850), Brassica oleracea BoSUC1 (AY065839), Bo SUC2 (AY065840), Citrus sinensis Cs SUT 1 (AY098891), Cs...”
• Characterization of a vacuolar sucrose transporter, HbSUT5, from Hevea brasiliensis: involvement in latex production through regulation of intracellular sucrose transport in the bark and laticifers
  Long, BMC plant biology 2019
  • “...other SUTs are At1g71880 (AtSUC1), At1g22710 (AtSUC2), At2g02860 (AtSUC3), At1g09960 (AtSUC4), At1g71890 (AtSUC5), At5g43610 (AtSUC6), At1g66570 (AtSUC7), At2g14670 (AtSUC8), At5g06170 (AtSUC9), BAA24071 (OsSUT1), BAC67163 (OsSUT2), BAB68368 (OsSUT3), BAC67164 (OsSUT4), BAC67165 (OsSUT5), ADW94615 (PtaSUT1), ADW94616 (PtaSUT3), ADW94617 (PtaSUT4), ADW94618 (PtaSUT5), ADW94619 (PtaSUT6), CAD61275 (LjSUT4), CAB75881 (HvSUT2), ABJ51933...”
• New Insights into Phloem Unloading and Expression of Sucrose Transporters in Vegetative Sinks of the Parasitic Plant Phelipanche ramosa L. (Pomel)
  Péron, Frontiers in plant science 2016
  • “...), AtSUC4 ( At1g09960 ), AtSUC5 ( At1g71890 ), AtSUC6 ( At5g43610 ), AtSUC7 ( At1g66570 ), AtSUC8 ( At2g14670 ), AtSUC9 ( At5g06170 ), BoSUC1 ( Brassica oleracea ; AAL58071 ), BoSUC2 ( B . oleracea ; AAL58072 ), BoSUT1 ( Bambusa oldhamii ; AAY43226...”
• Phosphate starvation induces DNA methylation in the vicinity of cis-acting elements known to regulate the expression of phosphate-responsive genes
  Yong-Villalobos, Plant signaling & behavior 2016
  • “...AT2G26760 AT3G02850 AT3G21870 AT3G60840 AT4G01820 AT1G66570 AT3G05690 AT3G47420 AT3G59884 AT4G21390 Gene Description TONOPLAST MONOSACCHARIDE TRANSPORTER1...”
• Linking Expression of Fructan Active Enzymes, Cell Wall Invertases and Sucrose Transporters with Fructan Profiles in Growing Taproot of Chicory (Cichorium intybus): Impact of Hormonal and Environmental Cues
  Wei, Frontiers in plant science 2016
  • “...Accession: AtSUC1 (At1g71880), AtSUC2 (At1g22710), AtSUC3 (At2g02860), AtSUT4 (At1g09960), At SUC5 (At1g71890), AtSUC6 (AT5g43610), AtSUC7 (AT1g66570), AtSUC8 (AT2g14670), AtSUC9 (AT5g06170). Click here for additional data file. Click here for additional data file. FIGURE S4 Impact of ABA treatment (72 h) on transcript levels of 1-SST and...”
• AKIN10 delays flowering by inactivating IDD8 transcription factor through protein phosphorylation in Arabidopsis
  Jeong, BMC plant biology 2015
  • “...At3g29160, AKIN11 ; At3g43190, SUS4 ; At3g13920, eIF4A ; At1g22710, SUC2 ; At5g43610, SUC6 ; At1g66570, SUC7 ; At2g14670, SUC8 ; and At3g26744, ICE1 . Availability of supporting data The data sets supporting the results of this article are included within the article and its additional...”
• Identification of tapetum-specific genes by comparing global gene expression of four different male sterile lines in Brassica oleracea
  Ma, Plant molecular biology 2015
  • “...7.553 2.254 C AT1G61110 NAC025 NAC domain containing protein 25 100.000 42.366 100.000 1.177 C AT1G66570 SUC7 Sucrose-proton symporter 7 12.623 5.220 8.168 2.813 C AT1G68190 B-box zinc finger family protein 9.385 3.859 4.895 1.220 C AT1G71160 KCS7 3-ketoacyl-CoA synthase 7 40.698 7.545 4.751 1.043 C...”
• More

Sb08g023310 No description from Sorghum bicolor
27% identity, 44% coverage

• Molecular cloning and expression analysis of turnip (Brassica rapa var. rapa) sucrose transporter gene family
  Liu, Plant diversity 2017
  • “...AAT51689; ZmSUT5, ACF85284; ZmSUT6, ACF85673; Sorghum bicolor : SbSUT1, Sb01g045720; SbSUT2, Sb04g038030; SbSUT3, Sb01g022430; SbSUT4, Sb08g023310; SbSUT5, Sb04g023860; SbSUT6, Sb07g028120. Beta vulgaris : BvSUT1.1, NP_001290021.1; BvSUT1.2, XP_010673573.1; BvSUT1.3, XP_010675270.1; BvSUT3, XP_010683228.1; BvSUT4.1, XP_010695439.1; BvSUT4.2, XP_010695440.1. Brassica oleracea : BoSUC1.1, XP_013595174.1; BoSUC1.2, XP_013588232.1; BoSUC1.3, XP_013612789.1; BoSUC1.4, XP_013592286.1;...”
• The sorghum SWEET gene family: stem sucrose accumulation as revealed through transcriptome profiling
  Mizuno, Biotechnology for biofuels 2016
  • “...53,509,42853,512,882 SbSUT4 Sobic.004G353600 Sb04g038030 Chr 4: 67,476,51267,481,811 SbSUT6 Sobic.007G214500 Sb07g028120 Chr 7: 63,062,89263,066,154 SbSUT2 Sobic.008G193300 Sb08g023310 Chr 8: 55,332,64655,338,922 Sugar degradation INV1 Sobic.001G099700 Sb01g008910 Chr 1: 7,615,3477,617,621 INV2 Sobic.003G440900 Sb03g047060 Chr 3: 73,993,61373,997,226 INV3 Sobic.004G004800 Sb04g000620 Chr 4: 439,003443,225 INV4 Sobic.006G255600 Sb06g031930 Chr 6: 60,211,62260,214,854 Sugar...”
• Are sucrose transporter expression profiles linked with patterns of biomass partitioning in Sorghum phenotypes?
  Milne, Frontiers in plant science 2013
  • “...italica* (SiSUT1, SiSUT2, SiSUT3, SiSUT4, SiSUT5), Sorghum bicolor* (SbSUT1 Sb01g045720, SbSUT2 Sb04g038030, SbSUT3 Sb01g022430, SbSUT4 Sb08g023310, SbSUT5 Sb04g023860, SbSUT6 Sb07g028120), Triticum aestivum (TaSUT1A, TaSUT1B, TaSUT1D), Zea mays* (ZmSUT1, ZmSUT2, ZmSUT3, ZmSUT4, ZmSUT5, ZmSUT6). Phylogenetic analysis was carried out using MUSCLE alignment, Gblocks curation followed by PhyML...”

NP_199174 ATSUC6 (Sucrose-proton symporter 6); carbohydrate transmembrane transporter/ sucrose:hydrogen symporter/ sugar:hydrogen symporter from Arabidopsis thaliana
AT5G43610 sucrose-proton symporter 6 from Arabidopsis thaliana
Q6A329 Putative sucrose transport protein SUC6 from Arabidopsis thaliana
26% identity, 40% coverage

• Characterization of Sucrose transporter alleles and their association with seed yield-related traits in Brassica napus L
  Li, BMC plant biology 2011
  • “...(AAF04295); Arabidopsis thaliana : AtSUC1 (CAA53147), AtSUC2 (CAA53150), AtSUC3 (AAC32907), AtSUC4 (NP_172467), AtSUC5 (AAG52226), AtSUC6 (NP_199174), AtSUC7 (NP_176830), AtSUC8 (NP_179074), AtSUC9 (NP_196235), Brssica napus : BnSUTx (ACB47398); Brassica oleracea : BoSUC1 (AAL58071), BoSUC2 (AAL58072); Bambusa oldhamii : BoSUT1 (AAY43226); Citrus sinensis : CsSUT2 (AAM29153); Datisca glomerata...”
• Sugar and Hormone Dynamics and the Expression Profiles of SUT/SUC and SWEET Sweet Sugar Transporters during Flower Development in Petunia axillaris
  Iftikhar, Plants (Basel, Switzerland) 2020
  • “...orthologs are in green: AtSUC1, At1g71880; AtSUC2, At1g22710; AtSUC3, At2g02860; AtSUC4, At1g09960; AtSUC5, AT1G71890; AtSUC6, AT5G43610; AtSUC7, AT1G66570; AtSUC8, AT2G14670; AtSUC9, At5g06170. Solanum lycopersicum orthologs are in orange: SlSUT1, NP_001289830.1; SlSUT2, NP_001234321.2; SlSUT4, NP_001234344.2. Sequence alignment and analysis are conducted using MUSCLE with default parameters, and...”
• Transcriptome Analysis of Carbohydrate Metabolism Genes and Molecular Regulation of Sucrose Transport Gene LoSUT on the Flowering Process of Developing Oriental Hybrid Lily 'Sorbonne' Bulb
  Gu, International journal of molecular sciences 2020
  • “...AtSUC1 (At1g71880), AtSUC2 (At1g22710), AtSUC3/ SUT 2 (At2g02860), AtSUC4/ SUT 4 (At1g09960), AtSUC5 (At1g71890), AtSUC6 (At5g43610), AtSUC7 (At1g66570), AtSUC8 (At2g14670), AtSUC9 (At5g06170), Asarina barclaiana Ab SUT 1 (AF191024), Beta vulgaris Bv SUT 1 (X83850), Brassica oleracea BoSUC1 (AY065839), Bo SUC2 (AY065840), Citrus sinensis Cs SUT 1...”
• Characterization of a vacuolar sucrose transporter, HbSUT5, from Hevea brasiliensis: involvement in latex production through regulation of intracellular sucrose transport in the bark and laticifers
  Long, BMC plant biology 2019
  • “...sequences of other SUTs are At1g71880 (AtSUC1), At1g22710 (AtSUC2), At2g02860 (AtSUC3), At1g09960 (AtSUC4), At1g71890 (AtSUC5), At5g43610 (AtSUC6), At1g66570 (AtSUC7), At2g14670 (AtSUC8), At5g06170 (AtSUC9), BAA24071 (OsSUT1), BAC67163 (OsSUT2), BAB68368 (OsSUT3), BAC67164 (OsSUT4), BAC67165 (OsSUT5), ADW94615 (PtaSUT1), ADW94616 (PtaSUT3), ADW94617 (PtaSUT4), ADW94618 (PtaSUT5), ADW94619 (PtaSUT6), CAD61275 (LjSUT4), CAB75881...”
• New Insights into Phloem Unloading and Expression of Sucrose Transporters in Vegetative Sinks of the Parasitic Plant Phelipanche ramosa L. (Pomel)
  Péron, Frontiers in plant science 2016
  • “...), AtSUC3 ( At2g02860 ), AtSUC4 ( At1g09960 ), AtSUC5 ( At1g71890 ), AtSUC6 ( At5g43610 ), AtSUC7 ( At1g66570 ), AtSUC8 ( At2g14670 ), AtSUC9 ( At5g06170 ), BoSUC1 ( Brassica oleracea ; AAL58071 ), BoSUC2 ( B . oleracea ; AAL58072 ), BoSUT1 (...”
• Linking Expression of Fructan Active Enzymes, Cell Wall Invertases and Sucrose Transporters with Fructan Profiles in Growing Taproot of Chicory (Cichorium intybus): Impact of Hormonal and Environmental Cues
  Wei, Frontiers in plant science 2016
  • “...thaliana . Accession: AtSUC1 (At1g71880), AtSUC2 (At1g22710), AtSUC3 (At2g02860), AtSUT4 (At1g09960), At SUC5 (At1g71890), AtSUC6 (AT5g43610), AtSUC7 (AT1g66570), AtSUC8 (AT2g14670), AtSUC9 (AT5g06170). Click here for additional data file. Click here for additional data file. FIGURE S4 Impact of ABA treatment (72 h) on transcript levels of...”
• AKIN10 delays flowering by inactivating IDD8 transcription factor through protein phosphorylation in Arabidopsis
  Jeong, BMC plant biology 2015
  • “...At3g01090, AKIN10 ; At3g29160, AKIN11 ; At3g43190, SUS4 ; At3g13920, eIF4A ; At1g22710, SUC2 ; At5g43610, SUC6 ; At1g66570, SUC7 ; At2g14670, SUC8 ; and At3g26744, ICE1 . Availability of supporting data The data sets supporting the results of this article are included within the article...”
• Bayesian phylogeny of sucrose transporters: ancient origins, differential expansion and convergent evolution in monocots and dicots
  Peng, Frontiers in plant science 2014
  • “...2009 ), followed by AtSUC8 (At2g14670) and AtSUC7 (At1g66570) (Figure 5B ). AtSUC7 and AtSUC6 (At5g43610) are pseudogenes, exhibiting extensive alternative splicing ( AtSUC7 ) or sequence substitutions ( AtSUC6 ) that are predicted to encode aberrant proteins (Sauer et al., 2004 ). Together, our analysis...”
• Spaceflight transcriptomes: unique responses to a novel environment
  Paul, Astrobiology 2012
  • “...At4g21440 At3g09790 At2g30770 At3g62740 At5g64530 At5g43610 At3g26120 At3g21500 At3g50980 At1g73280 At1g34650 At5g61980 At1g69930 At2g30790 At1g17870 At4g21200...”
• More
• Structure and sucrose binding mechanism of the plant SUC1 sucrose transporter
  Bavnhøj, Nature plants 2023
  • “...O80605 ), SUC4 (accession number Q9FE59 ), SUC5 (accession number Q9C8X2 ), SUC6 (accession number Q6A329 ), SUC7 (accession number Q67YF8 ), SUC8 (accession number Q9ZVK6 ), SUC9 (accession number Q9FG00 ). Conserved residues are highlighted with gray-scale, where black is perfectly conserved. Coloured tubes represent...”

Q03411 Sucrose transport protein from Spinacia oleracea
22% identity, 86% coverage

• New Insights into Phloem Unloading and Expression of Sucrose Transporters in Vegetative Sinks of the Parasitic Plant Phelipanche ramosa L. (Pomel).
  Péron, Frontiers in plant science 2016
  • “...; AAG09270 ), ShSUT1 ( Saccharum hybridum ; AAV41028 ), SoSUT1 ( Spinacea oleracea ; Q03411), StSUT1 ( Solanum tuberosum ; CAA48915 ), StSUT4 ( S . tuberosum ; AAG25923 ), TaSUT1A ( Triticum aestivum ; AAM13408 ), TaSUT1B ( T . aestivum ; AAM13409 ),...”
• Characterization of Sucrose transporter alleles and their association with seed yield-related traits in Brassica napus L
  Li, BMC plant biology 2011
  • “...(CAA83436); Solanum demissum : SdSUT2 (AAT40489); Saccharum hybridum : ShSUT1 (AAV41028); Spinacea oleracea : SoSUT1 (Q03411); Solanum tuberosum : StSUT1 (CAA48915), StSUT4 (AAG25923); Triticum aestivum : TaSUT1A (AAM13408), TaSUT1B (AAM13409), TaSUT1D (AAM13410); Vicia faba : VfSUCx (CAB07811); Vitis vinifera : VvSUCy (AAL32020), VvSUC11 (AAF08329), VvSUC12 (AAF08330),...”

suc6 / CAE53179.1 sucrose transporter from Arabidopsis thaliana (see paper)
26% identity, 40% coverage

SUC8_ARATH / Q9ZVK6 Sucrose transport protein SUC8; AtSUC8; Sucrose permease 8; Sucrose-proton symporter 8 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
AT2G14670, NP_179074 sucrose-proton symporter 8 from Arabidopsis thaliana
NP_179074 ATSUC8 (Sucrose-proton symporter 8); carbohydrate transmembrane transporter/ sucrose:hydrogen symporter/ sugar:hydrogen symporter from Arabidopsis thaliana
27% identity, 36% coverage

• function: Responsible for the transport of sucrose into the cell, with the concomitant uptake of protons (symport system). Can also transport maltose at a lesser rate. May also transport biotin.
  catalytic activity: sucrose(out) + H(+)(out) = sucrose(in) + H(+)(in) (RHEA:72187)
• Structure and sucrose binding mechanism of the plant SUC1 sucrose transporter
  Bavnhøj, Nature plants 2023
  • “...Q9C8X2 ), SUC6 (accession number Q6A329 ), SUC7 (accession number Q67YF8 ), SUC8 (accession number Q9ZVK6 ), SUC9 (accession number Q9FG00 ). Conserved residues are highlighted with gray-scale, where black is perfectly conserved. Coloured tubes represent -helices found in the N domain (cyan), EHR and IHR...”
• Single-gene resolution of diversity-driven overyielding in plant genotype mixtures
  Wuest, Nature communications 2023
  • “...and SRX145024 ). To genotype a wider set of RILs at the AtSUC8 locus ( At2g14670 [ https://www.arabidopsis.org/servlets/TairObject?id=35253&type=locus ]), a Cleaved Amplified Polymorphism (CAPS)-marker assay was developed based on a Eco RV-restriction site in the AtSUC8 coding sequence that is present in the Sav-0 allele but...”
• Single-gene resolution of diversity-driven community overyielding
  Wuest, 2022
• Sugar and Hormone Dynamics and the Expression Profiles of SUT/SUC and SWEET Sweet Sugar Transporters during Flower Development in Petunia axillaris
  Iftikhar, Plants (Basel, Switzerland) 2020
  • “...AtSUC1, At1g71880; AtSUC2, At1g22710; AtSUC3, At2g02860; AtSUC4, At1g09960; AtSUC5, AT1G71890; AtSUC6, AT5G43610; AtSUC7, AT1G66570; AtSUC8, AT2G14670; AtSUC9, At5g06170. Solanum lycopersicum orthologs are in orange: SlSUT1, NP_001289830.1; SlSUT2, NP_001234321.2; SlSUT4, NP_001234344.2. Sequence alignment and analysis are conducted using MUSCLE with default parameters, and the phylogenetic tree is...”
• Transcriptome Analysis of Carbohydrate Metabolism Genes and Molecular Regulation of Sucrose Transport Gene LoSUT on the Flowering Process of Developing Oriental Hybrid Lily 'Sorbonne' Bulb
  Gu, International journal of molecular sciences 2020
  • “...AtSUC3/ SUT 2 (At2g02860), AtSUC4/ SUT 4 (At1g09960), AtSUC5 (At1g71890), AtSUC6 (At5g43610), AtSUC7 (At1g66570), AtSUC8 (At2g14670), AtSUC9 (At5g06170), Asarina barclaiana Ab SUT 1 (AF191024), Beta vulgaris Bv SUT 1 (X83850), Brassica oleracea BoSUC1 (AY065839), Bo SUC2 (AY065840), Citrus sinensis Cs SUT 1 (AY098891), Cs SUT 2...”
• Characterization of a vacuolar sucrose transporter, HbSUT5, from Hevea brasiliensis: involvement in latex production through regulation of intracellular sucrose transport in the bark and laticifers
  Long, BMC plant biology 2019
  • “...are At1g71880 (AtSUC1), At1g22710 (AtSUC2), At2g02860 (AtSUC3), At1g09960 (AtSUC4), At1g71890 (AtSUC5), At5g43610 (AtSUC6), At1g66570 (AtSUC7), At2g14670 (AtSUC8), At5g06170 (AtSUC9), BAA24071 (OsSUT1), BAC67163 (OsSUT2), BAB68368 (OsSUT3), BAC67164 (OsSUT4), BAC67165 (OsSUT5), ADW94615 (PtaSUT1), ADW94616 (PtaSUT3), ADW94617 (PtaSUT4), ADW94618 (PtaSUT5), ADW94619 (PtaSUT6), CAD61275 (LjSUT4), CAB75881 (HvSUT2), ABJ51933 (HbSUT1), ABJ51934...”
• Differential gene expression and transport functionality in the bundle sheath versus mesophyll - a potential role in leaf mineral homeostasis
  Wigoda, Journal of experimental botany 2017
  • “...directly related to proton transport, namely AHA2 ( AT4G30190 ), ZIFL1 (AT5G13750 ), ATSUC8 ( AT2G14670 ), CHX24 ( AT5G37060 ), and CHX14 ( AT1G06970 ). To examine the expression levels of these 46 transporter genes, we crossed this set with the sets of transporter genes...”
• New Insights into Phloem Unloading and Expression of Sucrose Transporters in Vegetative Sinks of the Parasitic Plant Phelipanche ramosa L. (Pomel)
  Péron, Frontiers in plant science 2016
  • “...), AtSUC5 ( At1g71890 ), AtSUC6 ( At5g43610 ), AtSUC7 ( At1g66570 ), AtSUC8 ( At2g14670 ), AtSUC9 ( At5g06170 ), BoSUC1 ( Brassica oleracea ; AAL58071 ), BoSUC2 ( B . oleracea ; AAL58072 ), BoSUT1 ( Bambusa oldhamii ; AAY43226 ), CsSUT2 ( Citrus...”
• Linking Expression of Fructan Active Enzymes, Cell Wall Invertases and Sucrose Transporters with Fructan Profiles in Growing Taproot of Chicory (Cichorium intybus): Impact of Hormonal and Environmental Cues
  Wei, Frontiers in plant science 2016
  • “...(At1g71880), AtSUC2 (At1g22710), AtSUC3 (At2g02860), AtSUT4 (At1g09960), At SUC5 (At1g71890), AtSUC6 (AT5g43610), AtSUC7 (AT1g66570), AtSUC8 (AT2g14670), AtSUC9 (AT5g06170). Click here for additional data file. Click here for additional data file. FIGURE S4 Impact of ABA treatment (72 h) on transcript levels of 1-SST and 1-FFT in...”
• More
• Characterization of Sucrose transporter alleles and their association with seed yield-related traits in Brassica napus L
  Li, BMC plant biology 2011
  • “...AtSUC1 (CAA53147), AtSUC2 (CAA53150), AtSUC3 (AAC32907), AtSUC4 (NP_172467), AtSUC5 (AAG52226), AtSUC6 (NP_199174), AtSUC7 (NP_176830), AtSUC8 (NP_179074), AtSUC9 (NP_196235), Brssica napus : BnSUTx (ACB47398); Brassica oleracea : BoSUC1 (AAL58071), BoSUC2 (AAL58072); Bambusa oldhamii : BoSUT1 (AAY43226); Citrus sinensis : CsSUT2 (AAM29153); Datisca glomerata : DgSUT4 (CAG70682); Daucus...”

SUC1 / Q39232 sucrose transporter from Arabidopsis thaliana (see 3 papers)
SUC1_ARATH / Q39232 Sucrose transport protein SUC1; AtSUC1; Sucrose permease 1; Sucrose-proton symporter 1 from Arabidopsis thaliana (Mouse-ear cress) (see 6 papers)
TC 2.A.2.4.1 / Q39232 Sucrose:H+ symporter, Suc1 (provides osmotic driving force for anther dehiscence, pollen germination and pollen tube growth; also transports other glucosides such as maltose and phenylglucosides. Km (sucrose)= 0.5 mM. (Stadler et al., 1999)).  In wheat (Triticum aesticum), there are at least three isoforms designated Sut2A, Sut2B and Sut2D from Arabidopsis thaliana (Mouse-ear cress) (see 9 papers)
SUC1 / RF|NP_177333.1 sucrose transport protein SUC1 from Arabidopsis thaliana (see paper)
NP_177333 sucrose-proton symporter 1 from Arabidopsis thaliana
AT1G71880 SUC1 (Sucrose-proton symporter 1); carbohydrate transmembrane transporter/ sucrose:hydrogen symporter/ sugar:hydrogen symporter from Arabidopsis thaliana
25% identity, 37% coverage

• function: Responsible for the transport of sucrose into the cell, with the concomitant uptake of protons (symport system). This transport is both voltage- and energy-dependent. Can also transport other glucosides such as maltose, alpha-phenylglucoside and beta-phenylglucoside. May also transport biotin. Required for normal pollen germination and anthocyanin accumulation induced by sucrose.
  catalytic activity: sucrose(out) + H(+)(out) = sucrose(in) + H(+)(in) (RHEA:72187)
  disruption phenotype: Defective pollen with low rate of germination. Reduction of anthocyanin accumulation in response to exogenous sucrose or maltose.
• substrates: Sucrose
• Structure and sucrose binding mechanism of the plant SUC1 sucrose transporter
  Bavnhøj, Nature plants 2023
  • “...of sucrose and other solutes in vascular plants. Methods Protein purification A. thaliana SUC1 (UniProt: Q39232 ) cDNA was introduced into an expression construct based on p423-GAL1 with a C-terminal thrombin cleavage site and a decahistidine purification tag. Transformed S. cerevisiae (strain DSY-5) were grown in...”
  • “...for sucrose apply specifically at the defined pH. Oocyte uptake assays A. thaliana SUC1 (UniProt: Q39232 ) cDNA was cloned into the pNB1-U vector 77 and GFP fusion variant of the vector harbouring a C-terminal ten residue glycineserine linker followed by the gene sequence encoding eGFP....”
• Inferring the genetic responses to acute drought stress across an ecological gradient
  Devitt, BMC genomics 2022
  • “...isozyme O48791 SCAB1_ARATH Stomatal closure-related actin-binding protein 1 O82663 SDHA1_ARATH Succinate dehydrogenase flavoprotein subunit 1 Q39232 SUC1_ARATH Sucrose transport protein SUC1 Q9LNV3 STP2_ARATH Sugar transport protein 2 Q24JK1 MYB96_ARATH Transcription factor MYB96 Q9SNC6 PUB13_ARATH U-box domain-containing protein 13 Q8RWG1 AB1K1_ARATH Protein activity of BC1 complex kinase...”
• Microsome-associated proteome modifications of Arabidopsis seedlings grown on board the International Space Station reveal the possible effect on plants of space stresses other than microgravity
  Mazars, Plant signaling & behavior 2014
  • “...transporter Q8L9P5 2.142 putative peroxisomal membrane carrier protein Q8GX78 AT4G00370 2.089 putative anion transporter 2 Q39232 AT1G71880 2.051 sucrose transport protein SUC1 Q9LHG9 AT3G12390 1.953 Nascent polypeptide-associated complex subunit -like protein 1 Q9FNC9 AT5G43970 1.923 mitochondrial import receptor subunit TOM222 Q9SKX0 1.904 ABC transporter C family...”
• Arabidopsis Sucrose Transporter AtSuc1 introns act as strong enhancers of expression.
  Lasin, Plant & cell physiology 2020 (PubMed)
  • GeneRIF: Arabidopsis Sucrose Transporter AtSuc1 introns act as strong enhancers of expression.
• Arabidopsis SUC1 loads the phloem in suc2 mutants when expressed from the SUC2 promoter.
  Wippel, Journal of experimental botany 2012
  • GeneRIF: Both SUC1 and Srt1-GFP proteins were found exclusively in phloem companion cells (CCs), only SUC1 complemented the developmental defects of suc2-4 and suc2-5 mutants.
• An ABA-responsive element in the AtSUC1 promoter is involved in the regulation of AtSUC1 expression.
  Hoth, Planta 2010 (PubMed)
  • GeneRIF: Results show an ABA-responsive element in the AtSUC1 promoter is involved in the regulation of AtSUC1 expression.
• Expression of the AtSUC1 gene in the female gametophyte, and ecotype-specific expression differences in male reproductive organs.
  Feuerstein, Plant biology (Stuttgart, Germany) 2010 (PubMed)
  • GeneRIF: AtSUC1 expression in the funicular epidermis is induced upon pollination.
• Ethylene suppression of sugar-induced anthocyanin pigmentation in Arabidopsis.
  Jeong, Plant physiology 2010
  • GeneRIF: Suppression of SUC1 expression by ethylene inhibits Suc-induced anthocyanin accumulation in the presence of light.
• Arabidopsis sucrose transporter AtSUC1 is important for pollen germination and sucrose-induced anthocyanin accumulation.
  Sivitz, Plant physiology 2008
  • GeneRIF: important for sugar signaling in vegetative tissue and for normal male gametophyte function
• SA and NHP glucosyltransferase UGT76B1 affects plant defense in both SID2- and NPR1-dependent and independent manner
  Zhang, Plant cell reports 2024
  • “...8.82 2.81E-03 AT1G61560 MLO6 1.03 5.91 6.04E-03 AT2G27310 F-box family protein 1.20 8.29 1.17 E-02 AT1G71880 SUC1 1.03 9.38 1.87E-03 AT3G11080 RLP35 1.03 4.31 1.87E-01 AT1G06620 2-oxoglutarate and Fe(II)-dep. oxygenase superfamily protein 1.01 4.97 3.23E-02 AT4G08780 Peroxidase superfamily 1.00 2.93 9.35E-03 Seventy-one non-SA-responsive genes, however still...”
• The Proteome and Phosphoproteome Uncovers Candidate Proteins Associated With Vacuolar Phosphate Signal Multipled by Vacuolar Phosphate Transporter 1 (VPT1) in Arabidopsis
  Zhang, Molecular & cellular proteomics : MCP 2023
  • “...catabolic process alpha-amylase 1 (AMY1; At4g25000), and sucrose metabolic process including sucrose transport protein (SUC1; At1g71880) and sucrose synthase (SUS6; At1g73370) were all increased except BGAL9 and beta-amylase3 (BAM3; At4g17090) ( 30 ). The phosphorylation levels of proteins from carbohydrate metabolic process glucose-6-phosphate 1-dehydrogenase (G6PD5; At3g27300)...”
• Regulatory dynamics of gene expression in the developing male gametophyte of Arabidopsis
  Klodová, Plant reproduction 2023
  • “...et al. 2010 ). Similarly, we observed a log 2 fold difference of4.4 for AtSUC1 (At1g71880) at UNM stage and reduced signal in Ler-0 throughout development (mean expression 66.3 TPM in Col-0 and 24.44 TPM in Ler-0). Genes encoding F-box proteins were the most abundantly represented...”
• Comparative Metabolic Analysis Reveals a Metabolic Switch in Mature, Hydrated, and Germinated Pollen in Arabidopsis thaliana
  Wang, Frontiers in plant science 2022
  • “...sucrose during pollen germination can be accommodated by expression of sucrose transporters like AtSUC1 ( At1g71880 ), which when absent result in a compromised pollen germination phenotype in mutants without affecting fatty acid content ( Sivitz et al., 2008 ). By contrast, both monosaccharides (glucose and...”
• Membrane nanodomains and transport functions in plant
  Martinière, Plant physiology 2021
  • “...Sugar (continued) Sucrose transporter (SUT) AT1G22710 (SUT1) Leaves Demir et al., 2013 Sucrose-proton symporter (SUC) AT1G71880 (SUC1) Leaves/suspension cell cultures Demir et al., 2013 ; Yoshida et al., 2013 Polyol/monosaccharide transporter (PLT) AT3G18830 (PLT5) Leaves Demir et al., 2013 Tonoplast monosaccharide transporter (TMT) AT4G35300 (TMT2) Suspension...”
• Comparative Transcriptomics of Non-Embryogenic and Embryogenic Callus in Semi-Recalcitrant and Non-Recalcitrant Upland Cotton Lines
  Kumar, Plants (Basel, Switzerland) 2021
  • “...4.07 homeobox-3 AT2G33880 Gohir.A05G258900.2 3.996750279 0 4 NA Gohir.D05G252700.1 4.069014678 0.14795788 3.92 sucrose-proton symporter 2 AT1G71880 Gohir.D02G178800.1 5.818876119 1.96458346 3.85 early nodulin-like protein 3 AT4G32490 Gohir.D01G170800.1 4.741520918 0.91838623 3.82 D-amino acid aminotransferase-like PLP-dependent enzymes superfamily protein AT1G50110 Gohir.D03G120300.1 6.743972672 2.93243919 3.81 Ctr copper transporter family AT5G59030...”
• Glucose uptake to guard cells via STP transporters provides carbon sources for stomatal opening and plant growth
  Flütsch, EMBO reports 2020
  • “...ACT2, AT3G18780; BAM3, AT4G17090; KAT1, AT5G46240; MYB60, AT1G08810; STP1, AT1G11260; STP4, AT3G19930; STP13, AT5G26340; SUC1, AT1G71880 and SUC3, AT2G02860. References Alonso M , Stepanova AN , Leisse TJ , Kim CJ , Chen H , Shinn P , Stevenson DK , Zimmerman J , Barajas P...”
• Sugar and Hormone Dynamics and the Expression Profiles of SUT/SUC and SWEET Sweet Sugar Transporters during Flower Development in Petunia axillaris
  Iftikhar, Plants (Basel, Switzerland) 2020
  • “...Type III members. PaSUTs are shown in blue. Arabidopsis thaliana orthologs are in green: AtSUC1, At1g71880; AtSUC2, At1g22710; AtSUC3, At2g02860; AtSUC4, At1g09960; AtSUC5, AT1G71890; AtSUC6, AT5G43610; AtSUC7, AT1G66570; AtSUC8, AT2G14670; AtSUC9, At5g06170. Solanum lycopersicum orthologs are in orange: SlSUT1, NP_001289830.1; SlSUT2, NP_001234321.2; SlSUT4, NP_001234344.2. Sequence alignment...”
• More

Q43653 Sucrose transport protein from Solanum tuberosum
25% identity, 41% coverage

• Using a cell line breast cancer progression system to identify biomarker candidates.
  Yen, Journal of proteomics 2014
  • “...x P08138 NGFR Tumor necrosis factor receptor superfamily member 16 0 0 28 x x Q43653 PSCA Prostate stem cell antigen 3 0 27 Q12805 EFEMP1 EGF-containing fibulin-like extracellular matrix protein 1 2 2 26 x x P20061 TCN1 Transcobalamin-1 0 2 26 P15151 PVR Poliovirus...”

AO090009000637 No description from Aspergillus oryzae RIB40
25% identity, 35% coverage

• Sequence- and Structure-Based Functional Annotation and Assessment of Metabolic Transporters in Aspergillus oryzae: A Representative Case Study
  Raethong, BioMed research international 2016
  • “...Nitrate transporter AO090010000135 2.A.100.1.3 Iron-regulated transporter AO090010000229 2.A.17.2.2 Proton-dependent oligopeptide transporter AO090026000828 2.A.19.4.4 Sodium/potassium/calcium exchanger AO090009000637 2.A.2.6.1 Alpha-glucoside permease AO090003001404 2.A.20 Phosphate transporter AO090012000901 2.A.20.2.2 Phosphate transporter AO090103000274 2.A.22.3.2 Sodium and chloride dependent GABA transporter AO090009000405 2.A.29.1.3 Mitochondrial adenine nucleotide translocator AO090005000114 2.A.3.10.2 Amino acid transporter...”

XP_006351170 sucrose transport protein-like from Solanum tuberosum
25% identity, 41% coverage

• A sucrose transporter-interacting protein disulphide isomerase affects redox homeostasis and links sucrose partitioning with abiotic stress tolerance.
  Eggert, Plant, cell & environment 2016 (PubMed)
  • GeneRIF: affects redox homeostasis and links sucrose partitioning with abiotic stress tolerance

NCU09321 sucrose transporter from Neurospora crassa OR74A
20% identity, 67% coverage

• The Identification, Characterization, and Functional Analysis of the Sugar Transporter Gene Family of the Rice False Smut Pathogen, Villosiclava virens
  Qin, International journal of molecular sciences 2024
  • “...VvSTP8 and VvSTP35 showed a closer relationship with STPs from N. crassa , such as NCU09321, than with the majority of VvSTPs. Several STP genes from N. crassa and U. maydis , such as NCU07607 and UM03274, were grouped with VvSTP genes. 2.3. Expression Pattern of...”
  • “...VvSTP8 and VvSTP35 showed a closer relationship with STPs from N. crassa , such as NCU09321, than with the majority of VvSTPs. It is known that NCU09321 is a sucrose transporter from N. crassa [ 51 , 52 ]. There is no other detailed illustration of...”
• Correlating sugar transporter expression and activities to identify transporters for an orphan sugar substrate
  Tamayo, Applied microbiology and biotechnology 2024
  • “...genes that potentially encode sugar transporters were found (Supplemental Table S2 ). Only NCU00450 and NCU09321 belong to the glycoside-pentoside-hexuronide: cation symporter family (TC 2.A.2). The remaining forty-two candidate genes belong to several multigene families of the major facilitator superfamily. Concretely, putative sugar transporters NCU03468, NCU04310,...”
• Transcriptional comparison of the filamentous fungus Neurospora crassa growing on three major monosaccharides D-glucose, D-xylose and L-arabinose
  Li, Biotechnology for biofuels 2014
  • “...0.09 NCU08180 High-affinity glucose transporter 0.00 0.01 0.00 NCU08858 MFS alpha-glucoside transporter 24.76 36.86 37.86 NCU09321 Sucrose transporter 33.00 37.66 35.30 NCU09358 Hexose carrier protein 0.27 15.90 0.77 NCU11342 MFS hexose transporter 0.15 1.51 0.63 NCU12154 Maltose permease MAL61 2.10 2.59 1.51 The genes with RPKM...”

Q4JLW1 Sucrose transporter from Vitis vinifera
NP_001268070 sucrose transporter-like from Vitis vinifera
25% identity, 32% coverage

• Transcriptomic and metabolite analyses of Cabernet Sauvignon grape berry development
  Deluc, BMC genomics 2007
  • “...CB972367 TC53493 Q8LES0 Golgi nucleotide sugar transporter (GONST) 4 Transport 2 2.71 1615697_at AF021810 TC51724 Q4JLW1 Sucrose transporter (VvSuc27) Transport 3 2.44 1611331_at CF201541 TC69532 Q69M22 Golgi nucleotide sugar transporter (GONST) 4 Transport 7 2.2 1612481_at CF213270 - Q6ID34 Glycerol 3-phosphate transporter Transport 4 2.03 Hexose...”
• The Vitis vinifera sugar transporter gene family: phylogenetic overview and macroarray expression profiling.
  Afoufa-Bastien, BMC plant biology 2010
  • GeneRIF: Data show that two hexose (VvHT1, VvHT3), one polyol (VvPMT5) and one sucrose (VvSUC27) transporter genes, are highly expressed in most vegetative organs.

TC 2.A.2.4.5 / D1GC38 The proton:sucrose uptake symporter, Sut1 from Verbascum phoeniceum (see paper)
25% identity, 33% coverage

• substrates: H+, Sucrose

XP_021760460 sucrose transport protein-like isoform X1 from Chenopodium quinoa
21% identity, 86% coverage

• Salinity Effects on Guard Cell Proteome in Chenopodium quinoa
  Rasouli, International journal of molecular sciences 2021
  • “...protein 2-like Sugar XP_021726328 sugar carrier protein C-like Sugar XP_021757156 plastidic glucose transporter 4-like Sugar XP_021760460 sucrose transport protein-like isoform X1 Sucrose XP_021752898 chloride channel protein CLC-b-like anions XP_021739774 ATPase ASNA1 homolog anions XP_021772050 ADP, ATP carrier protein 1, mitochondrial-like cation ijms-22-00428-t004_Table 4 Table 4 Proteins...”

Afu5g06210 sucrose transporter, putative from Aspergillus fumigatus Af293
20% identity, 68% coverage

• The Mechanisms of Mating in Pathogenic Fungi-A Plastic Trait
  Usher, Genes 2019
  • “...the pseudohyphal/invasive growth pathway where it phosphorylates of Kss1p; phosphorylated by Ste11p SUT1 orf19.4342 CAGLI04246g Afu5g06210 Transcription factor of the Zn(II)2Cys6 family; positively regulates mating with SUT2 by repressing expression of genes which act as mating inhibitors SUT2 - CAGL0L09383g - Putative transcription factor of the...”

SUT3_ORYSJ / Q948L0 Sucrose transport protein SUT3; Sucrose permease 3; Sucrose transporter 3; OsSUT3; Sucrose-proton symporter 3 from Oryza sativa subsp. japonica (Rice) (see 2 papers)
24% identity, 40% coverage

• function: Responsible for the transport of sucrose into the cell, with the concomitant uptake of protons (symport system). May also transport other glucosides (By similarity).
  subunit: Homodimer.

NP_001289830 sucrose transport protein from Solanum lycopersicum
23% identity, 43% coverage

• Introns control expression of sucrose transporter LeSUT1 in trichomes, companion cells and in guard cells.
  Weise, Plant molecular biology 2008 (PubMed)
  • GeneRIF: Promoter region of LeSUT1 alone is insufficient for proper SUT1 expression and that regulatory cis elements in introns are involved in the expression of SUT1. [SUT1]

NP_001290021 sucrose transport protein from Beta vulgaris subsp. vulgaris
25% identity, 44% coverage

• Functional characterisation and cell specificity of BvSUT1, the transporter that loads sucrose into the phloem of sugar beet (Beta vulgaris L.) source leaves.
  Nieberl, Plant biology (Stuttgart, Germany) 2017 (PubMed)
  • GeneRIF: SUT1 is the sucrose transporter that is responsible for loading of sucrose into the phloem of sugar beet source leaves delivering sucrose to the storage tissue in sugar beet taproot sinks.

XAC2597 transport protein from Xanthomonas axonopodis pv. citri str. 306
20% identity, 87% coverage

• Plant structural and storage glucans trigger distinct transcriptional responses that modulate the motility of Xanthomonas pathogens
  Bonfim, Microbiology spectrum 2023
  • “...next to the loci encoding for a transcriptional regulator (XAC2595), an inner membrane MFS transporter (XAC2597), and a TonB-dependent transporter (TBDT, XAC2600), with the last two upregulated in presence of starch ( Fig. 2b and c ). Of note, XAC2595 is a transcriptional regulator belonging to...”
  • “...as maltose, are probably transported to the cytoplasm through the MFS transporter encoded by suc1 (XAC2597). Next, the putative cyclomaltodextrin glucanotransferase XAC2596 (GH13, not yet assigned to a subfamily) likely catalyzes the chemical reaction of cyclizing the malto-oligosaccharides into cyclodextrins. The disaccharide maltose is probably cleaved...”

SERP2441 transporter, putative from Staphylococcus epidermidis RP62A
SERP_RS11970 SLC45 family MFS transporter from Staphylococcus epidermidis RP62A
23% identity, 36% coverage

• Transcriptome Mining to Identify Molecular Markers for the Diagnosis of Staphylococcus epidermidis Bloodstream Infections
  Brás, Antibiotics (Basel, Switzerland) 2022
  • “...distinguish invasive from commensal isolates and among the ten genes identified as candidates, the gene SERP2441 showed the highest potential. A collection of 56 clinical and commensal isolates was then used to validate, by quantitative PCR, the discriminative power of the selected genes. A significant variation...”
  • “...one of the groups of isolates were selected. While five genes were identified, the gene SERP2441 had the higher discriminative potential. As the number of genes identified in this approach was limited, a second strategy was applied. The aim was to select highly expressed genes in...”
• Optimizing a reliable ex vivo human blood model to analyze expression of Staphylococcus epidermidis genes
  Brás, PeerJ 2020
  • “...gene expression assays Three unrelated genes were selected as probes for assessing gene expression stability: SERP_RS11970 , SERP_RS10985 and SERP_RS08870 . Two different experimental conditions were tested: (i) the utilization of different anticoagulants on the collection tubes and (ii) the reduction of the volume of blood...”
  • “...Product size (base pair) Efficiency (%) SERP_RS00125 (16S rRNA) Fw: GGGCTACACACGTGCTACAA Rv: GTACAAGACCCGGGAACGTA 176 97 SERP_RS11970 Fw: CAGGCATTGAACTTCCCAAT Rv: AATTCGGGGGCATATTTAGG 109 103 SERP_RS10985 Fw: ATGATTTTAGTGCTATCCCTGACT Rv: CACTAATTGCAAGATCATTTTCTG 102 110 SERP_RS08870 (sepA) Fw: TCTTAAGGCATCTCCGCCTA Rv: GTCTGGTGCGAATGATGTTG 196 97 Statistical analysis Statistical analysis was carried out with GraphPad...”

LP_RS14775 SLC45 family MFS transporter from Lactiplantibacillus plantarum WCFS1
lp_3533 sugar transport protein from Lactobacillus plantarum WCFS1
23% identity, 30% coverage

• Determination of the regulatory network and function of the lysR-type transcriptional regulator of Lactiplantibacillus plantarum, LpLttR
  Liu, Microbial cell factories 2022
  • “...3 B), and were described as replication proteins and hypothetical proteins, respectively. The expression of LP_RS14775 and LP_RS14610, separately annotated as SLC45 family MFS transporter and IS1182 family transposase, were upregulated. The transcriptional levels of these 11 genes were analyzed using RT-qPCR. Although the genes differed...”
  • “...FC(lttR/WT) LP_RS00230 LysR family transcriptional regulator 0.291 LP_RS15475 replication protein 0 LP_RS15480 hypothetical protein 0 LP_RS14775 SLC45 family MFS transporter 2.198 LP_RS14610 IS1182 family transposase 100.747 LP_RS13240 cell wall hydrolase/muramidase 0.46 LP_RS11700 MFS transporter 0.443 LP_RS13245 SH3 domain-containing protein 0.47 LP_RS07440 ABC transporter permease 0.44 LP_RS01255...”
• Identification of prebiotic fructooligosaccharide metabolism in Lactobacillus plantarum WCFS1 through microarrays
  Saulnier, Applied and environmental microbiology 2007
  • “...lp_2710 lp_2776 lp_2789 lp_2982 lp_2984 lp_3491 lp_3533 lp_3543 lp_3665 Mannitol PTS, EIICB Acetaldehyde dehydrogenase Ammonium transport protein Cellobiose...”

SE0123 sugar transporter from Staphylococcus epidermidis ATCC 12228
23% identity, 36% coverage

• Factors characterizing Staphylococcus epidermidis invasiveness determined by comparative genomics
  Yao, Infection and immunity 2005
  • “...clinical strains (total 22) P (Fisher's exact test) SE1875 SE0123 SE1608 SE0138 20 14 19 15 9 3 10 6 2.25E-05 0.00038208 0.00063793 0.00265532 SE0175 SE0126...”

BF3309 sugar transporter from Bacteroides fragilis YCH46
30% identity, 19% coverage

• PhoB regulates the survival of Bacteroides fragilis in peritoneal abscesses
  Wakimoto, PloS one 2013
  • “...phosphate ABC transporter phosphate-binding protein +4.58 103 2b BF3145 multidrug resistance ABC transporter +4.32 1 BF3309 sugar transporter +17.7 +15.5 2a BF3350 putative glucose/galactose transporter +13.3 +5.43 2b BF3714 polyphosphate kinase +5.22 +4.94 2a BF3715 putative phosphate/sulphate permeases 52.2 3 BF3721 cation efflux system protein 5.76...”

AFUA_3G08480 sucrose transporter, putative from Aspergillus fumigatus Af293
27% identity, 27% coverage

• Receptor-mediated signaling in Aspergillus fumigatus
  Grice, Frontiers in microbiology 2013
  • “...PIG-C AFUA_3G07170 XP_754889.1 Conserved hypothetical protein AFUA_3G07420 XP_754867.2 DUF1275 domain protein AFUA_3G07550 XP_754856.1 Sucrose transporter AFUA_3G08480 XP_754766.1 Conserved hypothetical protein AFUA_3G09650 XP_754654.1 PQ loop repeat protein AFUA_3G10470 XP_754572.1 RTA1 domain protein AFUA_3G10770 XP_754542.1 RTA1 domain protein AFUA_3G12830 XP_754338.2 Nonribosomal peptide synthase AFUA_3G13730 XP_754251.1 Mating-type alpha-pheromone receptor...”

XCC3357 sugar transporter from Xanthomonas campestris pv. campestris str. ATCC 33913
28% identity, 16% coverage

• Plant carbohydrate scavenging through tonB-dependent receptors: a feature shared by phytopathogenic and aquatic bacteria
  Blanvillain, PloS one 2007
  • “...XCC3358 ::pVO). (B) Pathogenicity and complementation tests with the Xcc wild-type strain, the XCC3356 and XCC3357 insertion mutants (XCC3356 ::pVO and XCC3357 ::pVO, respectively), the XCC3358 and XCC3359 deleted mutants ( XCC3358 D1 and XCC3359 D1, respectively) and their corresponding complemented strains [ XCC3358 D1 (pL-...”
  • “...related to sugar metabolism: XCC3356 codes for a putative transcriptional repressor of the LacI/GalR-family and XCC3357 encodes a putative sugar transporter of the major facilitator family, allowing the transport of substrate molecules through the inner membrane. We constructed insertion mutants in these two genes, presuming that...”

XAC3488 sugar transporter from Xanthomonas axonopodis pv. citri str. 306
28% identity, 16% coverage

• Stringent response regulators (p)ppGpp and DksA positively regulate virulence and host adaptation of Xanthomonas citri
  Zhang, Molecular plant pathology 2019
  • “...is composed of four genes encoding a regulatory protein (XAC3487), a sugar inner membrane transporter (XAC3488), a TonBdependent transporter (XAC3489) and an amylosucrase (XAC3490) (Fig. 6 B). The suxA , a TonBdependent transporter, suxB and suxC genes were downregulated in both dksA and spoT relA mutants...”

BCIN_05g02030 hypothetical protein from Botrytis cinerea B05.10
24% identity, 36% coverage

• Antifungal metabolites of biocontrol stain LB-1 and their inhibition mechanism against Botrytis cinerea
  Zhang, Frontiers in microbiology 2024
  • “...hydrolases enzymes related to cell wall degradation have been discovered, including general -glucoside permease ( BCIN_05g02030 , log 2 FC = 7.57), raucaffricine-o--d-glucosidase ( BCIN_16g03980 , log 2 FC = 4.93), glucan 1,3--glucosidase ( BCIN_05g01660 , log 2 FC = 4.13), glycosyl transferase family group 2...”

XHV734_1017 MFS transporter from Xanthomonas hortorum pv. vitians
28% identity, 16% coverage

• A Comprehensive Overview of the Genes and Functions Required for Lettuce Infection by the Hemibiotrophic Phytopathogen Xanthomonas hortorum pv. vitians
  Morinière, mSystems 2022
  • “...for an intracellular amylosucrase that cleaves sucrose into glucose-1-P and fructose ( 55 ); suxC (XHV734_1017), coding for an inner membrane sucrose transporter; and suxR (XHV734_1018), coding for a LacI/GalR-family transcriptional repressor of sucrose import, which was logically not critical in our screening. The phosphohexose mutase...”

SUT1_SCHPO / O14091 General alpha-glucoside permease from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
TC 2.A.2.6.1 / O14091 Maltose/sucrose H+ : symporter, Sut1 (maltose, Km = 6 %u03BCM; sucrose, Km = 36 %u03BCM) from Schizosaccharomyces pombe (Fission yeast) (see 3 papers)
sut1 / RF|NP_594387.1 general alpha-glucoside permease from Schizosaccharomyces pombe (see 2 papers)
SPAC2F3.08 alpha-glucoside transporter (PMID 11136464) from Schizosaccharomyces pombe
20% identity, 47% coverage

• function: Responsible for the transport of maltose and sucrose into the cell, with the concomitant uptake of protons (symport system).
• substrates: H+, Maltose, Sucrose
• Posttranslational Arginylation Enzyme Arginyltransferase1 Shows Genetic Interactions With Specific Cellular Pathways in vivo
  Wiley, Frontiers in physiology 2020
  • “...synthase Tps2 (predicted) TPS2 spn1 SPAC4F10.11 0.00028086 3.63235 Mitotic septin Spn1 CDC3 SEPTIN7,SEPTIN1,SEPTIN2, SEPTIN5,SEPTIN4 sut1 SPAC2F3.08 0.00034674 3.57762 Plasma membrane sucrose/maltose:proton symporter Sut1 SLC45A2,SLC45A3 plc1 SPAC22F8.11 0.00046324 3.50116 Phosphoinositide phospholipase C Plc1 PLC1 PLCB1,PLCH2,PLCH1,PLCB2, PLCB3,PLCB4,PLCD1,PLCD3, PLCD4,PLCL1,PLCL2,PLCG1 PLCG2 gid5 SPAC26H5.04 0.00068454 3.3957 GID complex armadillo repeat subunit...”
• A defect in protein farnesylation suppresses a loss of Schizosaccharomyces pombe tsc2+, a homolog of the human gene predisposing to tuberous sclerosis complex
  Nakase, Genetics 2006
  • “...SPBP4H10.12 SPAC821.10c SPBC211.07c SPAC29B12.13 SPAC2F3.08 SPCC1450.13c SPAC3C7.02c SPCC70.10 SPAC25B8.09 SPCC70.08c SPAC16E8.03 SPBC1773.05c SPBC16A3.17c...”
• Transport activity of rice sucrose transporters OsSUT1 and OsSUT5
  Sun, Plant & cell physiology 2010
  • “...(At5g43610), AtSUC7 (At1g66570), AtSUC8 (At2g14670), AtSUC9 (At5g06170); barley HvSUT1 (CAJ20123), HvSUT2 (CAB75881); fission yeast SpSUT1 (O14091); lotus LjSUT4 (CAD61275); maize ZmSUT1 (BBA83501); pea PsSUF4 (ABB30162); rice OsSUT1 (Os03g07480), OsSUT2 (Os12g44380), OsSUT3 (Os10g26740), OsSUT4 (Os02g58080), OsSUT5 (Os02g36700); and sugarcane ShSUT1 (AAV41028). It would be useful to know...”

C7JA46 Os12g0641400 protein from Oryza sativa subsp. japonica
31% identity, 10% coverage

• Quantitative iTRAQ-based proteomic analysis of rice grains to assess high night temperature stress
  Zhang, Proteomics 2017
  • “...1.579 3.366 0.469 Transport Q2R237 LOC4350785 Secindependent protein translocase protein TATB, chloroplastic 5.125 1.199 4.275 C7JA46 LOC9266530 Sucrose transport protein SUT2 2.573 0.651 3.954 Q69XN2 P0012B02.41 Putative yip1 interacting factor 1.495 0.445 3.359 Q6ZCC9 LOC4344489 Uncharacterized acetyltransferase At3g50280 0.907 0.425 2.131 Q2R1N0 LOC9266321 UDPglycosyltransferase 72B3 0.402...”

PITG_00917 Glycoside-Pentoside-Hexuronide (GPH):Cation Symporter Family from Phytophthora infestans T30-4
30% identity, 17% coverage

• Bioinformatic inference of specific and general transcription factor binding sites in the plant pathogen Phytophthora infestans
  Seidl, PloS one 2012
  • “...transporter activity, including e.g. a MOP flippase (PITG_00021) as well as a potential sugar transporter (PITG_00917). 10.1371/journal.pone.0051295.g005 Figure 5 Highly abundant cis -regulatory elements. Nucleotide conservation of the five (A-E) highly abundant cis -regulatory motifs is displayed as sequence logos. The location of the motif in...”

SS1G_08794 hypothetical protein from Sclerotinia sclerotiorum 1980 UF-70
26% identity, 35% coverage

• Changes in the Sclerotinia sclerotiorum transcriptome during infection of Brassica napus
  Seifbarghi, BMC genomics 2017
  • “...- - - 2.4 - SS1G_07618 MFS monosaccharide transporter - - - - - 2.1 SS1G_08794 MFS sucrose transporter - - 2.6 - - - SS1G_04208 MFS sugar transporter - - - 4.0 36.7 49.2 SS1G_10413 MFS sugar transporter - - - 2.3 4.6 4.8 SS1G_06751...”

TC 2.A.2.6.2 / Q9A612 The maltose/maltooligosaccharide transporter, MalI (541 aas) from Caulobacter crescentus (see paper)
CC2283 transporter, putative from Caulobacter crescentus CB15
33% identity, 10% coverage

• substrates: Maltooligosaccharides, Maltose
• Glucoamylase of Caulobacter crescentus CB15: cloning and expression in Escherichia coli and functional identification
  Sakaguchi, AMB Express 2014
  • “...metabolism of Caulobacter . In the malA gene cluster, there are six genes, cc2282 , cc2283 , cc2284 , cc2285 , cc2286 and cc2287 that are also described as MalS, MalY, MalI, an -amylase family protein, another -amylase family protein and MalA, resepectively (Neugebauer et al....”
• TonB-dependent maltose transport by Caulobacter crescentus
  Lohmiller, Microbiology (Reading, England) 2008 (PubMed)
  • “...across the cytoplasmic membrane by the MalY protein (CC2283). Maltose transport was induced by maltose and repressed by the MalI protein (CC2284). In addition...”
  • “...pSL2334a DtonB1 V in cc2334a, pSL2283 DmalY V in cc2283, pSL2284 DmalI V in cc2284. These plasmids were introduced into E. coli S17-1 lpir by transformation and...”
• ExbBD-dependent transport of maltodextrins through the novel MalA protein across the outer membrane of Caulobacter crescentus
  Neugebauer, Journal of bacteriology 2005
  • “...upstream of cc2286 and malA which controls transcription of cc2283 to cc2286 and in the opposite direction transcription of malA. It is likely that these genes...”
  • “...binding to the cytoplasmic membrane transporter encoded by cc2283. Dependence of MalA transport activity on ExbB ExbD. To test whether maltodextrin uptake...”

Shew_1874 major facilitator transporter from Shewanella loihica PV-4
24% identity, 19% coverage

• Validating regulatory predictions from diverse bacteria with mutant fitness data
  Sagawa, PloS one 2017
  • “...However, malR s fitness pattern is strongly correlated with the fitness pattern of malT ( Shew_1874 ) in Shewanella loihica with cofitness of 0.94 and rank of 1, as demonstrated in Fig 5 . Similar fitness patterns are also seen in Shewanella sp. ANA-3 and Shewanella...”

PITG_00908 Glycoside-Pentoside-Hexuronide (GPH):Cation Symporter Family from Phytophthora infestans T30-4
33% identity, 15% coverage

• Dominance of Mating Type A1 and Indication of Epigenetic Effects During Early Stages of Mating in Phytophthora infestans
  Tzelepis, Frontiers in microbiology 2020
  • “...in energy production and metabolism, such as FAD-dependent oxidoreductase ( PITG_03815 ) and dehydrogenases ( PITG_00908 , PITG_10290 ) ( Supplementary Table S4 ). Genes that encoded ATP-binding cassette proteins (ABC transporters; PITG_07717 , PITG_07716 , PITG_04787 ) were also up-regulated in the Swedish mating samples,...”

CA265_RS24665 maltose transporter MalT from Pedobacter sp. GW460-11-11-14-LB5
25% identity, 25% coverage

• mutant phenotype: Specifically important for maltose utilization.

GFO_2136 major facilitator superfamily permease-possibl y alpha-glucoside transporter from Gramella forsetii KT0803
28% identity, 17% coverage

• Functional characterization of polysaccharide utilization loci in the marine Bacteroidetes 'Gramella forsetii' KT0803
  Kabisch, The ISME journal 2014
  • “...the regulated secondary carriers are specific for hexuronate/hexarate (GFO_1159, upregulated in alginate), alpha-glucosides and galactose/glucose (GFO_2136 and 3326, both exclusively detected in glucose cultures). In contrast, high numbers of ATP-binding cassette (ABC) transporters (20 of 28 genes) were found in the proteome of all examined substrates,...”

New Search

Statistics

How It Works

PaperBLAST builds a database of protein sequences that are linked to scientific articles. These links come from automated text searches against the articles in EuropePMC and from manually-curated information from GeneRIF, UniProtKB/Swiss-Prot, BRENDA, CAZy (as made available by dbCAN), BioLiP, CharProtDB, MetaCyc, EcoCyc, TCDB, REBASE, the Fitness Browser, and a subset of the European Nucleotide Archive with the /experiment tag. Given this database and a protein sequence query, PaperBLAST uses protein-protein BLAST to find similar sequences with E < 0.001.

To build the database, we query EuropePMC with locus tags, with RefSeq protein identifiers, and with UniProt accessions. We obtain the locus tags from RefSeq or from MicrobesOnline. We use queries of the form "locus_tag AND genus_name" to try to ensure that the paper is actually discussing that gene. Because EuropePMC indexes most recent biomedical papers, even if they are not open access, some of the links may be to papers that you cannot read or that our computers cannot read. We query each of these identifiers that appears in the open access part of EuropePMC, as well as every locus tag that appears in the 500 most-referenced genomes, so that a gene may appear in the PaperBLAST results even though none of the papers that mention it are open access. We also incorporate text-mined links from EuropePMC that link open access articles to UniProt or RefSeq identifiers. (This yields some additional links because EuropePMC uses different heuristics for their text mining than we do.)

For every article that mentions a locus tag, a RefSeq protein identifier, or a UniProt accession, we try to select one or two snippets of text that refer to the protein. If we cannot get access to the full text, we try to select a snippet from the abstract, but unfortunately, unique identifiers such as locus tags are rarely provided in abstracts.

PaperBLAST also incorporates manually-curated protein functions:

• Proteins from NCBI's RefSeq are included if a GeneRIF entry links the gene to an article in PubMed^®. GeneRIF also provides a short summary of the article's claim about the protein, which is shown instead of a snippet.
• Proteins from Swiss-Prot (the curated part of UniProt) are included if the curators identified experimental evidence for the protein's function (evidence code ECO:0000269). For these proteins, the fields of the Swiss-Prot entry that describe the protein's function are shown (with bold headings).
• Proteins from BRENDA, a curated database of enzymes, are included if they are linked to a paper in PubMed and their full sequence is known.
• Every protein from the non-redundant subset of BioLiP, a database of ligand-binding sites and catalytic residues in protein structures, is included. Since BioLiP itself does not include descriptions of the proteins, those are taken from the Protein Data Bank. Descriptions from PDB rely on the original submitter of the structure and cannot be updated by others, so they may be less reliable. (For SitesBLAST and Sites on a Tree, we use a larger subset of BioLiP so that every ligand is represented among a group of structures with similar sequences, but for PaperBLAST, we use the non-redundant set provided by BioLiP.)
• Every protein from EcoCyc, a curated database of the proteins in Escherichia coli K-12, is included, regardless of whether they are characterized or not.
• Proteins from the MetaCyc metabolic pathway database are included if they are linked to a paper in PubMed and their full sequence is known.
• Proteins from the Transport Classification Database (TCDB) are included if they have known substrate(s), have reference(s), and are not described as uncharacterized or putative. (Some of the references are not visible on the PaperBLAST web site.)
• Every protein from CharProtDB, a database of experimentally characterized protein annotations, is included.
• Proteins from the CAZy database of carbohydrate-active enzymes are included if they are associated with an Enzyme Classification number. Even though CAZy does not provide links from individual protein sequences to papers, these should all be experimentally-characterized proteins.
• Proteins from the REBASE database of restriction enzymes are included if they have known specificity.
• Every protein with an evidence-based reannotation (based on mutant phenotypes) in the Fitness Browser is included.
• Sequence-specific transcription factors (including sigma factors and DNA-binding response regulators) with experimentally-determined DNA binding sites from the PRODORIC database of gene regulation in prokaryotes.
• Putative transcription factors from RegPrecise that have manually-curated predictions for their binding sites. These predictions are based on conserved putative regulatory sites across genomes that contain similar transcription factors, so PaperBLAST clusters the TFs at 70% identity and retains just one member of each cluster.
• Coding sequence (CDS) features from the European Nucleotide Archive (ENA) are included if the /experiment tag is set (implying that there is experimental evidence for the annotation), the nucleotide entry links to paper(s) in PubMed, and the nucleotide entry is from the STD data class (implying that these are targeted annotated sequences, not from shotgun sequencing). Also, to filter out genes whose transcription or translation was detected, but whose function was not studied, nucleotide entries or papers with more than 25 such proteins are excluded. Descriptions from ENA rely on the original submitter of the sequence and cannot be updated by others, so they may be less reliable.

Except for GeneRIF and ENA, the curated entries include a short curated description of the protein's function. For entries from BioLiP, the protein's function may not be known beyond binding to the ligand. Many of these entries also link to articles in PubMed.

For more information see the PaperBLAST paper (mSystems 2017) or the code. You can download PaperBLAST's database here.

Changes to PaperBLAST since the paper was written:

• November 2023: incorporated PRODORIC and RegPrecise. Many PRODORIC entries were not linked to a protein sequence (no UniProt identifier), so we added this information.
• February 2023: BioLiP changed their download format. PaperBLAST now includes their non-redundant subset. SitesBLAST and Sites on a Tree use a larger non-redundant subset that ensures that every ligand is represented within each cluster. This should ensure that every binding site is represented.
• June 2022: incorporated some coding sequences from ENA with the /experiment tag.
• March 2022: incorporated BioLiP.
• April 2020: incorporated TCDB.
• April 2019: EuropePMC now returns table entries in their search results. This has expanded PaperBLAST's database, but most of the new entries are of low relevance, and the resulting snippets are often just lists of locus tags with annotations.
• February 2018: the alignment page reports the conservation of the hit's functional sites (if available from from Swiss-Prot or UniProt)
• January 2018: incorporated BRENDA.
• December 2017: incorporated MetaCyc, CharProtDB, CAZy, REBASE, and the reannotations from the Fitness Browser.
• September 2017: EuropePMC no longer returns some table entries in their search results. This has shrunk PaperBLAST's database, but has also reduced the number of low-relevance hits.

Many of these changes are described in Interactive tools for functional annotation of bacterial genomes.

Secrets

PaperBLAST cannot provide snippets for many of the papers that are published in non-open-access journals. This limitation applies even if the paper is marked as "free" on the publisher's web site and is available in PubmedCentral or EuropePMC. If a journal that you publish in is marked as "secret," please consider publishing elsewhere.

Omissions from the PaperBLAST Database

Many important articles are missing from PaperBLAST, either because the article's full text is not in EuropePMC (as for many older articles), or because the paper does not mention a protein identifier such as a locus tag, or because of PaperBLAST's heuristics. If you notice an article that characterizes a protein's function but is missing from PaperBLAST, please notify the curators at UniProt or add an entry to GeneRIF. Entries in either of these databases will eventually be incorporated into PaperBLAST. Note that to add an entry to UniProt, you will need to find the UniProt identifier for the protein. If the protein is not already in UniProt, you can ask them to create an entry. To add an entry to GeneRIF, you will need an NCBI Gene identifier, but unfortunately many prokaryotic proteins in RefSeq do not have corresponding Gene identifers.

References

PaperBLAST: Text-mining papers for information about homologs.
M. N. Price and A. P. Arkin (2017). mSystems, 10.1128/mSystems.00039-17.

Europe PMC in 2017.
M. Levchenko et al (2017). Nucleic Acids Research, 10.1093/nar/gkx1005.

Gene indexing: characterization and analysis of NLM's GeneRIFs.
J. A. Mitchell et al (2003). AMIA Annu Symp Proc 2003:460-464.

UniProt: the universal protein knowledgebase.
The UniProt Consortium (2016). Nucleic Acids Research, 10.1093/nar/gkw1099.

BRENDA in 2017: new perspectives and new tools in BRENDA.
S. Placzek et al (2017). Nucleic Acids Research, 10.1093/nar/gkw952.

The EcoCyc database: reflecting new knowledge about Escherichia coli K-12.
I. M. Keeseler et al (2016). Nucleic Acids Research, 10.1093/nar/gkw1003.

The MetaCyc database of metabolic pathways and enzymes.
R. Caspi et al (2018). Nucleic Acids Research, 10.1093/nar/gkx935.

CharProtDB: a database of experimentally characterized protein annotations.
R. Madupu et al (2012). Nucleic Acids Research, 10.1093/nar/gkr1133.

The carbohydrate-active enzymes database (CAZy) in 2013.
V. Lombard et al (2014). Nucleic Acids Research, 10.1093/nar/gkt1178.

The Transporter Classification Database (TCDB): recent advances
M. H. Saier, Jr. et al (2016). Nucleic Acids Research, 10.1093/nar/gkv1103.

REBASE - a database for DNA restriction and modification: enzymes, genes and genomes.
R. J. Roberts et al (2015). Nucleic Acids Research, 10.1093/nar/gku1046.

Deep annotation of protein function across diverse bacteria from mutant phenotypes.
M. N. Price et al (2016). bioRxiv, 10.1101/072470.